From e24efcac8b67baa9454bf27631e5e49f898a88d4 Mon Sep 17 00:00:00 2001 From: "dependabot[bot]" <49699333+dependabot[bot]@users.noreply.github.com> Date: Mon, 11 Mar 2024 10:12:06 +0000 Subject: [chore]: Bump github.com/gin-contrib/cors from 1.5.0 to 1.7.0 (#2745) --- vendor/github.com/klauspost/cpuid/v2/cpuid.go | 427 +++++++++++---------- vendor/github.com/klauspost/cpuid/v2/detect_x86.go | 1 + .../klauspost/cpuid/v2/featureid_string.go | 289 +++++++------- 3 files changed, 382 insertions(+), 335 deletions(-) (limited to 'vendor/github.com/klauspost/cpuid/v2') diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go index 15b760337..805f5e7b4 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -67,195 +67,200 @@ const ( // Keep index -1 as unknown UNKNOWN = -1 - // Add features - ADX FeatureID = iota // Intel ADX (Multi-Precision Add-Carry Instruction Extensions) - AESNI // Advanced Encryption Standard New Instructions - AMD3DNOW // AMD 3DNOW - AMD3DNOWEXT // AMD 3DNowExt - AMXBF16 // Tile computational operations on BFLOAT16 numbers - AMXFP16 // Tile computational operations on FP16 numbers - AMXINT8 // Tile computational operations on 8-bit integers - AMXTILE // Tile architecture - APX_F // Intel APX - AVX // AVX functions - AVX10 // If set the Intel AVX10 Converged Vector ISA is supported - AVX10_128 // If set indicates that AVX10 128-bit vector support is present - AVX10_256 // If set indicates that AVX10 256-bit vector support is present - AVX10_512 // If set indicates that AVX10 512-bit vector support is present - AVX2 // AVX2 functions - AVX512BF16 // AVX-512 BFLOAT16 Instructions - AVX512BITALG // AVX-512 Bit Algorithms - AVX512BW // AVX-512 Byte and Word Instructions - AVX512CD // AVX-512 Conflict Detection Instructions - AVX512DQ // AVX-512 Doubleword and Quadword Instructions - AVX512ER // AVX-512 Exponential and Reciprocal Instructions - AVX512F // AVX-512 Foundation - AVX512FP16 // AVX-512 FP16 Instructions - AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions - AVX512PF // AVX-512 Prefetch Instructions - AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions - AVX512VBMI2 // AVX-512 Vector Bit Manipulation Instructions, Version 2 - AVX512VL // AVX-512 Vector Length Extensions - AVX512VNNI // AVX-512 Vector Neural Network Instructions - AVX512VP2INTERSECT // AVX-512 Intersect for D/Q - AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword - AVXIFMA // AVX-IFMA instructions - AVXNECONVERT // AVX-NE-CONVERT instructions - AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one - AVXVNNI // AVX (VEX encoded) VNNI neural network instructions - AVXVNNIINT8 // AVX-VNNI-INT8 instructions - BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 - BMI1 // Bit Manipulation Instruction Set 1 - BMI2 // Bit Manipulation Instruction Set 2 - CETIBT // Intel CET Indirect Branch Tracking - CETSS // Intel CET Shadow Stack - CLDEMOTE // Cache Line Demote - CLMUL // Carry-less Multiplication - CLZERO // CLZERO instruction supported - CMOV // i686 CMOV - CMPCCXADD // CMPCCXADD instructions - CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB - CMPXCHG8 // CMPXCHG8 instruction - CPBOOST // Core Performance Boost - CPPC // AMD: Collaborative Processor Performance Control - CX16 // CMPXCHG16B Instruction - EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ - ENQCMD // Enqueue Command - ERMS // Enhanced REP MOVSB/STOSB - F16C // Half-precision floating-point conversion - FLUSH_L1D // Flush L1D cache - FMA3 // Intel FMA 3. Does not imply AVX. - FMA4 // Bulldozer FMA4 functions - FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide - FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide - FSRM // Fast Short Rep Mov - FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9 - FXSROPT // FXSAVE/FXRSTOR optimizations - GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. - HLE // Hardware Lock Elision - HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR - HTT // Hyperthreading (enabled) - HWA // Hardware assert supported. Indicates support for MSRC001_10 - HYBRID_CPU // This part has CPUs of more than one type. - HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors - IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel) - IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR - IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) - IBRS // AMD: Indirect Branch Restricted Speculation - IBRS_PREFERRED // AMD: IBRS is preferred over software solution - IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection - IBS // Instruction Based Sampling (AMD) - IBSBRNTRGT // Instruction Based Sampling Feature (AMD) - IBSFETCHSAM // Instruction Based Sampling Feature (AMD) - IBSFFV // Instruction Based Sampling Feature (AMD) - IBSOPCNT // Instruction Based Sampling Feature (AMD) - IBSOPCNTEXT // Instruction Based Sampling Feature (AMD) - IBSOPSAM // Instruction Based Sampling Feature (AMD) - IBSRDWROPCNT // Instruction Based Sampling Feature (AMD) - IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD) - IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported - IBS_OPDATA4 // AMD: IBS op data 4 MSR supported - IBS_OPFUSE // AMD: Indicates support for IbsOpFuse - IBS_PREVENTHOST // Disallowing IBS use by the host supported - IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4 - IDPRED_CTRL // IPRED_DIS - INT_WBINVD // WBINVD/WBNOINVD are interruptible. - INVLPGB // NVLPGB and TLBSYNC instruction supported - KEYLOCKER // Key locker - KEYLOCKERW // Key locker wide - LAHF // LAHF/SAHF in long mode - LAM // If set, CPU supports Linear Address Masking - LBRVIRT // LBR virtualization - LZCNT // LZCNT instruction - MCAOVERFLOW // MCA overflow recovery support. - MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. - MCOMMIT // MCOMMIT instruction supported - MD_CLEAR // VERW clears CPU buffers - MMX // standard MMX - MMXEXT // SSE integer functions or AMD MMX ext - MOVBE // MOVBE instruction (big-endian) - MOVDIR64B // Move 64 Bytes as Direct Store - MOVDIRI // Move Doubleword as Direct Store - MOVSB_ZL // Fast Zero-Length MOVSB - MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD - MPX // Intel MPX (Memory Protection Extensions) - MSRIRC // Instruction Retired Counter MSR available - MSRLIST // Read/Write List of Model Specific Registers - MSR_PAGEFLUSH // Page Flush MSR available - NRIPS // Indicates support for NRIP save on VMEXIT - NX // NX (No-Execute) bit - OSXSAVE // XSAVE enabled by OS - PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption - POPCNT // POPCNT instruction - PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled - PREFETCHI // PREFETCHIT0/1 instructions - PSFD // Predictive Store Forward Disable - RDPRU // RDPRU instruction supported - RDRAND // RDRAND instruction is available - RDSEED // RDSEED instruction is available - RDTSCP // RDTSCP Instruction - RRSBA_CTRL // Restricted RSB Alternate - RTM // Restricted Transactional Memory - RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort. - SERIALIZE // Serialize Instruction Execution - SEV // AMD Secure Encrypted Virtualization supported - SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host - SEV_ALTERNATIVE // AMD SEV Alternate Injection supported - SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests - SEV_ES // AMD SEV Encrypted State supported - SEV_RESTRICTED // AMD SEV Restricted Injection supported - SEV_SNP // AMD SEV Secure Nested Paging supported - SGX // Software Guard Extensions - SGXLC // Software Guard Extensions Launch Control - SHA // Intel