From e24efcac8b67baa9454bf27631e5e49f898a88d4 Mon Sep 17 00:00:00 2001 From: "dependabot[bot]" <49699333+dependabot[bot]@users.noreply.github.com> Date: Mon, 11 Mar 2024 10:12:06 +0000 Subject: [chore]: Bump github.com/gin-contrib/cors from 1.5.0 to 1.7.0 (#2745) --- go.mod | 26 +- go.sum | 56 +- vendor/github.com/bytedance/sonic/README.md | 68 +- vendor/github.com/bytedance/sonic/README_ZH_CN.md | 45 +- vendor/github.com/bytedance/sonic/api.go | 32 +- vendor/github.com/bytedance/sonic/ast/api_amd64.go | 26 +- .../github.com/bytedance/sonic/ast/api_compat.go | 37 +- vendor/github.com/bytedance/sonic/ast/buffer.go | 150 +- vendor/github.com/bytedance/sonic/ast/encode.go | 32 +- vendor/github.com/bytedance/sonic/ast/iterator.go | 14 +- vendor/github.com/bytedance/sonic/ast/node.go | 255 +- vendor/github.com/bytedance/sonic/ast/parser.go | 8 +- vendor/github.com/bytedance/sonic/ast/search.go | 50 + vendor/github.com/bytedance/sonic/compat.go | 2 +- .../bytedance/sonic/decoder/decoder_amd64.go | 2 +- .../bytedance/sonic/decoder/decoder_compat.go | 4 +- .../bytedance/sonic/encoder/encoder_amd64.go | 5 +- .../bytedance/sonic/encoder/encoder_compat.go | 17 +- .../internal/decoder/asm_stubs_amd64_go121.go | 2 +- .../internal/decoder/assembler_regabi_amd64.go | 12 +- .../internal/decoder/assembler_stkabi_amd64.go | 3 +- .../bytedance/sonic/internal/decoder/compiler.go | 45 +- .../sonic/internal/decoder/generic_regabi_amd64.go | 6 +- .../internal/decoder/generic_regabi_amd64_test.s | 2 +- .../bytedance/sonic/internal/decoder/stream.go | 205 +- .../internal/encoder/asm_stubs_amd64_go121.go | 2 +- .../internal/encoder/assembler_regabi_amd64.go | 7 +- .../bytedance/sonic/internal/encoder/compiler.go | 2 +- .../sonic/internal/encoder/debug_go117.go | 2 +- .../bytedance/sonic/internal/encoder/encoder.go | 14 + .../bytedance/sonic/internal/encoder/primitives.go | 6 +- .../bytedance/sonic/internal/encoder/stream.go | 13 +- .../sonic/internal/encoder/stubs_go116.go | 4 - .../sonic/internal/encoder/stubs_go117.go | 4 - .../sonic/internal/encoder/stubs_go120.go | 4 - .../sonic/internal/encoder/stubs_go121.go | 4 - .../sonic/internal/jit/assembler_amd64.go | 12 - .../bytedance/sonic/internal/jit/runtime.go | 7 +- .../bytedance/sonic/internal/rt/asm_amd64.s | 3 +- .../bytedance/sonic/internal/rt/asm_arm64.s | 10 - .../bytedance/sonic/internal/rt/asm_compat.s | 9 + .../bytedance/sonic/internal/rt/fastmem.go | 3 +- .../bytedance/sonic/internal/rt/fastvalue.go | 21 + .../bytedance/sonic/internal/rt/int48.go | 6 +- .../bytedance/sonic/loader/funcdata_go121.go | 4 +- .../bytedance/sonic/loader/funcdata_latest.go | 4 +- .../bytedance/sonic/loader/loader_latest.go | 3 +- .../github.com/bytedance/sonic/loader/mmap_unix.go | 4 +- vendor/github.com/bytedance/sonic/loader/stubs.go | 34 +- vendor/github.com/bytedance/sonic/sonic.go | 5 +- .../github.com/chenzhuoyu/iasm/x86_64/operands.go | 733 ++- vendor/github.com/chenzhuoyu/iasm/x86_64/pools.go | 117 +- .../github.com/chenzhuoyu/iasm/x86_64/program.go | 702 +-- .../github.com/gabriel-vasile/mimetype/README.md | 3 - .../mimetype/internal/magic/binary.go | 38 +- .../mimetype/internal/magic/magic.go | 4 +- .../mimetype/internal/magic/text_csv.go | 18 +- .../github.com/gabriel-vasile/mimetype/mimetype.go | 3 +- .../gabriel-vasile/mimetype/supported_mimes.md | 2 +- vendor/github.com/gin-contrib/cors/config.go | 44 +- vendor/github.com/gin-contrib/cors/cors.go | 32 +- .../go-playground/validator/v10/Makefile | 4 +- .../go-playground/validator/v10/README.md | 3 +- .../go-playground/validator/v10/baked_in.go | 61 +- .../go-playground/validator/v10/cache.go | 7 +- .../github.com/go-playground/validator/v10/doc.go | 7 + .../go-playground/validator/v10/errors.go | 8 +- .../go-playground/validator/v10/options.go | 10 + .../go-playground/validator/v10/regexes.go | 2 + .../github.com/go-playground/validator/v10/util.go | 17 + .../go-playground/validator/v10/validator.go | 56 +- .../validator/v10/validator_instance.go | 30 +- vendor/github.com/klauspost/cpuid/v2/cpuid.go | 427 +- vendor/github.com/klauspost/cpuid/v2/detect_x86.go | 1 + .../klauspost/cpuid/v2/featureid_string.go | 289 +- vendor/github.com/leodido/go-urn/.gitignore | 3 +- vendor/github.com/leodido/go-urn/README.md | 126 +- vendor/github.com/leodido/go-urn/kind.go | 10 + vendor/github.com/leodido/go-urn/machine.go | 6178 +++++++++++++++----- vendor/github.com/leodido/go-urn/machine.go.rl | 283 +- vendor/github.com/leodido/go-urn/makefile | 20 +- vendor/github.com/leodido/go-urn/options.go | 9 + vendor/github.com/leodido/go-urn/parsing_mode.go | 12 + vendor/github.com/leodido/go-urn/scim.go | 48 + .../github.com/leodido/go-urn/scim/schema/type.go | 36 + vendor/github.com/leodido/go-urn/urn.go | 75 +- vendor/github.com/leodido/go-urn/urn8141.go | 30 + vendor/github.com/ugorji/go/codec/cbor.go | 23 +- vendor/github.com/ugorji/go/codec/decode.go | 13 +- vendor/github.com/ugorji/go/codec/encode.go | 11 +- vendor/github.com/ugorji/go/codec/gen.go | 16 +- vendor/github.com/ugorji/go/codec/helper.go | 31 +- vendor/github.com/ugorji/go/codec/json.go | 3 + vendor/github.com/ugorji/go/codec/msgpack.go | 2 +- vendor/github.com/ugorji/go/codec/reader.go | 4 +- vendor/golang.org/x/net/http2/transport.go | 9 + vendor/golang.org/x/sys/unix/aliases.go | 2 +- .../x/sys/unix/syscall_darwin_libSystem.go | 2 +- vendor/golang.org/x/sys/unix/syscall_freebsd.go | 12 +- vendor/golang.org/x/sys/unix/syscall_linux.go | 99 + vendor/golang.org/x/sys/unix/zsyscall_linux.go | 10 + vendor/golang.org/x/sys/unix/ztypes_linux.go | 60 + .../protobuf/encoding/protojson/decode.go | 38 +- .../protobuf/encoding/protojson/doc.go | 2 +- .../protobuf/encoding/protojson/encode.go | 39 +- .../encoding/protojson/well_known_types.go | 59 +- .../protobuf/encoding/prototext/decode.go | 8 +- .../protobuf/encoding/prototext/encode.go | 4 +- .../protobuf/encoding/protowire/wire.go | 28 +- .../protobuf/internal/descfmt/stringer.go | 183 +- .../protobuf/internal/editiondefaults/defaults.go | 12 + .../editiondefaults/editions_defaults.binpb | 4 + .../protobuf/internal/encoding/json/decode.go | 2 +- .../protobuf/internal/filedesc/desc.go | 102 +- .../protobuf/internal/filedesc/desc_init.go | 52 + .../protobuf/internal/filedesc/desc_lazy.go | 28 + .../protobuf/internal/filedesc/editions.go | 142 + .../protobuf/internal/genid/descriptor_gen.go | 364 +- .../protobuf/internal/genid/go_features_gen.go | 31 + .../protobuf/internal/genid/struct_gen.go | 5 + .../protobuf/internal/genid/type_gen.go | 38 + .../protobuf/internal/impl/codec_extension.go | 22 +- .../protobuf/internal/impl/codec_gen.go | 113 +- .../protobuf/internal/impl/codec_tables.go | 2 +- .../protobuf/internal/impl/legacy_message.go | 19 +- .../protobuf/internal/impl/message.go | 17 +- .../internal/impl/message_reflect_field.go | 2 +- .../protobuf/internal/impl/pointer_reflect.go | 36 + .../protobuf/internal/impl/pointer_unsafe.go | 40 + .../protobuf/internal/strs/strings.go | 2 +- .../protobuf/internal/strs/strings_unsafe.go | 95 - .../protobuf/internal/strs/strings_unsafe_go120.go | 95 + .../protobuf/internal/strs/strings_unsafe_go121.go | 74 + .../protobuf/internal/version/version.go | 2 +- vendor/google.golang.org/protobuf/proto/decode.go | 2 +- vendor/google.golang.org/protobuf/proto/doc.go | 58 +- vendor/google.golang.org/protobuf/proto/encode.go | 2 +- .../google.golang.org/protobuf/proto/extension.go | 2 +- vendor/google.golang.org/protobuf/proto/merge.go | 2 +- vendor/google.golang.org/protobuf/proto/proto.go | 18 +- .../protobuf/reflect/protodesc/desc.go | 29 +- .../protobuf/reflect/protodesc/desc_init.go | 56 + .../protobuf/reflect/protodesc/desc_resolve.go | 4 +- .../protobuf/reflect/protodesc/desc_validate.go | 6 +- .../protobuf/reflect/protodesc/editions.go | 148 + .../protobuf/reflect/protodesc/proto.go | 18 +- .../protobuf/reflect/protoreflect/proto.go | 85 +- .../protobuf/reflect/protoreflect/source_gen.go | 64 +- .../protobuf/reflect/protoreflect/type.go | 44 +- .../protobuf/reflect/protoreflect/value.go | 24 +- .../protobuf/reflect/protoreflect/value_equal.go | 8 +- .../protobuf/reflect/protoreflect/value_union.go | 44 +- .../protobuf/reflect/protoreflect/value_unsafe.go | 99 - .../reflect/protoreflect/value_unsafe_go120.go | 99 + .../reflect/protoreflect/value_unsafe_go121.go | 87 + .../protobuf/reflect/protoregistry/registry.go | 24 +- .../protobuf/types/descriptorpb/descriptor.pb.go | 2475 +++++--- .../protobuf/types/gofeaturespb/go_features.pb.go | 177 + .../protobuf/types/gofeaturespb/go_features.proto | 28 + .../protobuf/types/known/anypb/any.pb.go | 3 +- vendor/modules.txt | 35 +- 161 files changed, 11887 insertions(+), 4450 deletions(-) delete mode 100644 vendor/github.com/bytedance/sonic/internal/rt/asm_arm64.s create mode 100644 vendor/github.com/bytedance/sonic/internal/rt/asm_compat.s create mode 100644 vendor/github.com/leodido/go-urn/kind.go create mode 100644 vendor/github.com/leodido/go-urn/options.go create mode 100644 vendor/github.com/leodido/go-urn/parsing_mode.go create mode 100644 vendor/github.com/leodido/go-urn/scim.go create mode 100644 vendor/github.com/leodido/go-urn/scim/schema/type.go create mode 100644 vendor/github.com/leodido/go-urn/urn8141.go create mode 100644 vendor/google.golang.org/protobuf/internal/editiondefaults/defaults.go create mode 100644 vendor/google.golang.org/protobuf/internal/editiondefaults/editions_defaults.binpb create mode 100644 vendor/google.golang.org/protobuf/internal/filedesc/editions.go create mode 100644 vendor/google.golang.org/protobuf/internal/genid/go_features_gen.go delete mode 100644 vendor/google.golang.org/protobuf/internal/strs/strings_unsafe.go create mode 100644 vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go120.go create mode 100644 vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go121.go create mode 100644 vendor/google.golang.org/protobuf/reflect/protodesc/editions.go delete mode 100644 vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe.go create mode 100644 vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go120.go create mode 100644 vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go121.go create mode 100644 vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.pb.go create mode 100644 vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.proto diff --git a/go.mod b/go.mod index 476efb215..07cb065cf 100644 --- a/go.mod +++ b/go.mod @@ -27,7 +27,7 @@ require ( github.com/buckket/go-blurhash v1.1.0 github.com/coreos/go-oidc/v3 v3.9.0 github.com/disintegration/imaging v1.6.2 - github.com/gin-contrib/cors v1.5.0 + github.com/gin-contrib/cors v1.7.0 github.com/gin-contrib/gzip v0.0.6 github.com/gin-contrib/sessions v0.0.5 github.com/gin-gonic/gin v1.9.1 @@ -69,9 +69,9 @@ require ( go.opentelemetry.io/otel/sdk/metric v1.20.0 go.opentelemetry.io/otel/trace v1.20.0 go.uber.org/automaxprocs v1.5.3 - golang.org/x/crypto v0.20.0 + golang.org/x/crypto v0.21.0 golang.org/x/image v0.15.0 - golang.org/x/net v0.21.0 + golang.org/x/net v0.22.0 golang.org/x/oauth2 v0.17.0 golang.org/x/text v0.14.0 gopkg.in/mcuadros/go-syslog.v2 v2.3.0 @@ -91,11 +91,11 @@ require ( github.com/asaskevich/govalidator v0.0.0-20230301143203-a9d515a09cc2 // indirect github.com/aymerick/douceur v0.2.0 // indirect github.com/beorn7/perks v1.0.1 // indirect - github.com/bytedance/sonic v1.10.1 // indirect + github.com/bytedance/sonic v1.11.2 // indirect github.com/cenkalti/backoff/v4 v4.2.1 // indirect github.com/cespare/xxhash/v2 v2.2.0 // indirect github.com/chenzhuoyu/base64x v0.0.0-20230717121745-296ad89f973d // indirect - github.com/chenzhuoyu/iasm v0.9.0 // indirect + github.com/chenzhuoyu/iasm v0.9.1 // indirect github.com/cilium/ebpf v0.9.1 // indirect github.com/containerd/cgroups/v3 v3.0.1 // indirect github.com/coreos/go-systemd/v22 v22.3.2 // indirect @@ -110,7 +110,7 @@ require ( github.com/dustin/go-humanize v1.0.1 // indirect github.com/felixge/httpsnoop v1.0.3 // indirect github.com/fsnotify/fsnotify v1.7.0 // indirect - github.com/gabriel-vasile/mimetype v1.4.2 // indirect + github.com/gabriel-vasile/mimetype v1.4.3 // indirect github.com/gin-contrib/sse v0.1.0 // indirect github.com/go-errors/errors v1.4.1 // indirect github.com/go-fed/httpsig v1.1.0 // indirect @@ -130,7 +130,7 @@ require ( github.com/go-openapi/validate v0.22.1 // indirect github.com/go-playground/locales v0.14.1 // indirect github.com/go-playground/universal-translator v0.18.1 // indirect - github.com/go-playground/validator/v10 v10.15.5 // indirect + github.com/go-playground/validator/v10 v10.19.0 // indirect github.com/go-xmlfmt/xmlfmt v0.0.0-20211206191508-7fd73a941850 // indirect github.com/goccy/go-json v0.10.2 // indirect github.com/godbus/dbus/v5 v5.0.4 // indirect @@ -156,10 +156,10 @@ require ( github.com/json-iterator/go v1.1.12 // indirect github.com/kballard/go-shellquote v0.0.0-20180428030007-95032a82bc51 // indirect github.com/klauspost/compress v1.17.4 // indirect - github.com/klauspost/cpuid/v2 v2.2.6 // indirect + github.com/klauspost/cpuid/v2 v2.2.7 // indirect github.com/kr/pretty v0.3.1 // indirect github.com/kr/text v0.2.0 // indirect - github.com/leodido/go-urn v1.2.4 // indirect + github.com/leodido/go-urn v1.4.0 // indirect github.com/magiconair/properties v1.8.7 // indirect github.com/mailru/easyjson v0.7.7 // indirect github.com/mattn/go-isatty v0.0.20 // indirect @@ -198,7 +198,7 @@ require ( github.com/tmthrgd/go-hex v0.0.0-20190904060850-447a3041c3bc // indirect github.com/toqueteos/webbrowser v1.2.0 // indirect github.com/twitchyliquid64/golang-asm v0.15.1 // indirect - github.com/ugorji/go/codec v1.2.11 // indirect + github.com/ugorji/go/codec v1.2.12 // indirect github.com/uptrace/opentelemetry-go-extra/otelsql v0.2.3 // indirect github.com/vmihailenco/msgpack/v5 v5.4.1 // indirect github.com/vmihailenco/tagparser/v2 v2.0.0 // indirect @@ -207,17 +207,17 @@ require ( go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.20.0 // indirect go.opentelemetry.io/proto/otlp v1.0.0 // indirect go.uber.org/multierr v1.11.0 // indirect - golang.org/x/arch v0.5.0 // indirect + golang.org/x/arch v0.7.0 // indirect golang.org/x/exp v0.0.0-20240112132812-db7319d0e0e3 // indirect golang.org/x/mod v0.14.0 // indirect golang.org/x/sync v0.6.0 // indirect - golang.org/x/sys v0.17.0 // indirect + golang.org/x/sys v0.18.0 // indirect golang.org/x/tools v0.17.0 // indirect google.golang.org/appengine v1.6.8 // indirect google.golang.org/genproto/googleapis/api v0.0.0-20231106174013-bbf56f31fb17 // indirect google.golang.org/genproto/googleapis/rpc v0.0.0-20231120223509-83a465c0220f // indirect google.golang.org/grpc v1.59.0 // indirect - google.golang.org/protobuf v1.31.0 // indirect + google.golang.org/protobuf v1.33.0 // indirect gopkg.in/ini.v1 v1.67.0 // indirect gopkg.in/yaml.v2 v2.4.0 // indirect lukechampine.com/uint128 v1.2.0 // indirect diff --git a/go.sum b/go.sum index b31ceb59c..df73ed8d3 100644 --- a/go.sum +++ b/go.sum @@ -105,8 +105,8 @@ github.com/buckket/go-blurhash v1.1.0 h1:X5M6r0LIvwdvKiUtiNcRL2YlmOfMzYobI3VCKCZ github.com/buckket/go-blurhash v1.1.0/go.mod h1:aT2iqo5W9vu9GpyoLErKfTHwgODsZp3bQfXjXJUxNb8= github.com/bytedance/sonic v1.5.0/go.mod h1:ED5hyg4y6t3/9Ku1R6dU/4KyJ48DZ4jPhfY1O2AihPM= github.com/bytedance/sonic v1.10.0-rc/go.mod h1:ElCzW+ufi8qKqNW0FY314xriJhyJhuoJ3gFZdAHF7NM= -github.com/bytedance/sonic v1.10.1 h1:7a1wuFXL1cMy7a3f7/VFcEtriuXQnUBhtoVfOZiaysc= -github.com/bytedance/sonic v1.10.1/go.mod h1:iZcSUejdk5aukTND/Eu/ivjQuEL0Cu9/rf50Hi0u/g4= +github.com/bytedance/sonic v1.11.2 h1:ywfwo0a/3j9HR8wsYGWsIWl2mvRsI950HyoxiBERw5A= +github.com/bytedance/sonic v1.11.2/go.mod h1:iZcSUejdk5aukTND/Eu/ivjQuEL0Cu9/rf50Hi0u/g4= github.com/cenkalti/backoff/v4 v4.2.1 h1:y4OZtCnogmCPw98Zjyt5a6+QwPLGkiQsYW5oUqylYbM= github.com/cenkalti/backoff/v4 v4.2.1/go.mod h1:Y3VNntkOUPxTVeUxJ/G5vcM//AlwfmyYozVcomhLiZE= github.com/census-instrumentation/opencensus-proto v0.2.1/go.mod h1:f6KPmirojxKA12rnyqOA5BBL4O983OfeGPqjHWSTneU= @@ -116,8 +116,9 @@ github.com/chenzhuoyu/base64x v0.0.0-20211019084208-fb5309c8db06/go.mod h1:DH46F github.com/chenzhuoyu/base64x v0.0.0-20221115062448-fe3a3abad311/go.mod h1:b583jCggY9gE99b6G5LEC39OIiVsWj+R97kbl5odCEk= github.com/chenzhuoyu/base64x v0.0.0-20230717121745-296ad89f973d h1:77cEq6EriyTZ0g/qfRdp61a3Uu/AWrgIq2s0ClJV1g0= github.com/chenzhuoyu/base64x v0.0.0-20230717121745-296ad89f973d/go.mod h1:8EPpVsBuRksnlj1mLy4AWzRNQYxauNi62uWcE3to6eA= -github.com/chenzhuoyu/iasm v0.9.0 h1:9fhXjVzq5hUy2gkhhgHl95zG2cEAhw9OSGs8toWWAwo= github.com/chenzhuoyu/iasm v0.9.0/go.mod h1:Xjy2NpN3h7aUqeqM+woSuuvxmIe6+DDsiNLIrkAmYog= +github.com/chenzhuoyu/iasm v0.9.1 h1:tUHQJXo3NhBqw6s33wkGn9SP3bvrWLdlVIJ3hQBL7P0= +github.com/chenzhuoyu/iasm v0.9.1/go.mod h1:Xjy2NpN3h7aUqeqM+woSuuvxmIe6+DDsiNLIrkAmYog= github.com/chzyer/logex v1.1.10/go.mod h1:+Ywpsq7O8HXn0nuIou7OrIPyXbp3wmkHB+jjWRnGsAI= github.com/chzyer/readline v0.0.0-20180603132655-2972be24d48e/go.mod h1:nSuG5e5PlCu98SY8svDHJxuZscDgtXS6KTTbou5AhLI= github.com/chzyer/test v0.0.0-20180213035817-a1ea475d72b1/go.mod h1:Q3SI9o4m/ZMnBNeIyt5eFwwo7qiLfzFZmjNmxjkiQlU= @@ -178,12 +179,12 @@ github.com/fsnotify/fsnotify v1.4.7/go.mod h1:jwhsz4b93w/PPRr/qN1Yymfu8t87LnFCMo github.com/fsnotify/fsnotify v1.4.9/go.mod h1:znqG4EE+3YCdAaPaxE2ZRY/06pZUdp0tY4IgpuI1SZQ= github.com/fsnotify/fsnotify v1.7.0 h1:8JEhPFa5W2WU7YfeZzPNqzMP6Lwt7L2715Ggo0nosvA= github.com/fsnotify/fsnotify v1.7.0/go.mod h1:40Bi/Hjc2AVfZrqy+aj+yEI+/bRxZnMJyTJwOpGvigM= -github.com/gabriel-vasile/mimetype v1.4.2 h1:w5qFW6JKBz9Y393Y4q372O9A7cUSequkh1Q7OhCmWKU= -github.com/gabriel-vasile/mimetype v1.4.2/go.mod h1:zApsH/mKG4w07erKIaJPFiX0Tsq9BFQgN3qGY5GnNgA= +github.com/gabriel-vasile/mimetype v1.4.3 h1:in2uUcidCuFcDKtdcBxlR0rJ1+fsokWf+uqxgUFjbI0= +github.com/gabriel-vasile/mimetype v1.4.3/go.mod h1:d8uq/6HKRL6CGdk+aubisF/M5GcPfT7nKyLpA0lbSSk= github.com/gavv/httpexpect v2.0.0+incompatible h1:1X9kcRshkSKEjNJJxX9Y9mQ5BRfbxU5kORdjhlA1yX8= github.com/gavv/httpexpect v2.0.0+incompatible/go.mod h1:x+9tiU1YnrOvnB725RkpoLv1M62hOWzwo5OXotisrKc= -github.com/gin-contrib/cors v1.5.0 h1:DgGKV7DDoOn36DFkNtbHrjoRiT5ExCe+PC9/xp7aKvk= -github.com/gin-contrib/cors v1.5.0/go.mod h1:TvU7MAZ3EwrPLI2ztzTt3tqgvBCq+wn8WpZmfADjupI= +github.com/gin-contrib/cors v1.7.0 h1:wZX2wuZ0o7rV2/1i7gb4Jn+gW7HBqaP91fizJkBUJOA= +github.com/gin-contrib/cors v1.7.0/go.mod h1:cI+h6iOAyxKRtUtC6iF/Si1KSFvGm/gK+kshxlCi8ro= github.com/gin-contrib/gzip v0.0.6 h1:NjcunTcGAj5CO1gn4N8jHOSIeRFHIbn51z6K+xaN4d4= github.com/gin-contrib/gzip v0.0.6/go.mod h1:QOJlmV2xmayAjkNS2Y8NQsMneuRShOU/kjovCXNuzzk= github.com/gin-contrib/sessions v0.0.5 h1:CATtfHmLMQrMNpJRgzjWXD7worTh7g7ritsQfmF+0jE= @@ -262,8 +263,8 @@ github.com/go-playground/universal-translator v0.18.0/go.mod h1:UvRDBj+xPUEGrFYl github.com/go-playground/universal-translator v0.18.1 h1:Bcnm0ZwsGyWbCzImXv+pAJnYK9S473LQFuzCbDbfSFY= github.com/go-playground/universal-translator v0.18.1/go.mod h1:xekY+UJKNuX9WP91TpwSH2VMlDf28Uj24BCp08ZFTUY= github.com/go-playground/validator/v10 v10.10.0/go.mod h1:74x4gJWsvQexRdW8Pn3dXSGrTK4nAUsbPlLADvpJkos= -github.com/go-playground/validator/v10 v10.15.5 h1:LEBecTWb/1j5TNY1YYG2RcOUN3R7NLylN+x8TTueE24= -github.com/go-playground/validator/v10 v10.15.5/go.mod h1:9iXMNT7sEkjXb0I+enO7QXmzG6QCsPWY4zveKFVRSyU= +github.com/go-playground/validator/v10 v10.19.0 h1:ol+5Fu+cSq9JD7SoSqe04GMI92cbn0+wvQ3bZ8b/AU4= +github.com/go-playground/validator/v10 v10.19.0/go.mod h1:dbuPbCMFw/DrkbEynArYaCwl3amGuJotoKCe95atGMM= github.com/go-session/session v3.1.2+incompatible/go.mod h1:8B3iivBQjrz/JtC68Np2T1yBBLxTan3mn/3OM0CyRt0= github.com/go-stack/stack v1.8.0/go.mod h1:v0f6uXyyMGvRgIKkXu+yp6POWl0qKG85gN/melR3HDY= github.com/go-swagger/go-swagger v0.30.5 h1:SQ2+xSonWjjoEMOV5tcOnZJVlfyUfCBhGQGArS1b9+U= @@ -451,8 +452,8 @@ github.com/klauspost/compress v1.17.4 h1:Ej5ixsIri7BrIjBkRZLTo6ghwrEtHFk7ijlczPW