SHA Extensions - SME // AMD Secure Memory Encryption supported - SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced - SPEC_CTRL_SSBD // Speculative Store Bypass Disable - SRBDS_CTRL // SRBDS mitigation MSR available - SSE // SSE functions - SSE2 // P4 SSE functions - SSE3 // Prescott SSE3 functions - SSE4 // Penryn SSE4.1 functions - SSE42 // Nehalem SSE4.2 functions - SSE4A // AMD Barcelona microarchitecture SSE4a instructions - SSSE3 // Conroe SSSE3 functions - STIBP // Single Thread Indirect Branch Predictors - STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On - STOSB_SHORT // Fast short STOSB - SUCCOR // Software uncorrectable error containment and recovery capability. - SVM // AMD Secure Virtual Machine - SVMDA // Indicates support for the SVM decode assists. - SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control - SVML // AMD SVM lock. Indicates support for SVM-Lock. - SVMNP // AMD SVM nested paging - SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter - SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold - SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions. - SYSEE // SYSENTER and SYSEXIT instructions - TBM // AMD Trailing Bit Manipulation - TDX_GUEST // Intel Trust Domain Extensions Guest - TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations - TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. - TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. - TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 - TSXLDTRK // Intel TSX Suspend Load Address Tracking - VAES // Vector AES. AVX(512) versions requires additional checks. - VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits. - VMPL // AMD VM Permission Levels supported - VMSA_REGPROT // AMD VMSA Register Protection supported - VMX // Virtual Machine Extensions - VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. - VTE // AMD Virtual Transparent Encryption supported - WAITPKG // TPAUSE, UMONITOR, UMWAIT - WBNOINVD // Write Back and Do Not Invalidate Cache - WRMSRNS // Non-Serializing Write to Model Specific Register - X87 // FPU - XGETBV1 // Supports XGETBV with ECX = 1 - XOP // Bulldozer XOP functions - XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV - XSAVEC // Supports XSAVEC and the compacted form of XRSTOR. - XSAVEOPT // XSAVEOPT available - XSAVES // Supports XSAVES/XRSTORS and IA32_XSS + // x86 features + ADX FeatureID = iota // Intel ADX (Multi-Precision Add-Carry Instruction Extensions) + AESNI // Advanced Encryption Standard New Instructions + AMD3DNOW // AMD 3DNOW + AMD3DNOWEXT // AMD 3DNowExt + AMXBF16 // Tile computational operations on BFLOAT16 numbers + AMXFP16 // Tile computational operations on FP16 numbers + AMXINT8 // Tile computational operations on 8-bit integers + AMXTILE // Tile architecture + APX_F // Intel APX + AVX // AVX functions + AVX10 // If set the Intel AVX10 Converged Vector ISA is supported + AVX10_128 // If set indicates that AVX10 128-bit vector support is present + AVX10_256 // If set indicates that AVX10 256-bit vector support is present + AVX10_512 // If set indicates that AVX10 512-bit vector support is present + AVX2 // AVX2 functions + AVX512BF16 // AVX-512 BFLOAT16 Instructions + AVX512BITALG // AVX-512 Bit Algorithms + AVX512BW // AVX-512 Byte and Word Instructions + AVX512CD // AVX-512 Conflict Detection Instructions + AVX512DQ // AVX-512 Doubleword and Quadword Instructions + AVX512ER // AVX-512 Exponential and Reciprocal Instructions + AVX512F // AVX-512 Foundation + AVX512FP16 // AVX-512 FP16 Instructions + AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions + AVX512PF // AVX-512 Prefetch Instructions + AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions + AVX512VBMI2 // AVX-512 Vector Bit Manipulation