github.com/klauspost/compress v1.17.4/go.mod h1:/dCuZOvVtNoHsyb+cuJD3itjs3NbnF6KH9zAO4BDxPM= github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= github.com/klauspost/cpuid/v2 v2.0.9/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= -github.com/klauspost/cpuid/v2 v2.2.6 h1:ndNyv040zDGIDh8thGkXYjnFtiN02M1PVVF+JE/48xc= -github.com/klauspost/cpuid/v2 v2.2.6/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= +github.com/klauspost/cpuid/v2 v2.2.7 h1:ZWSB3igEs+d0qvnxR/ZBzXVmxkgt8DdzP6m9pfuVLDM= +github.com/klauspost/cpuid/v2 v2.2.7/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= github.com/knz/go-libedit v1.10.1/go.mod h1:MZTVkCWyz0oBc7JOWP3wNAzd002ZbM/5hgShxwh4x8M= github.com/konsorten/go-windows-terminal-sequences v1.0.1/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ= github.com/konsorten/go-windows-terminal-sequences v1.0.2/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ= @@ -467,8 +468,8 @@ github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI= github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY= github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE= github.com/leodido/go-urn v1.2.1/go.mod h1:zt4jvISO2HfUBqxjfIshjdMTYS56ZS/qv49ictyFfxY= -github.com/leodido/go-urn v1.2.4 h1:XlAE/cm/ms7TE/VMVoduSpNBoyc2dOxHs5MZSwAN63Q= -github.com/leodido/go-urn v1.2.4/go.mod h1:7ZrI8mTSeBSHl/UaRyKQW1qZeMgak41ANeCNaVckg+4= +github.com/leodido/go-urn v1.4.0 h1:WT9HwE9SGECu3lg4d/dIA+jxlljEa1/ffXKmRjqdmIQ= +github.com/leodido/go-urn v1.4.0/go.mod h1:bvxc+MVxLKB4z00jd1z+Dvzr47oO32F/QSNjSBOlFxI= github.com/magiconair/properties v1.8.7 h1:IeQXZAiQcpL9mgcAe1Nu6cX9LLw6ExEHKjN0VQdvPDY= github.com/magiconair/properties v1.8.7/go.mod h1:Dhd985XPs7jluiymwWYZ0G4Z61jb3vdS329zhj2hYo0= github.com/mailru/easyjson v0.0.0-20190614124828-94de47d64c63/go.mod h1:C1wdFJiN94OJF2b5HbByQZoLdCWB1Yqtg26g4irojpc= @@ -616,7 +617,6 @@ github.com/stretchr/testify v1.7.0/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/ github.com/stretchr/testify v1.7.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= github.com/stretchr/testify v1.8.0/go.mod h1:yNjHg4UonilssWZ8iaSj1OCr/vHnekPRkoO+kdMU+MU= github.com/stretchr/testify v1.8.1/go.mod h1:w2LPCIKwWwSfY2zedu0+kehJoqGctiVI29o6fzry7u4= -github.com/stretchr/testify v1.8.2/go.mod h1:w2LPCIKwWwSfY2zedu0+kehJoqGctiVI29o6fzry7u4= github.com/stretchr/testify v1.8.4/go.mod h1:sz/lmYIOXD/1dqDmKjjqLyZ2RngseejIcXlSw2iwfAo= github.com/stretchr/testify v1.9.0 h1:HtqpIVDClZ4nwg75+f6Lvsy/wHu+3BoSGCbBAcpTsTg= github.com/stretchr/testify v1.9.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY= @@ -670,8 +670,8 @@ github.com/twitchyliquid64/golang-asm v0.15.1 h1:SU5vSMR7hnwNxj24w34ZyCi/FmDZTkS github.com/twitchyliquid64/golang-asm v0.15.1/go.mod h1:a1lVb/DtPvCB8fslRZhAngC2+aY1QWCk3Cedj/Gdt08= github.com/ugorji/go v1.2.7/go.mod h1:nF9osbDWLy6bDVv/Rtoh6QgnvNDpmCalQV5urGCCS6M= github.com/ugorji/go/codec v1.2.7/go.mod h1:WGN1fab3R1fzQlVQTkfxVtIBhWDRqOviHU95kRgeqEY= -github.com/ugorji/go/codec v1.2.11 h1:BMaWp1Bb6fHwEtbplGBGJ498wD+LKlNSl25MjdZY4dU= -github.com/ugorji/go/codec v1.2.11/go.mod h1:UNopzCgEMSXjBc6AOMqYvWC1ktqTAfzJZUZgYf6w6lg= +github.com/ugorji/go/codec v1.2.12 h1:9LC83zGrHhuUA9l16C9AHXAqEV/2wBQ4nkvumAE65EE= +github.com/ugorji/go/codec v1.2.12/go.mod h1:UNopzCgEMSXjBc6AOMqYvWC1ktqTAfzJZUZgYf6w6lg= github.com/ulule/limiter/v3 v3.11.2 h1:P4yOrxoEMJbOTfRJR2OzjL90oflzYPPmWg+dvwN2tHA= github.com/ulule/limiter/v3 v3.11.2/go.mod h1:QG5GnFOCV+k7lrL5Y8kgEeeflPH3+Cviqlqa8SVSQxI= github.com/uptrace/bun v1.1.17 h1:qxBaEIo0hC/8O3O6GrMDKxqyT+mw5/s0Pn/n6xjyGIk= @@ -762,8 +762,8 @@ go.uber.org/goleak v1.3.0/go.mod h1:CoHD4mav9JJNrW/WLlf7HGZPjdw8EucARQHekz1X6bE= go.uber.org/multierr v1.11.0 h1:blXXJkSxSSfBVBlC76pxqeO+LN3aDfLQo+309xJstO0= go.uber.org/multierr v1.11.0/go.mod h1:20+QtiLqy0Nd6FdQB9TLXag12DsQkrbs3htMFfDN80Y= golang.org/x/arch v0.0.0-20210923205945-b76863e36670/go.mod h1:5om86z9Hs0C8fWVUuoMHwpExlXzs5Tkyp9hOrfG7pp8= -golang.org/x/arch v0.5.0 h1:jpGode6huXQxcskEIpOCvrU+tzo81b6+oFLUYXWtH/Y= -golang.org/x/arch v0.5.0/go.mod h1:5om86z9Hs0C8fWVUuoMHwpExlXzs5Tkyp9hOrfG7pp8= +golang.org/x/arch v0.7.0 h1:pskyeJh/3AmoQ8CPE95vxHLqp1G1GfGNXTmcl9NEKTc= +golang.org/x/arch v0.7.0/go.mod h1:FEVrYAQjsQXMVJ1nsMoVVXPZg6p2JE2mx8psSWTDQys= golang.org/x/crypto v0.0.0-20180904163835-0709b304e793/go.mod h1:6SG95UA2DQfeDnfUPMdvaQW0Q7yPrPDi9nlGo2tz2b4= golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= golang.org/x/crypto v0.0.0-20190422162423-af44ce270edf/go.mod h1:WFFai1msRO1wXaEeE5yQxYXgSfI8pQAWXbQop6sCtWE= @@ -777,8 +777,8 @@ golang.org/x/crypto v0.0.0-20210711020723-a769d52b0f97/go.mod h1:GvvjBRRGRdwPK5y golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4= golang.org/x/crypto v0.3.0/go.mod h1:hebNnKkNXi2UzZN1eVRvBB7co0a+JxK6XbPiWVs/3J4= -golang.org/x/crypto v0.20.0 h1:jmAMJJZXr5KiCw05dfYK9QnqaqKLYXijU23lsEdcQqg= -golang.org/x/crypto v0.20.0/go.mod h1:Xwo95rrVNIoSMx9wa1JroENMToLWn3RNVrTBpLHgZPQ= +golang.org/x/crypto v0.21.0 h1:X31++rzVUdKhX5sWmSOFZxx8UW/ldWx55cbf08iNAMA= +golang.org/x/crypto v0.21.0/go.mod h1:0BP7YvVV9gBbVKyeTG0Gyn+gZm94bibOW5BjDEYAOMs= golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20190306152737-a1d7652674e8/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20190510132918-efd6b22b2522/go.mod h1:ZjyILWgesfNpC6sMxTJOJm9Kp84zZh5NQWvqDGG3Qr8= @@ -851,8 +851,8 @@ golang.org/x/net v0.0.0-20210421230115-4e50805a0758/go.mod h1:72T/g9IO56b78aLF+1 golang.org/x/net v0.0.0-20211112202133-69e39bad7dc2/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y= golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c= golang.org/x/net v0.2.0/go.mod h1:KqCZLdyyvdV855qA2rE3GC2aiw5xGR5TEjj8smXukLY= -golang.org/x/net v0.21.0 h1:AQyQV4dYCvJ7vGmJyKki9+PBdyvhkSd8EIx/qb0AYv4= -golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44= +golang.org/x/net v0.22.0 h1:9sGLhx7iRIHEiX0oAJ3MRZMUCElJgy7Br1nO+AMN3Tc= +golang.org/x/net v0.22.0/go.mod h1:JKghWKKOSdJwpW2GEx0Ja7fmaKnMsbu+MWVZTokSYmg= golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U= golang.org/x/oauth2 v0.0.0-20190226205417-e64efc72b421/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= @@ -923,13 +923,13 @@ golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBc golang.org/x/sys v0.2.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.6.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.17.0 h1:25cE3gD+tdBA7lp7QfhuV+rJiE9YXTcS3VG1SqssI/Y= -golang.org/x/sys v0.17.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= +golang.org/x/sys v0.18.0 h1:DBdB3niSjOA/O0blCZBqDefyWNYveAYMNF1Wum0DYQ4= +golang.org/x/sys v0.18.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= golang.org/x/term v0.2.0/go.mod h1:TVmDHMZPmdnySmBfhjOoOdhjzdE1h4u1VwSiw2l1Nuc= -golang.org/x/term v0.17.0 h1:mkTF7LCd6WGJNL3K1Ad7kwxNfYAW6a8a8QqtMblp/4U= -golang.org/x/term v0.17.0/go.mod h1:lLRBjIVuehSbZlaOtGMbcMncT+aqLLLmKrsjNrUguwk= +golang.org/x/term v0.18.0 h1:FcHjZXDMxI8mM3nwhX9HlKop4C0YQvCVCdwYl2wOtE8= +golang.org/x/term v0.18.0/go.mod h1:ILwASektA3OnRv7amZ1xhE/KTR+u50pbXfZ03+6Nx58= golang.org/x/text v0.0.0-20170915032832-14c0d48ead0c/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.1-0.20180807135948-17ff2d5776d2/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= @@ -1083,8 +1083,8 @@ google.golang.org/protobuf v1.25.0/go.mod h1:9JNX74DMeImyA3h4bdi1ymwjUzf21/xIlba google.golang.org/protobuf v1.26.0-rc.1/go.mod h1:jlhhOSvTdKEhbULTjvd4ARK9grFBp09yW+WbY/TyQbw= google.golang.org/protobuf v1.26.0/go.mod h1:9q0QmTI4eRPtz6boOQmLYwt+qCgq0jsYwAQnmE0givc= google.golang.org/protobuf v1.28.0/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I= -google.golang.org/protobuf v1.31.0 h1:g0LDEJHgrBl9N9r17Ru3sqWhkIx2NB67okBHPwC7hs8= -google.golang.org/protobuf v1.31.0/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I= +google.golang.org/protobuf v1.33.0 h1:uNO2rsAINq/JlFpSdYEKIZ0uKD/R9cpdv0T+yoGwGmI= +google.golang.org/protobuf v1.33.0/go.mod h1:c6P6GXX6sHbq/GpV6MGZEdwhWPcYBgnhAHhKbcUYpos= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v1.0.0-20180628173108-788fd7840127/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v1.0.0-20190902080502-41f04d3bba15/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= diff --git a/vendor/github.com/bytedance/sonic/README.md b/vendor/github.com/bytedance/sonic/README.md index 3486b9c47..a74fc4968 100644 --- a/vendor/github.com/bytedance/sonic/README.md +++ b/vendor/github.com/bytedance/sonic/README.md @@ -5,18 +5,27 @@ English | [中文](README_ZH_CN.md) A blazingly fast JSON serializing & deserializing library, accelerated by JIT (just-in-time compiling) and SIMD (single-instruction-multiple-data). ## Requirement -- Go 1.16~1.21 + +- Go 1.16~1.22 - Linux / MacOS / Windows(need go1.17 above) - Amd64 ARCH ## Features + - Runtime object binding without code generation - Complete APIs for JSON value manipulation - Fast, fast, fast! +## APIs + +see [go.dev](https://pkg.go.dev/github.com/bytedance/sonic) + ## Benchmarks + For **all sizes** of json and **all scenarios** of usage, **Sonic performs best**. + - [Medium](https://github.com/bytedance/sonic/blob/main/decoder/testdata_test.go#L19) (13KB, 300+ key, 6 layers) + ```powershell goversion: 1.17.1 goos: darwin @@ -81,6 +90,7 @@ BenchmarkLoadNode_Parallel/LoadAll()-16 5493 ns/op 2370.6 BenchmarkLoadNode/Interface()-16 17722 ns/op 734.85 MB/s 13323 B/op 88 allocs/op BenchmarkLoadNode_Parallel/Interface()-16 10330 ns/op 1260.70 MB/s 15178 B/op 88 allocs/op ``` + - [Small](https://github.com/bytedance/sonic/blob/main/testdata/small.go) (400B, 11 keys, 3 layers) ![small benchmarks](./docs/imgs/bench-small.png) - [Large](https://github.com/bytedance/sonic/blob/main/testdata/twitter.json) (635KB, 10000+ key, 6 layers) @@ -89,6 +99,7 @@ BenchmarkLoadNode_Parallel/Interface()-16 10330 ns/op 1260.7 See [bench.sh](https://github.com/bytedance/sonic/blob/main/scripts/bench.sh) for benchmark codes. ## How it works + See [INTRODUCTION.md](./docs/INTRODUCTION.md). ## Usage @@ -96,6 +107,7 @@ See [INTRODUCTION.md](./docs/INTRODUCTION.md). ### Marshal/Unmarshal Default behaviors are mostly consistent with `encoding/json`, except HTML escaping form (see [Escape HTML](https://github.com/bytedance/sonic/blob/main/README.md#escape-html)) and `SortKeys` feature (optional support see [Sort Keys](https://github.com/bytedance/sonic/blob/main/README.md#sort-keys)) that is **NOT** in conformity to [RFC8259](https://datatracker.ietf.org/doc/html/rfc8259). + ```go import "github.com/bytedance/sonic" @@ -107,8 +119,11 @@ err := sonic.Unmarshal(output, &data) ``` ### Streaming IO -Sonic supports decoding json from `io.Reader` or encoding objects into `io.