Instructions, Version 2 + AVX512VL // AVX-512 Vector Length Extensions + AVX512VNNI // AVX-512 Vector Neural Network Instructions + AVX512VP2INTERSECT // AVX-512 Intersect for D/Q + AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword + AVXIFMA // AVX-IFMA instructions + AVXNECONVERT // AVX-NE-CONVERT instructions + AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one + AVXVNNI // AVX (VEX encoded) VNNI neural network instructions + AVXVNNIINT8 // AVX-VNNI-INT8 instructions + BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 + BMI1 // Bit Manipulation Instruction Set 1 + BMI2 // Bit Manipulation Instruction Set 2 + CETIBT // Intel CET Indirect Branch Tracking + CETSS // Intel CET Shadow Stack + CLDEMOTE // Cache Line Demote + CLMUL // Carry-less Multiplication + CLZERO // CLZERO instruction supported + CMOV // i686 CMOV + CMPCCXADD // CMPCCXADD instructions + CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB + CMPXCHG8 // CMPXCHG8 instruction + CPBOOST // Core Performance Boost + CPPC // AMD: Collaborative Processor Performance Control + CX16 // CMPXCHG16B Instruction + EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ + ENQCMD // Enqueue Command + ERMS // Enhanced REP MOVSB/STOSB + F16C // Half-precision floating-point conversion + FLUSH_L1D // Flush L1D cache + FMA3 // Intel FMA 3. Does not imply AVX. + FMA4 // Bulldozer FMA4 functions + FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide + FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide + FSRM // Fast Short Rep Mov + FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9 + FXSROPT // FXSAVE/FXRSTOR optimizations + GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. + HLE // Hardware Lock Elision + HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR + HTT // Hyperthreading (enabled) + HWA // Hardware assert supported. Indicates support for MSRC001_10 + HYBRID_CPU // This part has CPUs of more than one type. + HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors + IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel) + IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR + IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) + IBPB_BRTYPE // Indicates that MSR 49h (PRED_CMD) bit 0 (IBPB) flushes all branch type predictions from the CPU branch predictor + IBRS // AMD: Indirect Branch Restricted Speculation + IBRS_PREFERRED // AMD: IBRS is preferred over software solution + IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection + IBS // Instruction Based Sampling (AMD) + IBSBRNTRGT // Instruction Based Sampling Feature (AMD) + IBSFETCHSAM // Instruction Based Sampling Feature (AMD) + IBSFFV // Instruction Based Sampling Feature (AMD) + IBSOPCNT // Instruction Based Sampling Feature (AMD) + IBSOPCNTEXT // Instruction Based Sampling Feature (AMD) + IBSOPSAM // Instruction Based Sampling Feature (AMD) + IBSRDWROPCNT // Instruction Based Sampling Feature (AMD) + IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD) + IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported + IBS_OPDATA4 // AMD: IBS op data 4 MSR supported + IBS_OPFUSE // AMD: Indicates support for IbsOpFuse + IBS_PREVENTHOST // Disallowing IBS use by the host supported + IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4 + IDPRED_CTRL // IPRED_DIS + INT_WBINVD // WBINVD/WBNOINVD are interruptible. + INVLPGB // NVLPGB and TLBSYNC instruction supported + KEYLOCKER // Key locker + KEYLOCKERW // Key locker wide + LAHF // LAHF/SAHF in long mode + LAM // If set, CPU supports Linear Address Masking + LBRVIRT // LBR virtualization + LZCNT // LZCNT instruction + MCAOVERFLOW // MCA overflow recovery support. + MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. + MCOMMIT // MCOMMIT instruction supported + MD_CLEAR // VERW clears CPU buffers + MMX // standard MMX + MMXEXT // SSE integer functions or AMD MMX ext + MOVBE // MOVBE instruction (big-endian) + MOVDIR64B // Move 64 Bytes as Direct Store + MOVDIRI // Move Doubleword as Direct Store + MOVSB_ZL // Fast Zero-Length MOVSB + MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD + MPX // Intel MPX (Memory Protection Extensions) + MSRIRC // Instruction Retired Counter MSR available + MSRLIST // Read/Write List of Model Specific Registers + MSR_PAGEFLUSH // Page Flush MSR available + NRIPS // Indicates support for NRIP save on VMEXIT + NX // NX (No-Execute) bit + OSXSAVE // XSAVE enabled by OS + PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption + POPCNT // POPCNT instruction + PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled + PREFETCHI // PREFETCHIT0/1 instructions + PSFD // Predictive Store Forward Disable + RDPRU // RDPRU instruction supported + RDRAND // RDRAND instruction is available + RDSEED // RDSEED instruction is available + RDTSCP // RDTSCP Instruction + RRSBA_CTRL // Restricted RSB Alternate + RTM // Restricted Transactional Memory + RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort. + SBPB // Indicates support for the Selective Branch Predictor Barrier + SERIALIZE // Serialize Instruction Execution + SEV // AMD Secure Encrypted Virtualization supported + SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host + SEV_ALTERNATIVE // AMD SEV Alternate Injection supported + SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests + SEV_ES // AMD SEV Encrypted State supported + SEV_RESTRICTED // AMD SEV Restricted Injection supported + SEV_SNP // AMD SEV Secure Nested Paging supported + SGX // Software Guard Extensions + SGXLC // Software Guard Extensions Launch Control + SHA // Intel SHA Extensions + SME // AMD Secure Memory Encryption supported + SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced + SPEC_CTRL_SSBD // Speculative Store Bypass Disable + SRBDS_CTRL // SRBDS mitigation MSR available + SRSO_MSR_FIX // Indicates that software may use MSR BP_CFG[BpSpecReduce] to mitigate SRSO. + SRSO_NO // Indicates the CPU is not subject to the SRSO vulnerability + SRSO_USER_KERNEL_NO // Indicates the CPU is not subject to the SRSO vulnerability across user/kernel boundaries + SSE // SSE functions + SSE2 // P4 SSE functions + SSE3 // Prescott SSE3 functions + SSE4 // Penryn SSE4.1 functions + SSE42 // Nehalem SSE4.2 functions + SSE4A // AMD Barcelona microarchitecture SSE4a instructions + SSSE3 // Conroe SSSE3 functions + STIBP // Single Thread Indirect Branch Predictors + STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On + STOSB_SHORT // Fast short STOSB + SUCCOR // Software uncorrectable error containment and recovery capability. + SVM // AMD Secure Virtual Machine + SVMDA // Indicates support for the SVM decode assists. + SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control + SVML // AMD SVM lock. Indicates support for SVM-Lock. + SVMNP // AMD SVM nested paging + SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter + SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold + SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions. + SYSEE // SYSENTER and SYSEXIT instructions + TBM // AMD Trailing Bit Manipulation + TDX_GUEST // Intel Trust Domain Extensions Guest + TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations + TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. + TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. + TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 + TSXLDTRK // Intel TSX Suspend Load Address Tracking + VAES // Vector AES. AVX(512) versions requires additional checks. + VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits. + VMPL // AMD VM Permission Levels supported + VMSA_REGPROT // AMD VMSA Register Protection supported + VMX // Virtual Machine Extensions + VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. + VTE // AMD Virtual Transparent Encryption supported + WAITPKG // TPAUSE, UMONITOR, UMWAIT + WBNOINVD // Write Back and Do Not Invalidate Cache + WRMSRNS // Non-Serializing Write to Model Specific Register + X87 // FPU + XGETBV1 // Supports XGETBV with ECX = 1 + XOP // Bulldozer XOP functions + XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV + XSAVEC // Supports XSAVEC and the compacted form of XRSTOR. + XSAVEOPT // XSAVEOPT available + XSAVES // Supports XSAVES/XRSTORS and IA32_XSS // ARM features: AESARM // AES instructions @@ -309,10 +314,11 @@ type CPUInfo struct { L2 int // L2 Cache (per core or shared). Will be -1 if undetected L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected } - SGX SGXSupport - AVX10Level uint8 - maxFunc uint32 - maxExFunc uint32 + SGX SGXSupport + AMDMemEncryption AMDMemEncryptionSupport + AVX10Level uint8 + maxFunc uint32 + maxExFunc uint32 } var cpuid func(op uint32) (eax, ebx, ecx, edx uint32) @@ -1079,6 +1085,32 @@ func hasSGX(available, lc bool) (rval SGXSupport) { return } +type AMDMemEncryptionSupport struct { + Available bool + CBitPossition uint32 + NumVMPL uint32 + PhysAddrReduction uint32 + NumEntryptedGuests uint32 + MinSevNoEsAsid uint32 +} + +func hasAMDMemEncryption(available bool) (rval AMDMemEncryptionSupport) { + rval.Available = available + if !available { + return + } + + _, b, c, d := cpuidex(0x8000001f, 0) + + rval.CBitPossition = b & 0x3f + rval.PhysAddrReduction = (b >> 6) & 0x3F + rval.NumVMPL = (b >> 12) & 0xf + rval.NumEntryptedGuests = c + rval.MinSevNoEsAsid = d + + return +} + func support() flagSet { var fs flagSet mfi := maxFunctionID() @@ -1418,6 +1450,15 @@ func support() flagSet { fs.setIf((a>>24)&1 == 1, VMSA_REGPROT) } + if maxExtendedFunction() >= 0x80000021 && vend == AMD { + a, _, _, _ := cpuid(0x80000021) + fs.setIf((a>>31)&1 == 1, SRSO_MSR_FIX) + fs.setIf((a>>30)&1 == 1, SRSO_USER_KERNEL_NO) + fs.setIf((a>>29)&1 == 1, SRSO_NO) + fs.setIf((a>>28)&1 == 1, IBPB_BRTYPE) + fs.setIf((a>>27)&1 == 1, SBPB) + } + if mfi >= 0x20 { // Microsoft has decided to purposefully hide the information // of the guest TEE when VMs are being created using Hyper-V. diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go index c7dfa125d..799b400c2 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -27,6 +27,7 @@ func addInfo(c *CPUInfo, safe bool) { c.Family, c.Model, c.Stepping = familyModel() c.featureSet = support() c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC)) + c.AMDMemEncryption = hasAMDMemEncryption(c.featureSet.inSet(SME) || c.featureSet.inSet(SEV)) c.ThreadsPerCore = threadsPerCore() c.LogicalCores = logicalCores() c.PhysicalCores = physicalCores() diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go index 43bd05f51..57a085a53 100644 --- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -81,152 +81,157 @@ func _() { _ = x[IA32_ARCH_CAP-71] _ = x[IA32_CORE_CAP-72] _ = x[IBPB-73] - _ = x[IBRS-74] - _ = x[IBRS_PREFERRED-75] - _ = x[IBRS_PROVIDES_SMP-76] - _ = x[IBS-77] - _ = x[IBSBRNTRGT-78] - _ = x[IBSFETCHSAM-79] - _ = x[IBSFFV-80] - _ = x[IBSOPCNT-81] - _ = x[IBSOPCNTEXT-82] - _ = x[IBSOPSAM-83] - _ = x[IBSRDWROPCNT-84] - _ = x[IBSRIPINVALIDCHK-85] - _ = x[IBS_FETCH_CTLX-86] - _ = x[IBS_OPDATA4-87] - _ = x[IBS_OPFUSE-88] - _ = x[IBS_PREVENTHOST-89] - _ = x[IBS_ZEN4-90] - _ = x[IDPRED_CTRL-91] - _ = x[INT_WBINVD-92] - _ = x[INVLPGB-93] - _ = x[KEYLOCKER-94] - _ = x[KEYLOCKERW-95] - _ = x[LAHF-96] - _ = x[LAM-97] - _ = x[LBRVIRT-98] - _ = x[LZCNT-99] - _ = x[MCAOVERFLOW-100] - _ = x[MCDT_NO-101] - _ = x[MCOMMIT-102] - _ = x[MD_CLEAR-103] - _ = x[MMX-104] - _ = x[MMXEXT-105] - _ = x[MOVBE-106] - _ = x[MOVDIR64B-107] - _ = x[MOVDIRI-108] - _ = x[MOVSB_ZL-109] - _ = x[MOVU-110] - _ = x[MPX-111] - _ = x[MSRIRC-112] - _ = x[MSRLIST-113] - _ = x[MSR_PAGEFLUSH-114] - _ = x[NRIPS-115] - _ = x[NX-116] - _ = x[OSXSAVE-117] - _ = x[PCONFIG-118] - _ = x[POPCNT-119] - _ = x[PPIN-120] - _ = x[PREFETCHI-121] - _ = x[PSFD-122] - _ = x[RDPRU-123] - _ = x[RDRAND-124] - _ = x[RDSEED-125] - _ = x[RDTSCP-126] - _ = x[RRSBA_CTRL-127] - _ = x[RTM-128] - _ = x[RTM_ALWAYS_ABORT-129] - _ = x[SERIALIZE-130] - _ = x[SEV-131] - _ = x[SEV_64BIT-132] - _ = x[SEV_ALTERNATIVE-133] - _ = x[SEV_DEBUGSWAP-134] - _ = x[SEV_ES-135] - _ = x[SEV_RESTRICTED-136] - _ = x[SEV_SNP-137] - _ = x[SGX-138] - _ = x[SGXLC-139] - _ = x[SHA-140] - _ = x[SME-141] - _ = x[SME_COHERENT-142] - _ = x[SPEC_CTRL_SSBD-143] - _ = x[SRBDS_CTRL-144] - _ = x[SSE-145] - _ = x[SSE2-146] - _ = x[SSE3-147] - _ = x[SSE4-148] - _ = x[SSE42-149] - _ = x[SSE4A-150] - _ = x[SSSE3-151] - _ = x[STIBP-152] - _ = x[STIBP_ALWAYSON-153] - _ = x[STOSB_SHORT-154] - _ = x[SUCCOR-155] - _ = x[SVM-156] - _ = x[SVMDA-157] - _ = x[SVMFBASID-158] - _ = x[SVML-159] - _ = x[SVMNP-160] - _ = x[SVMPF-161] - _ = x[SVMPFT-162] - _ = x[SYSCALL-163] - _ = x[SYSEE-164] - _ = x[TBM-165] - _ = x[TDX_GUEST-166] - _ = x[TLB_FLUSH_NESTED-167] - _ = x[TME-168] - _ = x[TOPEXT-169] - _ = x[TSCRATEMSR-170] - _ = x[TSXLDTRK-171] - _ = x[VAES-172] - _ = x[VMCBCLEAN-173] - _ = x[VMPL-174] - _ = x[VMSA_REGPROT-175] - _ = x[VMX-176] - _ = x[VPCLMULQDQ-177] - _ = x[VTE-178] - _ = x[WAITPKG-179] - _ = x[WBNOINVD-180] - _ = x[WRMSRNS-181] - _ = x[X87-182] - _ = x[XGETBV1-183] - _ = x[XOP-184] - _ = x[XSAVE-185] - _ = x[XSAVEC-186] - _ = x[XSAVEOPT-187] - _ = x[XSAVES-188] - _ = x[AESARM-189] - _ = x[ARMCPUID-190] - _ = x[ASIMD-191] - _ = x[ASIMDDP-192] - _ = x[ASIMDHP-193] - _ = x[ASIMDRDM-194] - _ = x[ATOMICS-195] - _ = x[CRC32-196] - _ = x[DCPOP-197] - _ = x[EVTSTRM-198] - _ = x[FCMA-199] - _ = x[FP-200] - _ = x[FPHP-201] - _ = x[GPA-202] - _ = x[JSCVT-203] - _ = x[LRCPC-204] - _ = x[PMULL-205] - _ = x[SHA1-206] - _ = x[SHA2-207] - _ = x[SHA3-208] - _ = x[SHA512-209] - _ = x[SM3-210] - _ = x[SM4-211] - _ = x[SVE-212] - _ = x[lastID-213] + _ = x[IBPB_BRTYPE-74] + _ = x[IBRS-75] + _ = x[IBRS_PREFERRED-76] + _ = x[IBRS_PROVIDES_SMP-77] + _ = x[IBS-78] + _ = x[IBSBRNTRGT-79] + _ = x[IBSFETCHSAM-80] + _ = x[IBSFFV-81] + _ = x[IBSOPCNT-82] + _ = x[IBSOPCNTEXT-83] + _ = x[IBSOPSAM-84] + _ = x[IBSRDWROPCNT-85] + _ = x[IBSRIPINVALIDCHK-86] + _ = x[IBS_FETCH_CTLX-87] + _ = x[IBS_OPDATA4-88] + _ = x[IBS_OPFUSE-89] + _ = x[IBS_PREVENTHOST-90] + _ = x[IBS_ZEN4-91] + _ = x[IDPRED_CTRL-92] + _ = x[INT_WBINVD-93] + _ = x[INVLPGB-94] + _ = x[KEYLOCKER-95] + _ = x[KEYLOCKERW-96] + _ = x[LAHF-97] + _ = x[LAM-98] + _ = x[LBRVIRT-99] + _ = x[LZCNT-100] + _ = x[MCAOVERFLOW-101] + _ = x[MCDT_NO-102] + _ = x[MCOMMIT-103] + _ = x[MD_CLEAR-104] + _ = x[MMX-105] + _ = x[MMXEXT-106] + _ = x[MOVBE-107] + _ = x[MOVDIR64B-108] + _ = x[MOVDIRI-109] + _ = x[MOVSB_ZL-110] + _ = x[MOVU-111] + _ = x[MPX-112] + _ = x[MSRIRC-113] + _ = x[MSRLIST-114] + _ = x[MSR_PAGEFLUSH-115] + _ = x[NRIPS-116] + _ = x[NX-117] + _ = x[OSXSAVE-118] + _ = x[PCONFIG-119] + _ = x[POPCNT-120] + _ = x[PPIN-121] + _ = x[PREFETCHI-122] + _ = x[PSFD-123] + _ = x[RDPRU-124] + _ = x[RDRAND-125] + _ = x[RDSEED-126] + _ = x[RDTSCP-127] + _ = x[RRSBA_CTRL-128] + _ = x[RTM-129] + _ = x[RTM_ALWAYS_ABORT-130] + _ = x[SBPB-131] + _ = x[SERIALIZE-132] + _ = x[SEV-133] + _ = x[SEV_64BIT-134] + _ = x[SEV_ALTERNATIVE-135] + _ = x[SEV_DEBUGSWAP-136] + _ = x[SEV_ES-137] + _ = x[SEV_RESTRICTED-138] + _ = x[SEV_SNP-139] + _ = x[SGX-140] + _ = x[SGXLC-141] + _ = x[SHA-142] + _ = x[SME-143] + _ = x[SME_COHERENT-144] + _ = x[SPEC_CTRL_SSBD-145] + _ = x[SRBDS_CTRL-146] + _ = x[SRSO_MSR_FIX-147] + _ = x[SRSO_NO-148] + _ = x[SRSO_USER_KERNEL_NO-149] + _ = x[SSE-150] + _ = x[SSE2-151] + _ = x[SSE3-152] + _ = x[SSE4-153] + _ = x[SSE42-154] + _ = x[SSE4A-155] + _ = x[SSSE3-156] + _ = x[STIBP-157] + _ = x[STIBP_ALWAYSON-158] + _ = x[STOSB_SHORT-159] + _ = x[SUCCOR-160] + _ = x[SVM-161] + _ = x[SVMDA-162] + _ = x[SVMFBASID-163] + _ = x[SVML-164] + _ = x[SVMNP-165] + _ = x[SVMPF-166] + _ = x[SVMPFT-167] + _ = x[SYSCALL-168] + _ = x[SYSEE-169] + _ = x[TBM-170] + _ = x[TDX_GUEST-171] + _ = x[TLB_FLUSH_NESTED-172] + _ = x[TME-173] + _ = x[TOPEXT-174] + _ = x[TSCRATEMSR-175] + _ = x[TSXLDTRK-176] + _ = x[VAES-177] + _ = x[VMCBCLEAN-178] + _ = x[VMPL-179] + _ = x[VMSA_REGPROT-180] + _ = x[VMX-181] + _ = x[VPCLMULQDQ-182] + _ = x[VTE-183] + _ = x[WAITPKG-184] + _ = x[WBNOINVD-185] + _ = x[WRMSRNS-186] + _ = x[X87-187] + _ = x[XGETBV1-188] + _ = x[XOP-189] + _ = x[XSAVE-190] + _ = x[XSAVEC-191] + _ = x[XSAVEOPT-192] + _ = x[XSAVES-193] + _ = x[AESARM-194] + _ = x[ARMCPUID-195] + _ = x[ASIMD-196] + _ = x[ASIMDDP-197] + _ = x[ASIMDHP-198] + _ = x[ASIMDRDM-199] + _ = x[ATOMICS-200] + _ = x[CRC32-201] + _ = x[DCPOP-202] + _ = x[EVTSTRM-203] + _ = x[FCMA-204] + _ = x[FP-205] + _ = x[FPHP-206] + _ = x[GPA-207] + _ = x[JSCVT-208] + _ = x[LRCPC-209] + _ = x[PMULL-210] + _ = x[SHA1-211] + _ = x[SHA2-212] + _ = x[SHA3-213] + _ = x[SHA512-214] + _ = x[SM3-215] + _ = x[SM4-216] + _ = x[SVE-217] + _ = x[lastID-218] _ = x[firstID-0] } -const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" -var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 319, 323, 327, 333, 338, 346, 351, 357, 361, 370, 388, 396, 403, 407, 411, 425, 431, 435, 439, 448, 452, 456, 461, 466, 470, 474, 481, 485, 488, 494, 497, 500, 510, 520, 533, 546, 550, 554, 568, 585, 588, 598, 609, 615, 623, 634, 642, 654, 670, 684, 695, 705, 720, 728, 739, 749, 756, 765, 775, 779, 782, 789, 794, 805, 812, 819, 827, 830, 836, 841, 850, 857, 865, 869, 872, 878, 885, 898, 903, 905, 912, 919, 925, 929, 938, 942, 947, 953, 959, 965, 975, 978, 994, 1003, 1006, 1015, 1030, 1043, 1049, 1063, 1070, 1073, 1078, 1081, 1084, 1096, 1110, 1120, 1123, 1127, 1131, 1135, 1140, 1145, 1150, 1155, 1169, 1180, 1186, 1189, 1194, 1203, 1207, 1212, 1217, 1223, 1230, 1235, 1238, 1247, 1263, 1266, 1272, 1282, 1290, 1294, 1303, 1307, 1319, 1322, 1332, 1335, 1342, 1350, 1357, 1360, 1367, 1370, 1375, 1381, 1389, 1395, 1401, 1409, 1414, 1421, 1428, 1436, 1443, 1448, 1453, 1460, 1464, 1466, 1470, 1473, 1478, 1483, 1488, 1492, 1496, 1500, 1506, 1509, 1512, 1515, 1521} +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 319, 323, 327, 333, 338, 346, 351, 357, 361, 370, 388, 396, 403, 407, 411, 425, 431, 435, 439, 448, 452, 456, 461, 466, 470, 474, 481, 485, 488, 494, 497, 500, 510, 520, 533, 546, 550, 561, 565, 579, 596, 599, 609, 620, 626, 634, 645, 653, 665, 681, 695, 706, 716, 731, 739, 750, 760, 767, 776, 786, 790, 793, 800, 805, 816, 823, 830, 838, 841, 847, 852, 861, 868, 876, 880, 883, 889, 896, 909, 914, 916, 923, 930, 936, 940, 949, 953, 958, 964, 970, 976, 986, 989, 1005, 1009, 1018, 1021, 1030, 1045, 1058, 1064, 1078, 1085, 1088, 1093, 1096, 1099, 1111, 1125, 1135, 1147, 1154, 1173, 1176, 1180, 1184, 1188, 1193, 1198, 1203, 1208, 1222, 1233, 1239, 1242, 1247, 1256, 1260, 1265, 1270, 1276, 1283, 1288, 1291, 1300, 1316, 1319, 1325, 1335, 1343, 1347, 1356, 1360, 1372, 1375, 1385, 1388, 1395, 1403, 1410, 1413, 1420, 1423, 1428, 1434, 1442, 1448, 1454, 1462, 1467, 1474, 1481, 1489, 1496, 1501, 1506, 1513, 1517, 1519, 1523, 1526, 1531, 1536, 1541, 1545, 1549, 1553, 1559, 1562, 1565, 1568, 1574} func (i FeatureID) String() string { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { -- cgit v1.3