`Writer`, aims at handling multiple values as well as reducing memory consumption. + +Sonic supports decoding json from `io.Reader` or encoding objects into `io.Writer`, aims at handling multiple values as well as reducing memory consumption. + - encoder + ```go var o1 = map[string]interface{}{ "a": "b", @@ -123,7 +138,9 @@ fmt.Println(w.String()) // {"a":"b"} // 1 ``` + - decoder + ```go var o = map[string]interface{}{} var r = strings.NewReader(`{"a":"b"}{"1":"2"}`) @@ -136,6 +153,7 @@ fmt.Printf("%+v", o) ``` ### Use Number/Use Int64 + ```go import "github.com/bytedance/sonic/decoder" @@ -164,7 +182,9 @@ fm := root.Interface().(float64) // jn == jm ``` ### Sort Keys + On account of the performance loss from sorting (roughly 10%), sonic doesn't enable this feature by default. If your component depends on it to work (like [zstd](https://github.com/facebook/zstd)), Use it like this: + ```go import "github.com/bytedance/sonic" import "github.com/bytedance/sonic/encoder" @@ -177,19 +197,26 @@ v, err := encoder.Encode(m, encoder.SortMapKeys) var root := sonic.Get(JSON) err := root.SortKeys() ``` + ### Escape HTML + On account of the performance loss (roughly 15%), sonic doesn't enable this feature by default. You can use `encoder.EscapeHTML` option to open this feature (align with `encoding/json.HTMLEscape`). + ```go import "github.com/bytedance/sonic" v := map[string]string{"&&":"<>"} ret, err := Encode(v, EscapeHTML) // ret == `{"\u0026\u0026":{"X":"\u003c\u003e"}}` ``` + ### Compact Format + Sonic encodes primitive objects (struct/map...) as compact-format JSON by default, except marshaling `json.RawMessage` or `json.Marshaler`: sonic ensures validating their output JSON but **DONOT** compacting them for performance concerns. We provide the option `encoder.CompactMarshaler` to add compacting process. ### Print Error + If there invalid syntax in input JSON, sonic will return `decoder.SyntaxError`, which supports pretty-printing of error position + ```go import "github.com/bytedance/sonic" import "github.com/bytedance/sonic/decoder" @@ -215,7 +242,9 @@ if err != nil { ``` #### Mismatched Types [Sonic v1.6.0] + If there a **mismatch-typed** value for a given key, sonic will report `decoder.MismatchTypeError` (if there are many, report the last one), but still skip wrong the value and keep decoding next JSON. + ```go import "github.com/bytedance/sonic" import "github.com/bytedance/sonic/decoder" @@ -228,10 +257,15 @@ err := UnmarshalString(`{"A":"1","B":1}`, &data) println(err.Error()) // Mismatch type int with value string "at index 5: mismatched type with value\n\n\t{\"A\":\"1\",\"B\":1}\n\t.....^.........\n" fmt.Printf("%+v", data) // {A:0 B:1} ``` + ### Ast.Node + Sonic/ast.Node is a completely self-contained AST for JSON. It implements serialization and deserialization both and provides robust APIs for obtaining and modification of generic data. + #### Get/Index + Search partial JSON by given paths, which must be non-negative integer or string, or nil + ```go import "github.com/bytedance/sonic" @@ -245,10 +279,13 @@ raw := root.Raw() // == string(input) root, err := sonic.Get(input, "key1", 1, "key2") sub := root.Get("key3").Index(2).Int64() // == 3 ``` + **Tip**: since `Index()` uses offset to locate data, which is much faster than scanning like `Get()`, we suggest you use it as much as possible. And sonic also provides another API `IndexOrGet()` to underlying use offset as well as ensure the key is matched. #### Set/Unset + Modify the json content by Set()/Unset() + ```go import "github.com/bytedance/sonic" @@ -265,7 +302,9 @@ println(root.Get("key4").Check()) // "value not exist" ``` #### Serialize + To encode `ast.Node` as json, use `MarshalJson()` or `json.Marshal()` (MUST pass the node's pointer) + ```go import ( "encoding/json" @@ -279,6 +318,7 @@ println(string(buf) == string(exp)) // true ``` #### APIs + - validation: `Check()`, `Error()`, `Valid()`, `Exist()` - searching: `Index()`, `Get()`, `IndexPair()`, `IndexOrGet()`, `GetByPath()` - go-type casting: `Int64()`, `Float64()`, `String()`, `Number()`, `Bool()`, `Map[UseNumber|UseNode]()`, `Array[UseNumber|UseNode]()`, `Interface[UseNumber|UseNode]()` @@ -287,7 +327,9 @@ println(string(buf) == string(exp)) // true - modification: `Set()`, `SetByIndex()`, `Add()` ### Ast.Visitor + Sonic provides an advanced API for fully parsing JSON into non-standard types (neither `struct` not `map[string]interface{}`) without using any intermediate representation (`ast.Node` or `interface{}`). For example, you might have the following types which are like `interface{}` but actually not `interface{}`: + ```go type UserNode interface {} @@ -302,7 +344,9 @@ type ( UserArray struct{ Value []UserNode } ) ``` + Sonic provides the following API to return **the preorder traversal of a JSON AST**. The `ast.Visitor` is a SAX style interface which is used in some C++ JSON library. You should implement `ast.Visitor` by yourself and pass it to `ast.Preorder()` method. In your visitor you can make your custom types to represent JSON values. There may be an O(n) space container (such as stack) in your visitor to record the object / array hierarchy. + ```go func Preorder(str string, visitor Visitor, opts *VisitorOptions) error @@ -323,12 +367,14 @@ type Visitor interface { See [ast/visitor.go](https://github.com/bytedance/sonic/blob/main/ast/visitor.go) for detailed usage. We also implement a demo visitor for `UserNode` in [ast/visitor_test.go](https://github.com/bytedance/sonic/blob/main/ast/visitor_test.go). ## Compatibility + Sonic **DOES NOT** ensure to support all environments, due to the difficulty of developing high-performance codes. For developers who use sonic to build their applications in different environments, we have the following suggestions: - Developing on **Mac M1**: Make sure you have Rosetta 2 installed on your machine, and set `GOARCH=amd64` when building your application. Rosetta 2 can automatically translate x86 binaries to arm64 binaries and run x86 applications on Mac M1. - Developing on **Linux arm64**: You can install qemu and use the `qemu-x86_64 -cpu max` command to convert x86 binaries to amr64 binaries for applications built with sonic. The qemu can achieve a similar transfer effect to Rosetta 2 on Mac M1. For developers who want to use sonic on Linux arm64 without qemu, or those who want to handle JSON strictly consistent with `encoding/json`, we provide some compatible APIs as `sonic.API` + - `ConfigDefault`: the sonic's default config (`EscapeHTML=false`,`SortKeys=false`...) to run on sonic-supporting environment. It will fall back to `encoding/json` with the corresponding config, and some options like `SortKeys=false` will be invalid. - `ConfigStd`: the std-compatible config (`EscapeHTML=true`,`SortKeys=true`...) to run on sonic-supporting environment. It will fall back to `encoding/json`. - `ConfigFastest`: the fastest config (`NoQuoteTextMarshaler=true`) to run on sonic-supporting environment. It will fall back to `encoding/json` with the corresponding config, and some options will be invalid. @@ -336,7 +382,9 @@ For developers who want to use sonic on Linux arm64 without qemu, or those who w ## Tips ### Pretouch + Since Sonic uses [golang-asm](https://github.com/twitchyliquid64/golang-asm) as a JIT assembler, which is NOT very suitable for runtime compiling, first-hit running of a huge schema may cause request-timeout or even process-OOM. For better stability, we advise **using `Pretouch()` for huge-schema or compact-memory applications** before `Marshal()/Unmarshal()`. + ```go import ( "reflect" @@ -362,17 +410,23 @@ func init() { ``` ### Copy string -When decoding **string values without any escaped characters**, sonic references them from the origin JSON buffer instead of mallocing a new buffer to copy. This helps a lot for CPU performance but may leave the whole JSON buffer in memory as long as the decoded objects are being used. In practice, we found the extra memory introduced by referring JSON buffer is usually 20% ~ 80% of decoded objects. Once an application holds these objects for a long time (for example, cache the decoded objects for reusing), its in-use memory on the server may go up. We provide the option `decoder.CopyString()` for users to choose not to reference the JSON buffer, which may cause a decline in CPU performance to some degree. + +When decoding **string values without any escaped characters**, sonic references them from the origin JSON buffer instead of mallocing a new buffer to copy. This helps a lot for CPU performance but may leave the whole JSON buffer in memory as long as the decoded objects are being used. In practice, we found the extra memory introduced by referring JSON buffer is usually 20% ~ 80% of decoded objects. Once an application holds these objects for a long time (for example, cache the decoded objects for reusing), its in-use memory on the server may go up. - `Config.CopyString`/`decoder.CopyString()`: We provide the option for `Decode()` / `Unmarshal()` users to choose not to reference the JSON buffer, which may cause a decline in CPU performance to some degree. + +- `GetFromStringNoCopy()`: For memory safty, `sonic.Get()` / `sonic.GetFromString()` now copies return JSON. If users want to get json more quickly and not care about memory usage, you can use `GetFromStringNoCopy()` to return a JSON direclty referenced from source. ### Pass string or []byte? + For alignment to `encoding/json`, we provide API to pass `[]byte` as an argument, but the string-to-bytes copy is conducted at the same time considering safety, which may lose performance when the origin JSON is huge. Therefore, you can use `UnmarshalString()` and `GetFromString()` to pass a string, as long as your origin data is a string or **nocopy-cast** is safe for your []byte. We also provide API `MarshalString()` for convenient **nocopy-cast** of encoded JSON []byte, which is safe since sonic's output bytes is always duplicated and unique. ### Accelerate `encoding.TextMarshaler` -To ensure data security, sonic.Encoder quotes and escapes string values from `encoding.TextMarshaler` interfaces by default, which may degrade performance much if most of your data is in form of them. We provide `encoder.NoQuoteTextMarshaler` to skip these operations, which means you **MUST** ensure their output string escaped and quoted following [RFC8259](https://datatracker.ietf.org/doc/html/rfc8259). +To ensure data security, sonic.Encoder quotes and escapes string values from `encoding.TextMarshaler` interfaces by default, which may degrade performance much if most of your data is in form of them. We provide `encoder.NoQuoteTextMarshaler` to skip these operations, which means you **MUST** ensure their output string escaped and quoted following [RFC8259](https://datatracker.ietf.org/doc/html/rfc8259). ### Better performance for generic data + In **fully-parsed** scenario, `Unmarshal()` performs better than `Get()`+`Node.Interface()`. But if you only have a part of the schema for specific json, you can combine `Get()` and `Unmarshal()` together: + ```go import "github.com/bytedance/sonic" @@ -380,7 +434,9 @@ node, err := sonic.GetFromString(_TwitterJson, "statuses", 3, "user") var user User // your partial schema... err = sonic.UnmarshalString(node.Raw(), &user) ``` + Even if you don't have any schema, use `ast.Node` as the container of generic values instead of `map` or `interface`: + ```go import "github.com/bytedance/sonic" @@ -391,7 +447,9 @@ err = user.Check() // err = user.LoadAll() // only call this when you want to use 'user' concurrently... go someFunc(user) ``` + Why? Because `ast.Node` stores its children using `array`: + - `Array`'s performance is **much better** than `Map` when Inserting (Deserialize) and Scanning (Serialize) data; - **Hashing** (`map[x]`) is not as efficient as **Indexing** (`array[x]`), which `ast.Node` can conduct on **both array and object**; - Using `Interface()`/`Map()` means Sonic must parse all the underlying values, while `ast.Node` can parse them **on demand**. @@ -399,6 +457,7 @@ Why? Because `ast.Node` stores its children using `array`: **CAUTION:** `ast.Node` **DOESN'T** ensure concurrent security directly, due to its **lazy-load** design. However, you can call `Node.Load()`/`Node.LoadAll()` to achieve that, which may bring performance reduction while it still works faster than converting to `map` or `interface{}` ### Ast.Node or Ast.Visitor? + For generic data, `ast.Node` should be enough for your needs in most cases. However, `ast.Node` is designed for partially processing JSON string. It has some special designs such as lazy-load which might not be suitable for directly parsing the whole JSON string like `Unmarshal()`. Although `ast.Node` is better then `map` or `interface{}`, it's also a kind of intermediate representation after all if your final types are customized and you have to convert the above types to your custom types after parsing. @@ -408,4 +467,5 @@ For better performance, in previous case the `ast.Visitor` will be the better ch But `ast.Visitor` is not a very handy API. You might need to write a lot of code to implement your visitor and carefully maintain the tree hierarchy during decoding. Please read the comments in [ast/visitor.go](https://github.com/bytedance/sonic/blob/main/ast/visitor.go) carefully if you decide to use this API. ## Community + Sonic is a subproject of [CloudWeGo](https://www.cloudwego.io/). We are committed to building a cloud native ecosystem. diff --git a/vendor/github.com/bytedance/sonic/README_ZH_CN.md b/vendor/github.com/bytedance/sonic/README_ZH_CN.md index a18e99afe..d0341ab72 100644 --- a/vendor/github.com/bytedance/sonic/README_ZH_CN.md +++ b/vendor/github.com/bytedance/sonic/README_ZH_CN.md @@ -6,10 +6,14 @@ ## 依赖 -- Go 1.16~1.21 +- Go 1.16~1.22 - Linux / MacOS / Windows(需要 Go1.17 以上) - Amd64 架构 +## 接口 + +详见 [go.dev](https://pkg.go.dev/github.com/bytedance/sonic) + ## 特色 - 运行时对象绑定,无需代码生成 @@ -19,7 +23,9 @@ ## 基准测试 对于**所有大小**的 json 和**所有使用场景**, **Sonic 表现均为最佳**。 + - [中型](https://github.com/bytedance/sonic/blob/main/decoder/testdata_test.go#L19) (13kB, 300+ 键, 6 层) + ```powershell goversion: 1.17.1 goos: darwin @@ -84,6 +90,7 @@ BenchmarkLoadNode_Parallel/LoadAll()-16 5493 ns/op 2370.6 BenchmarkLoadNode/Interface()-16 17722 ns/op 734.85 MB/s 13323 B/op 88 allocs/op BenchmarkLoadNode_Parallel/Interface()-16 10330 ns/op 1260.70 MB/s 15178 B/op 88 allocs/op ``` + - [小型](https://github.com/bytedance/sonic/blob/main/testdata/small.go) (400B, 11 个键, 3 层) ![small benchmarks](./docs/imgs/bench-small.png) - [大型](https://github.com/bytedance/sonic/blob/main/testdata/twitter.json) (635kB, 10000+ 个键, 6 层) @@ -100,6 +107,7 @@ BenchmarkLoadNode_Parallel/Interface()-16 10330 ns/op 1260.7 ### 序列化/反序列化 默认的行为基本上与 `encoding/json` 相一致,除了 HTML 转义形式(参见 [Escape HTML](https://github.com/bytedance/sonic/blob/main/README.md#escape-html)) 和 `SortKeys` 功能(参见 [Sort Keys](https://github.com/bytedance/sonic/blob/main/README.md#sort-keys))**没有**遵循 [RFC8259](https://datatracker.ietf.org/doc/html/rfc8259) 。 + ```go import "github.com/bytedance/sonic" @@ -113,7 +121,9 @@ err := sonic.Unmarshal(output, &data) ### 流式输入输出 Sonic 支持解码 `io.Reader` 中输入的 json,或将对象编码为 json 后输出至 `io.Writer`,以处理多个值并减少内存消耗。 + - 编码器 + ```go var o1 = map[string]interface{}{ "a": "b", @@ -128,7 +138,9 @@ fmt.Println(w.String()) // {"a":"b"} // 1 ``` + - 解码器 + ```go var o = map[string]interface{}{} var r = strings.NewReader(`{"a":"b"}{"1":"2"}`) @@ -172,6 +184,7 @@ fm := root.Interface().(float64) // jn == jm ### 对键排序 考虑到排序带来的性能损失(约 10% ), sonic 默认不会启用这个功能。如果你的组件依赖这个行为(如 [zstd](https://github.com/facebook/zstd)) ,可以仿照下面的例子: + ```go import "github.com/bytedance/sonic" import "github.com/bytedance/sonic/encoder" @@ -188,6 +201,7 @@ err := root.SortKeys() ### HTML 转义 考虑到性能损失(约15%), sonic 默认不会启用这个功能。你可以使用 `encoder.EscapeHTML` 选项来开启(与 `encoding/json.HTMLEscape` 行为一致)。 + ```go import "github.com/bytedance/sonic" @@ -196,11 +210,13 @@ ret, err := Encode(v, EscapeHTML) // ret == `{"\u0026\u0026":{"X":"\u003c\u003e" ``` ### 紧凑格式 + Sonic 默认将基本类型( `struct` , `map` 等)编码为紧凑格式的 JSON ,除非使用 `json.RawMessage` or `json.Marshaler` 进行编码: sonic 确保输出的 JSON 合法,但出于性能考虑,**不会**加工成紧凑格式。我们提供选项 `encoder.CompactMarshaler` 来添加此过程, ### 打印错误 如果输入的 JSON 存在无效的语法,sonic 将返回 `decoder.SyntaxError`,该错误支持错误位置的美化输出。 + ```go import "github.com/bytedance/sonic" import "github.com/bytedance/sonic/decoder" @@ -228,6 +244,7 @@ if err != nil { #### 类型不匹配 [Sonic v1.6.0] 如果给定键中存在**类型不匹配**的值, sonic 会抛出 `decoder.MismatchTypeError` (如果有多个,只会报告最后一个),但仍会跳过错误的值并解码下一个 JSON 。 + ```go import "github.com/bytedance/sonic" import "github.com/bytedance/sonic/decoder" @@ -240,6 +257,7 @@ err := UnmarshalString(`{"A":"1","B":1}`, &data) println(err.Error()) // Mismatch type int with value string "at index 5: mismatched type with value\n\n\t{\"A\":\"1\",\"B\":1}\n\t.....^.........\n" fmt.Printf("%+v", data) // {A:0 B:1} ``` + ### `Ast.Node` Sonic/ast.Node 是完全独立的 JSON 抽象语法树库。它实现了序列化和反序列化,并提供了获取和修改通用数据的鲁棒的 API。 @@ -247,6 +265,7 @@ Sonic/ast.Node 是完全独立的 JSON 抽象语法树库。它实现了序列 #### 查找/索引 通过给定的路径搜索 JSON 片段,路径必须为非负整数,字符串或 `nil` 。 + ```go import "github.com/bytedance/sonic" @@ -260,11 +279,13 @@ raw := root.Raw() // == string(input) root, err := sonic.Get(input, "key1", 1, "key2") sub := root.Get("key3").Index(2).Int64() // == 3 ``` + **注意**:由于 `Index()` 使用偏移量来定位数据,比使用扫描的 `Get()` 要快的多,建议尽可能的使用 `Index` 。 Sonic 也提供了另一个 API, `IndexOrGet()` ,以偏移量为基础并且也确保键的匹配。 #### 修改 -使用 ` Set()` / `Unset()` 修改 json 的内容 +使用 `Set()` / `Unset()` 修改 json 的内容 + ```go import "github.com/bytedance/sonic" @@ -281,7 +302,9 @@ println(root.Get("key4").Check()) // "value not exist" ``` #### 序列化 + 要将 `ast.Node` 编码为 json ,使用 `MarshalJson()` 或者 `json.Marshal()` (必须传递指向节点的指针) + ```go import ( "encoding/json" @@ -295,6 +318,7 @@ println(string(buf) == string(exp)) // true ``` #### APIs + - 合法性检查: `Check()`, `Error()`, `Valid()`, `Exist()` - 索引: `Index()`, `Get()`, `IndexPair()`, `IndexOrGet()`, `GetByPath()` - 转换至 go 内置类型: `Int64()`, `Float64()`, `String()`, `Number()`, `Bool()`, `Map[UseNumber|UseNode]()`, `Array[UseNumber|UseNode]()`, `Interface[UseNumber|UseNode]()` @@ -303,7 +327,9 @@ println(string(buf) == string(exp)) // true - 修改: `Set()`, `SetByIndex()`, `Add()` ### `Ast.Visitor` + Sonic 提供了一个高级的 API 用于直接全量解析 JSON 到非标准容器里 (既不是 `struct` 也不是 `map[string]interface{}`) 且不需要借助任何中间表示 (`ast.Node` 或 `interface{}`)。举个例子,你可能定义了下述的类型,它们看起来像 `interface{}`,但实际上并不是: + ```go type UserNode interface {} @@ -318,7 +344,9 @@ type ( UserArray struct{ Value []UserNode } ) ``` + Sonic 提供了下述的 API 来返回 **“对 JSON AST 的前序遍历”**。`ast.Visitor` 是一个 SAX 风格的接口,这在某些 C++ 的 JSON 解析库中被使用到。你需要自己实现一个 `ast.Visitor`,将它传递给 `ast.Preorder()` 方法。在你的实现中你可以使用自定义的类型来表示 JSON 的值。在你的 `ast.Visitor` 中,可能需要有一个 O(n) 空间复杂度的容器(比如说栈)来记录 object / array 的层级。 + ```go func Preorder(str string, visitor Visitor, opts *VisitorOptions) error @@ -335,15 +363,18 @@ type Visitor interface { OnArrayEnd() error } ``` + 详细用法参看 [ast/visitor.go](https://github.com/bytedance/sonic/blob/main/ast/visitor.go),我们还为 `UserNode` 实现了一个示例 `ast.Visitor`,你可以在 [ast/visitor_test.go](https://github.com/bytedance/sonic/blob/main/ast/visitor_test.go) 中找到它。 ## 兼容性 + 由于开发高性能代码的困难性, Sonic **不**保证对所有环境的支持。对于在不同环境中使用 Sonic 构建应用程序的开发者,我们有以下建议: - 在 **Mac M1** 上开发:确保在您的计算机上安装了 Rosetta 2,并在构建时设置 `GOARCH=amd64` 。 Rosetta 2 可以自动将 x86 二进制文件转换为 arm64 二进制文件,并在 Mac M1 上运行 x86 应用程序。 - 在 **Linux arm64** 上开发:您可以安装 qemu 并使用 `qemu-x86_64 -cpu max` 命令来将 x86 二进制文件转换为 arm64 二进制文件。qemu可以实现与Mac M1上的Rosetta 2类似的转换效果。 对于希望在不使用 qemu 下使用 sonic 的开发者,或者希望处理 JSON 时与 `encoding/JSON` 严格保持一致的开发者,我们在 `sonic.API` 中提供了一些兼容性 API + - `ConfigDefault`: 在支持 sonic 的环境下 sonic 的默认配置(`EscapeHTML=false`,`SortKeys=false`等)。行为与具有相应配置的 `encoding/json` 一致,一些选项,如 `SortKeys=false` 将无效。 - `ConfigStd`: 在支持 sonic 的环境下与标准库兼容的配置(`EscapeHTML=true`,`SortKeys=true`等)。行为与 `encoding/json` 一致。 - `ConfigFastest`: 在支持 sonic 的环境下运行最快的配置(`NoQuoteTextMarshaler=true`)。行为与具有相应配置的 `encoding/json` 一致,某些选项将无效。 @@ -351,7 +382,9 @@ type Visitor interface { ## 注意事项 ### 预热 + 由于 Sonic 使用 [golang-asm](https://github.com/twitchyliquid64/golang-asm) 作为 JIT 汇编器,这个库并不适用于运行时编译,第一次运行一个大型模式可能会导致请求超时甚至进程内存溢出。为了更好地稳定性,我们建议在运行大型模式或在内存有限的应用中,在使用 `Marshal()/Unmarshal()` 前运行 `Pretouch()`。 + ```go import ( "reflect" @@ -381,16 +414,17 @@ func init() { 当解码 **没有转义字符的字符串**时, sonic 会从原始的 JSON 缓冲区内引用而不是复制到新的一个缓冲区中。这对 CPU 的性能方面很有帮助,但是可能因此在解码后对象仍在使用的时候将整个 JSON 缓冲区保留在内存中。实践中我们发现,通过引用 JSON 缓冲区引入的额外内存通常是解码后对象的 20% 至 80% ,一旦应用长期保留这些对象(如缓存以备重用),服务器所使用的内存可能会增加。我们提供了选项 `decoder.CopyString()` 供用户选择,不引用 JSON 缓冲区。这可能在一定程度上降低 CPU 性能。 ### 传递字符串还是字节数组? + 为了和 `encoding/json` 保持一致,我们提供了传递 `[]byte` 作为参数的 API ,但考虑到安全性,字符串到字节的复制是同时进行的,这在原始 JSON 非常大时可能会导致性能损失。因此,你可以使用 `UnmarshalString()` 和 `GetFromString()` 来传递字符串,只要你的原始数据是字符串,或**零拷贝类型转换**对于你的字节数组是安全的。我们也提供了 `MarshalString()` 的 API ,以便对编码的 JSON 字节数组进行**零拷贝类型转换**,因为 sonic 输出的字节始终是重复并且唯一的,所以这样是安全的。 ### 加速 `encoding.TextMarshaler` 为了保证数据安全性, `sonic.Encoder` 默认会对来自 `encoding.TextMarshaler` 接口的字符串进行引用和转义,如果大部分数据都是这种形式那可能会导致很大的性能损失。我们提供了 `encoder.NoQuoteTextMarshaler` 选项来跳过这些操作,但你**必须**保证他们的输出字符串依照 [RFC8259](https://datatracker.ietf.org/doc/html/rfc8259) 进行了转义和引用。 - ### 泛型的性能优化 在 **完全解析**的场景下, `Unmarshal()` 表现得比 `Get()`+`Node.Interface()` 更好。但是如果你只有特定 JSON 的部分模式,你可以将 `Get()` 和 `Unmarshal()` 结合使用: + ```go import "github.com/bytedance/sonic" @@ -398,7 +432,9 @@ node, err := sonic.GetFromString(_TwitterJson, "statuses", 3, "user") var user User // your partial schema... err = sonic.UnmarshalString(node.Raw(), &user) ``` + 甚至如果你没有任何模式,可以用 `ast.Node` 代替 `map` 或 `interface` 作为泛型的容器: + ```go import "github.com/bytedance/sonic" @@ -409,7 +445,9 @@ err = user.Check() // err = user.LoadAll() // only call this when you want to use 'user' concurrently... go someFunc(user) ``` + 为什么?因为 `ast.Node` 使用 `array` 来存储其子节点: + - 在插入(反序列化)和扫描(序列化)数据时,`Array` 的性能比 `Map` **好得多**; - **哈希**(`map[x]`)的效率不如**索引**(`array[x]`)高效,而 `ast.Node` 可以在数组和对象上使用索引; - 使用 `Interface()` / `Map()` 意味着 sonic 必须解析所有的底层值,而 `ast.Node` 可以**按需解析**它们。 @@ -417,6 +455,7 @@ go someFunc(user) **注意**:由于 `ast.Node` 的惰性加载设计,其**不能**直接保证并发安全性,但你可以调用 `Node.Load()` / `Node.LoadAll()` 来实现并发安全。尽管可能会带来性能损失,但仍比转换成 `map` 或 `interface{}` 更为高效。 ### 使用 `ast.Node` 还是 `ast.Visitor`? + 对于泛型数据的解析,`ast.Node` 在大多数场景上应该能够满足你的需求。 然而,`ast.Node` 是一种针对部分解析 JSON 而设计的泛型容器,它包含一些特殊设计,比如惰性加载,如果你希望像 `Unmarshal()` 那样直接解析整个 JSON,这些设计可能并不合适。尽管 `ast.Node` 相较于 `map` 或 `interface{}` 来说是更好的一种泛型容器,但它毕竟也是一种中间表示,如果你的最终类型是自定义的,你还得在解析完成后将上述类型转化成你自定义的类型。 diff --git a/vendor/github.com/bytedance/sonic/api.go b/vendor/github.com/bytedance/sonic/api.go index 9525b7afd..54d9a2160 100644 --- a/vendor/github.com/bytedance/sonic/api.go +++ b/vendor/github.com/bytedance/sonic/api.go @@ -20,6 +20,7 @@ import ( `io` `github.com/bytedance/sonic/ast` + `github.com/bytedance/sonic/internal/rt` ) // Config is a combination of sonic/encoder.Options and sonic/decoder.Options @@ -73,6 +74,9 @@ type Config struct { // NoValidateJSONMarshaler indicates that the encoder should not validate the output string // after encoding the JSONMarshaler to JSON. NoValidateJSONMarshaler bool + + // NoEncoderNewline indicates that the encoder should not add a newline after every message + NoEncoderNewline bool } var ( @@ -170,27 +174,41 @@ func UnmarshalString(buf string, val interface{}) error { return ConfigDefault.UnmarshalFromString(buf, val) } -// Get searches the given path from json, -// and returns its representing ast.Node. +// Get searches and locates the given path from src json, +// and returns a ast.Node representing the partially json. // // Each path arg must be integer or string: // - Integer is target index(>=0), means searching current node as array. // - String is target key, means searching current node as object. // // -// Note, the api expects the json is well-formed at least, -// otherwise it may return unexpected result. +// Notice: It expects the src json is **Well-formed** and **Immutable** when calling, +// otherwise it may return unexpected result. +// Considering memory safty, the returned JSON is **Copied** from the input func Get(src []byte, path ...interface{}) (ast.Node, error) { - return GetFromString(string(src), path...) + return GetCopyFromString(rt.Mem2Str(src), path...) } -// GetFromString is same with Get except src is string, -// which can reduce unnecessary memory copy. +// GetFromString is same with Get except src is string. +// +// WARNING: The returned JSON is **Referenced** from the input. +// Caching or long-time holding the returned node may cause OOM. +// If your src is big, consider use GetFromStringCopy(). func GetFromString(src string, path ...interface{}) (ast.Node, error) { return ast.NewSearcher(src).GetByPath(path...) } +// GetCopyFromString is same with Get except src is string +func GetCopyFromString(src string, path ...interface{}) (ast.Node, error) { + return ast.NewSearcher(src).GetByPathCopy(path...) +} + // Valid reports whether data is a valid JSON encoding. func Valid(data []byte) bool { return ConfigDefault.Valid(data) } + +// Valid reports whether data is a valid JSON encoding. +func ValidString(data string) bool { + return ConfigDefault.Valid(rt.Str2Mem(data)) +} diff --git a/vendor/github.com/bytedance/sonic/ast/api_amd64.go b/vendor/github.com/bytedance/sonic/ast/api_amd64.go index da6738efd..fa4375630 100644 --- a/vendor/github.com/bytedance/sonic/ast/api_amd64.go +++ b/vendor/github.com/bytedance/sonic/ast/api_amd64.go @@ -1,4 +1,4 @@ -// +build amd64,go1.16,!go1.22 +// +build amd64,go1.16,!go1.23 /* * Copyright 2022 ByteDance Inc. @@ -131,27 +131,3 @@ func (self *Parser) getByPath(path ...interface{}) (int, types.ParsingError) { } return start, 0 } - -func (self *Searcher) GetByPath(path ...interface{}) (Node, error) { - var err types.ParsingError - var start int - - self.parser.p = 0 - start, err = self.parser.getByPath(path...) - if err != 0 { - // for compatibility with old version - if err == types.ERR_NOT_FOUND { - return Node{}, ErrNotExist - } - if err == types.ERR_UNSUPPORT_TYPE { - panic("path must be either int(>=0) or string") - } - return Node{}, self.parser.syntaxError(err) - } - - t := switchRawType(self.parser.s[start]) - if t == _V_NONE { - return Node{}, self.parser.ExportError(err) - } - return newRawNode(self.parser.s[start:self.parser.p], t), nil -} diff --git a/vendor/github.com/bytedance/sonic/ast/api_compat.go b/vendor/github.com/bytedance/sonic/ast/api_compat.go index 7b475eb61..9244e76e1 100644 --- a/vendor/github.com/bytedance/sonic/ast/api_compat.go +++ b/vendor/github.com/bytedance/sonic/ast/api_compat.go @@ -1,4 +1,4 @@ -// +build !amd64 !go1.16 go1.22 +// +build !amd64 !go1.16 go1.23 /* * Copyright 2022 ByteDance Inc. @@ -21,14 +21,13 @@ package ast import ( `encoding/base64` `encoding/json` - `fmt` `github.com/bytedance/sonic/internal/native/types` `github.com/bytedance/sonic/internal/rt` ) func init() { - println("WARNING: sonic only supports Go1.16~1.20 && CPU amd64, but your environment is not suitable") + println("WARNING: sonic only supports Go1.16~1.22 && CPU amd64, but your environment is not suitable") } func quote(buf *[]byte, val string) { @@ -88,37 +87,25 @@ func (self *Node) encodeInterface(buf *[]byte) error { return nil } -func (self *Searcher) GetByPath(path ...interface{}) (Node, error) { - self.parser.p = 0 - +func (self *Parser) getByPath(path ...interface{}) (int, types.ParsingError) { var err types.ParsingError for _, p := range path { if idx, ok := p.(int); ok && idx >= 0 { - if err = self.parser.searchIndex(idx); err != 0 { - return Node{}, self.parser.ExportError(err) + if err = self.searchIndex(idx); err != 0 { + return -1, err } } else if key, ok := p.(string); ok { - if err = self.parser.searchKey(key); err != 0 { - return Node{}, self.parser.ExportError(err) + if err = self.searchKey(key); err != 0 { + return -1, err } } else { panic("path must be either int(>=0) or string") } } - var start = self.parser.p - if start, err = self.parser.skip(); err != 0 { - return Node{}, self.parser.ExportError(err) - } - ns := len(self.parser.s) - if self.parser.p > ns || start >= ns || start>=self.parser.p { - return Node{}, fmt.Errorf("skip %d char out of json boundary", start) - } - - t := switchRawType(self.parser.s[start]) - if t == _V_NONE { - return Node{}, self.parser.ExportError(err) + var start int + if start, err = self.skip(); err != 0 { + return -1, err } - - return newRawNode(self.parser.s[start:self.parser.p], t), nil -} \ No newline at end of file + return start, 0 +} diff --git a/vendor/github.com/bytedance/sonic/ast/buffer.go b/vendor/github.com/bytedance/sonic/ast/buffer.go index 93f4ff47a..bccbf4814 100644 --- a/vendor/github.com/bytedance/sonic/ast/buffer.go +++ b/vendor/github.com/bytedance/sonic/ast/buffer.go @@ -58,29 +58,89 @@ func (self *linkedNodes) At(i int) (*Node) { return nil } -func (self *linkedNodes) Add(v Node) { - if self.size < _DEFAULT_NODE_CAP { - self.head[self.size] = v - self.size++ +func (self *linkedNodes) MoveOne(source int, target int) { + if source == target { return } + if source < 0 || source >= self.size || target < 0 || target >= self.size { + return + } + // reserve source + n := *self.At(source) + if source < target { + // move every element (source,target] one step back + for i:=source; itarget; i-- { + *self.At(i) = *self.At(i-1) + } + } + // set target + *self.At(target) = n +} + +func (self *linkedNodes) Pop() { + if self == nil || self.size == 0 { + return + } + self.Set(self.size-1, Node{}) + self.size-- +} + +func (self *linkedPairs) Pop() { + if self == nil || self.size == 0 { + return + } + self.Set(self.size-1, Pair{}) + self.size-- +} + +func (self *linkedNodes) Push(v Node) { + self.Set(self.size, v) +} - a, b, c := self.size/_DEFAULT_NODE_CAP-1 , self.size%_DEFAULT_NODE_CAP, cap(self.tail) - if a - c >= 0 { +func (self *linkedNodes) Set(i int, v Node) { + if i < _DEFAULT_NODE_CAP { + self.head[i] = v + if self.size <= i { + self.size = i+1 + } + return + } + a, b := i/_DEFAULT_NODE_CAP-1, i%_DEFAULT_NODE_CAP + if a < 0 { + self.head[b] = v + } else { + self.growTailLength(a+1) + var n = &self.tail[a] + if *n == nil { + *n = new(nodeChunk) + } + (*n)[b] = v + } + if self.size <= i { + self.size = i+1 + } +} + +func (self *linkedNodes) growTailLength(l int) { + if l <= len(self.tail) { + return + } + c := cap(self.tail) + for c < l { c += 1 + c>>_APPEND_GROW_SHIFT - tmp := make([]*nodeChunk, a + 1, c) - copy(tmp, self.tail) - self.tail = tmp - } else if a >= len(self.tail) { - self.tail = self.tail[:a+1] } - - var n = &self.tail[a] - if *n == nil { - *n = new(nodeChunk) + if c == cap(self.tail) { + self.tail = self.tail[:l] + return } - (*n)[b] = v - self.size++ + tmp := make([]*nodeChunk, l, c) + copy(tmp, self.tail) + self.tail = tmp } func (self *linkedNodes) ToSlice(con []Node) { @@ -169,29 +229,49 @@ func (self *linkedPairs) At(i int) *Pair { return nil } -func (self *linkedPairs) Add(v Pair) { - if self.size < _DEFAULT_NODE_CAP { - self.head[self.size] = v - self.size++ +func (self *linkedPairs) Push(v Pair) { + self.Set(self.size, v) +} + +func (self *linkedPairs) Set(i int, v Pair) { + if i < _DEFAULT_NODE_CAP { + self.head[i] = v + if self.size <= i { + self.size = i+1 + } return } + a, b := i/_DEFAULT_NODE_CAP-1, i%_DEFAULT_NODE_CAP + if a < 0 { + self.head[b] = v + } else { + self.growTailLength(a+1) + var n = &self.tail[a] + if *n == nil { + *n = new(pairChunk) + } + (*n)[b] = v + } + if self.size <= i { + self.size = i+1 + } +} - a, b, c := self.size/_DEFAULT_NODE_CAP-1 , self.size%_DEFAULT_NODE_CAP, cap(self.tail) - if a - c >= 0 { +func (self *linkedPairs) growTailLength(l int) { + if l <= len(self.tail) { + return + } + c := cap(self.tail) + for c < l { c += 1 + c>>_APPEND_GROW_SHIFT - tmp := make([]*pairChunk, a + 1, c) - copy(tmp, self.tail) - self.tail = tmp - } else if a >= len(self.tail) { - self.tail = self.tail[:a+1] } - - var n = &self.tail[a] - if *n == nil { - *n = new(pairChunk) + if c == cap(self.tail) { + self.tail = self.tail[:l] + return } - (*n)[b] = v - self.size++ + tmp := make([]*pairChunk, l, c) + copy(tmp, self.tail) + self.tail = tmp } // linear search @@ -271,7 +351,7 @@ func (self *linkedPairs) Swap(i, j int) { } func (self *linkedPairs) Sort() { - sort.Sort(self) + sort.Stable(self) } // Compare two strings from the pos d. diff --git a/vendor/github.com/bytedance/sonic/ast/encode.go b/vendor/github.com/bytedance/sonic/ast/encode.go index 263ae5a9d..956809c2c 100644 --- a/vendor/github.com/bytedance/sonic/ast/encode.go +++ b/vendor/github.com/bytedance/sonic/ast/encode.go @@ -193,20 +193,9 @@ func (self *Node) encodeArray(buf *[]byte) error { *buf = append(*buf, '[') - var s = (*linkedNodes)(self.p) var started bool - if nb > 0 { - n := s.At(0) - if n.Exists() { - if err := n.encode(buf); err != nil { - return err - } - started = true - } - } - - for i := 1; i < nb; i++ { - n := s.At(i) + for i := 0; i < nb; i++ { + n := self.nodeAt(i) if !n.Exists() { continue } @@ -250,21 +239,10 @@ func (self *Node) encodeObject(buf *[]byte) error { *buf = append(*buf, '{') - var s = (*linkedPairs)(self.p) var started bool - if nb > 0 { - n := s.At(0) - if n.Value.Exists() { - if err := n.encode(buf); err != nil { - return err - } - started = true - } - } - - for i := 1; i < nb; i++ { - n := s.At(i) - if !n.Value.Exists() { + for i := 0; i < nb; i++ { + n := self.pairAt(i) + if n == nil || !n.Value.Exists() { continue } if started { diff --git a/vendor/github.com/bytedance/sonic/ast/iterator.go b/vendor/github.com/bytedance/sonic/ast/iterator.go index 3c4187a9c..64e1e5a90 100644 --- a/vendor/github.com/bytedance/sonic/ast/iterator.go +++ b/vendor/github.com/bytedance/sonic/ast/iterator.go @@ -32,7 +32,11 @@ func (self *Node) Values() (ListIterator, error) { if err := self.should(types.V_ARRAY, "an array"); err != nil { return ListIterator{}, err } - return ListIterator{Iterator{p: self}}, nil + return self.values(), nil +} + +func (self *Node) values() ListIterator { + return ListIterator{Iterator{p: self}} } // Properties returns iterator for object's children traversal @@ -40,7 +44,11 @@ func (self *Node) Properties() (ObjectIterator, error) { if err := self.should(types.V_OBJECT, "an object"); err != nil { return ObjectIterator{}, err } - return ObjectIterator{Iterator{p: self}}, nil + return self.properties(), nil +} + +func (self *Node) properties() ObjectIterator { + return ObjectIterator{Iterator{p: self}} } type Iterator struct { @@ -114,7 +122,7 @@ next_start: } else { n := self.p.pairAt(self.i) self.i++ - if !n.Value.Exists() { + if n == nil || !n.Value.Exists() { goto next_start } return n diff --git a/vendor/github.com/bytedance/sonic/ast/node.go b/vendor/github.com/bytedance/sonic/ast/node.go index 990908ddd..9637659b1 100644 --- a/vendor/github.com/bytedance/sonic/ast/node.go +++ b/vendor/github.com/bytedance/sonic/ast/node.go @@ -491,7 +491,6 @@ func (self *Node) StrictFloat64() (float64, error) { // Len returns children count of a array|object|string node // WARN: For partially loaded node, it also works but only counts the parsed children -// WARN: For ARRAY|OBJECT nodes which has been conducted `UnsetXX()`, its length WON'T change func (self *Node) Len() (int, error) { if err := self.checkRaw(); err != nil { return 0, err @@ -534,10 +533,12 @@ func (self *Node) Set(key string, node Node) (bool, error) { if err := node.Check(); err != nil { return false, err } - + if self.t == _V_NONE || self.t == types.V_NULL { *self = NewObject([]Pair{{key, node}}) return false, nil + } else if self.itype() != types.V_OBJECT { + return false, ErrUnsupportType } p := self.Get(key) @@ -548,7 +549,7 @@ func (self *Node) Set(key string, node Node) (bool, error) { *self = newObject(new(linkedPairs)) } s := (*linkedPairs)(self.p) - s.Add(Pair{key, node}) + s.Push(Pair{key, node}) self.l++ return false, nil @@ -565,20 +566,22 @@ func (self *Node) SetAny(key string, val interface{}) (bool, error) { return self.Set(key, NewAny(val)) } -// Unset RESET the node of given key under object parent, and reports if the key has existed. -// WARN: After conducting `UnsetXX()`, the node's length WON'T change +// Unset REMOVE (soft) the node of given key under object parent, and reports if the key has existed. func (self *Node) Unset(key string) (bool, error) { if err := self.should(types.V_OBJECT, "an object"); err != nil { return false, err } + // NOTICE: must get acurate length before deduct + if err := self.skipAllKey(); err != nil { + return false, err + } p, i := self.skipKey(key) if !p.Exists() { return false, nil } else if err := p.Check(); err != nil { return false, err } - - self.removePair(i) + self.removePairAt(i) return true, nil } @@ -614,22 +617,28 @@ func (self *Node) SetAnyByIndex(index int, val interface{}) (bool, error) { return self.SetByIndex(index, NewAny(val)) } -// UnsetByIndex remove the node of given index -// WARN: After conducting `UnsetXX()`, the node's length WON'T change +// UnsetByIndex REOMVE (softly) the node of given index. +// +// WARN: this will change address of elements, which is a dangerous action. +// Use Unset() for object or Pop() for array instead. func (self *Node) UnsetByIndex(index int) (bool, error) { - if err := self.Check(); err != nil { + if err := self.checkRaw(); err != nil { return false, err } var p *Node it := self.itype() + if it == types.V_ARRAY { - p = self.Index(index) - }else if it == types.V_OBJECT { - if err := self.checkRaw(); err != nil { + if err := self.skipAllIndex(); err != nil { return false, err } - pr := self.skipIndexPair(index) + p = self.nodeAt(index) + } else if it == types.V_OBJECT { + if err := self.skipAllKey(); err != nil { + return false, err + } + pr := self.pairAt(index) if pr == nil { return false, ErrNotExist } @@ -642,6 +651,12 @@ func (self *Node) UnsetByIndex(index int) (bool, error) { return false, ErrNotExist } + // last elem + if index == self.len() - 1 { + return true, self.Pop() + } + + // not last elem, self.len() change but linked-chunk not change if it == types.V_ARRAY { self.removeNode(index) }else if it == types.V_OBJECT { @@ -665,16 +680,101 @@ func (self *Node) Add(node Node) error { if err := self.should(types.V_ARRAY, "an array"); err != nil { return err } + s, err := self.unsafeArray() if err != nil { return err } - s.Add(node) + // Notice: array won't have unset node in tail + s.Push(node) self.l++ return nil } +// Pop remove the last child of the V_Array or V_Object node. +func (self *Node) Pop() error { + if err := self.checkRaw(); err != nil { + return err + } + + if it := self.itype(); it == types.V_ARRAY { + s, err := self.unsafeArray() + if err != nil { + return err + } + // remove tail unset nodes + for i := s.Len()-1; i >= 0; i-- { + if s.At(i).Exists() { + s.Pop() + self.l-- + break + } + s.Pop() + } + + } else if it == types.V_OBJECT { + s, err := self.unsafeMap() + if err != nil { + return err + } + // remove tail unset nodes + for i := s.Len()-1; i >= 0; i-- { + if p := s.At(i); p != nil && p.Value.Exists() { + s.Pop() + self.l-- + break + } + s.Pop() + } + + } else { + return ErrUnsupportType + } + + return nil +} + +// Move moves the child at src index to dst index, +// meanwhile slides sliblings from src+1 to dst. +// +// WARN: this will change address of elements, which is a dangerous action. +func (self *Node) Move(dst, src int) error { + if err := self.should(types.V_ARRAY, "an array"); err != nil { + return err + } + + s, err := self.unsafeArray() + if err != nil { + return err + } + + // check if any unset node exists + if l := s.Len(); self.len() != l { + di, si := dst, src + // find real pos of src and dst + for i := 0; i < l; i++ { + if s.At(i).Exists() { + di-- + si-- + } + if di == -1 { + dst = i + di-- + } + if si == -1 { + src = i + si-- + } + if di == -2 && si == -2 { + break + } + } + } + + s.MoveOne(src, dst) + return nil +} // SetAny wraps val with V_ANY node, and Add() the node. func (self *Node) AddAny(val interface{}) error { @@ -721,8 +821,6 @@ func (self *Node) Get(key string) *Node { // Index indexies node at given idx, // node type CAN be either V_OBJECT or V_ARRAY -// WARN: After conducting `UnsetXX()`, the node's length WON'T change, -// thus its children's indexing WON'T change too func (self *Node) Index(idx int) *Node { if err := self.checkRaw(); err != nil { return unwrapError(err) @@ -746,8 +844,6 @@ func (self *Node) Index(idx int) *Node { // IndexPair indexies pair at given idx, // node type MUST be either V_OBJECT -// WARN: After conducting `UnsetXX()`, the node's length WON'T change, -// thus its children's indexing WON'T change too func (self *Node) IndexPair(idx int) *Pair { if err := self.should(types.V_OBJECT, "an object"); err != nil { return nil @@ -755,19 +851,30 @@ func (self *Node) IndexPair(idx int) *Pair { return self.skipIndexPair(idx) } +func (self *Node) indexOrGet(idx int, key string) (*Node, int) { + if err := self.should(types.V_OBJECT, "an object"); err != nil { + return unwrapError(err), idx + } + + pr := self.skipIndexPair(idx) + if pr != nil && pr.Key == key { + return &pr.Value, idx + } + + return self.skipKey(key) +} + // IndexOrGet firstly use idx to index a value and check if its key matches // If not, then use the key to search value func (self *Node) IndexOrGet(idx int, key string) *Node { - if err := self.should(types.V_OBJECT, "an object"); err != nil { - return unwrapError(err) - } + node, _ := self.indexOrGet(idx, key) + return node +} - pr := self.skipIndexPair(idx) - if pr != nil && pr.Key == key { - return &pr.Value - } - n, _ := self.skipKey(key) - return n +// IndexOrGetWithIdx attempts to retrieve a node by index and key, returning the node and its correct index. +// If the key does not match at the given index, it searches by key and returns the node with its updated index. +func (self *Node) IndexOrGetWithIdx(idx int, key string) (*Node, int) { + return self.indexOrGet(idx, key) } /** Generic Value Converters **/ @@ -864,7 +971,7 @@ func (self *Node) SortKeys(recurse bool) error { } if self.itype() == types.V_OBJECT { return self.sortKeys(recurse) - } else { + } else if self.itype() == types.V_ARRAY { var err error err2 := self.ForEach(func(path Sequence, node *Node) bool { it := node.itype() @@ -880,10 +987,16 @@ func (self *Node) SortKeys(recurse bool) error { return err } return err2 + } else { + return nil } } func (self *Node) sortKeys(recurse bool) (err error) { + // check raw node first + if err := self.checkRaw(); err != nil { + return err + } ps, err := self.unsafeMap() if err != nil { return err @@ -1172,6 +1285,19 @@ func (self *Node) nodeAt(i int) *Node { p = &stack.v } else { p = (*linkedNodes)(self.p) + if l := p.Len(); l != self.len() { + // some nodes got unset, iterate to skip them + for j:=0; j=0) or string") + } + return Node{}, self.parser.syntaxError(err) + } + + t := switchRawType(self.parser.s[start]) + if t == _V_NONE { + return Node{}, self.parser.ExportError(err) + } + + // copy string to reducing memory usage + var raw string + if copystring { + raw = rt.Mem2Str([]byte(self.parser.s[start:self.parser.p])) + } else { + raw = self.parser.s[start:self.parser.p] + } + return newRawNode(raw, t), nil +} diff --git a/vendor/github.com/bytedance/sonic/compat.go b/vendor/github.com/bytedance/sonic/compat.go index ec414c0cf..728bc1767 100644 --- a/vendor/github.com/bytedance/sonic/compat.go +++ b/vendor/github.com/bytedance/sonic/compat.go @@ -1,4 +1,4 @@ -// +build !amd64 !go1.16 go1.22 +// +build !amd64 !go1.16 go1.23 /* * Copyright 2021 ByteDance Inc. diff --git a/vendor/github.com/bytedance/sonic/decoder/decoder_amd64.go b/vendor/github.com/bytedance/sonic/decoder/decoder_amd64.go index 7c2845514..346ebbce5 100644 --- a/vendor/github.com/bytedance/sonic/decoder/decoder_amd64.go +++ b/vendor/github.com/bytedance/sonic/decoder/decoder_amd64.go @@ -1,4 +1,4 @@ -// +build amd64,go1.16,!go1.22 +// +build amd64,go1.16,!go1.23 /* * Copyright 2023 ByteDance Inc. diff --git a/vendor/github.com/bytedance/sonic/decoder/decoder_compat.go b/vendor/github.com/bytedance/sonic/decoder/decoder_compat.go index 84bae4387..7883862c3 100644 --- a/vendor/github.com/bytedance/sonic/decoder/decoder_compat.go +++ b/vendor/github.com/bytedance/sonic/decoder/decoder_compat.go @@ -1,4 +1,4 @@ -// +build !amd64 !go1.16 go1.22 +// +build !amd64 !go1.16 go1.23 /* * Copyright 2023 ByteDance Inc. @@ -30,7 +30,7 @@ import ( ) func init() { - println("WARNING: sonic only supports Go1.16~1.20 && CPU amd64, but your environment is not suitable") + println("WARNING: sonic only supports Go1.16~1.22 && CPU amd64, but your environment is not suitable") } const ( diff --git a/vendor/github.com/bytedance/sonic/encoder/encoder_amd64.go b/vendor/github.com/bytedance/sonic/encoder/encoder_amd64.go index e93b09a25..b4f1b7b52 100644 --- a/vendor/github.com/bytedance/sonic/encoder/encoder_amd64.go +++ b/vendor/github.com/bytedance/sonic/encoder/encoder_amd64.go @@ -1,4 +1,4 @@ -// +build amd64,go1.16,!go1.22 +// +build amd64,go1.16,!go1.23 /* * Copyright 2023 ByteDance Inc. @@ -63,6 +63,9 @@ const ( // after encoding the JSONMarshaler to JSON. NoValidateJSONMarshaler Options = encoder.NoValidateJSONMarshaler + // NoEncoderNewline indicates that the encoder should not add a newline after every message + NoEncoderNewline Options = encoder.NoEncoderNewline + // CompatibleWithStd is used to be compatible with std encoder. CompatibleWithStd Options = encoder.CompatibleWithStd ) diff --git a/vendor/github.com/bytedance/sonic/encoder/encoder_compat.go b/vendor/github.com/bytedance/sonic/encoder/encoder_compat.go index 2e02b59cd..320dd9b5c 100644 --- a/vendor/github.com/bytedance/sonic/encoder/encoder_compat.go +++ b/vendor/github.com/bytedance/sonic/encoder/encoder_compat.go @@ -1,4 +1,4 @@ -// +build !amd64 !go1.16 go1.22 +// +build !amd64 !go1.16 go1.23 /* * Copyright 2023 ByteDance Inc. @@ -28,7 +28,7 @@ import ( ) func init() { - println("WARNING: sonic only supports Go1.16~1.20 && CPU amd64, but your environment is not suitable") + println("WARNING: sonic only supports Go1.16~1.22 && CPU amd64, but your environment is not suitable") } // Options is a set of encoding options. @@ -42,6 +42,7 @@ const ( bitNoNullSliceOrMap bitValidateString bitNoValidateJSONMarshaler + bitNoEncoderNewline // used for recursive compile bitPointerValue = 63 @@ -77,6 +78,9 @@ const ( // NoValidateJSONMarshaler indicates that the encoder should not validate the output string // after encoding the JSONMarshaler to JSON. NoValidateJSONMarshaler Options = 1 << bitNoValidateJSONMarshaler + + // NoEncoderNewline indicates that the encoder should not add a newline after every message + NoEncoderNewline Options = 1 << bitNoEncoderNewline // CompatibleWithStd is used to be compatible with std encoder. CompatibleWithStd Options = SortMapKeys | EscapeHTML | CompactMarshaler @@ -130,6 +134,15 @@ func (self *Encoder) SetNoValidateJSONMarshaler(f bool) { } } +// SetNoEncoderNewline specifies if option NoEncoderNewline opens +func (self *Encoder) SetNoEncoderNewline(f bool) { + if f { + self.Opts |= NoEncoderNewline + } else { + self.Opts &= ^NoEncoderNewline + } +} + // SetCompactMarshaler specifies if option CompactMarshaler opens func (self *Encoder) SetCompactMarshaler(f bool) { if f { diff --git a/vendor/github.com/bytedance/sonic/internal/decoder/asm_stubs_amd64_go121.go b/vendor/github.com/bytedance/sonic/internal/decoder/asm_stubs_amd64_go121.go index 5db5b5cd0..6adeac0cf 100644 --- a/vendor/github.com/bytedance/sonic/internal/decoder/asm_stubs_amd64_go121.go +++ b/vendor/github.com/bytedance/sonic/internal/decoder/asm_stubs_amd64_go121.go @@ -1,4 +1,4 @@ -// +build go1.21,!go1.22 +// +build go1.21,!go1.23 // Copyright 2023 CloudWeGo Authors // diff --git a/vendor/github.com/bytedance/sonic/internal/decoder/assembler_regabi_amd64.go b/vendor/github.com/bytedance/sonic/internal/decoder/assembler_regabi_amd64.go index 3d223e14e..0defb75a5 100644 --- a/vendor/github.com/bytedance/sonic/internal/decoder/assembler_regabi_amd64.go +++ b/vendor/github.com/bytedance/sonic/internal/decoder/assembler_regabi_amd64.go @@ -1,5 +1,4 @@ -//go:build go1.17 && !go1.22 -// +build go1.17,!go1.22 +// +build go1.17,!go1.23 /* * Copyright 2021 ByteDance Inc. @@ -420,9 +419,9 @@ func (self *_Assembler) call_go(fn obj.Addr) { } func (self *_Assembler) callc(fn obj.Addr) { - self.Emit("XCHGQ", _IP, _BP) + self.save(_IP) self.call(fn) - self.Emit("XCHGQ", _IP, _BP) + self.load(_IP) } func (self *_Assembler) call_c(fn obj.Addr) { @@ -1164,7 +1163,7 @@ var ( var ( _F_FieldMap_GetCaseInsensitive obj.Addr - _Empty_Slice = make([]byte, 0) + _Empty_Slice = []byte{} _Zero_Base = int64(uintptr(((*rt.GoSlice)(unsafe.Pointer(&_Empty_Slice))).Ptr)) ) @@ -1641,7 +1640,8 @@ func (self *_Assembler) _asm_OP_check_empty(p *_Instr) { self.Emit("CMPB", jit.Sib(_IP, _IC, 1, 0), jit.Imm(int64(rbracket))) // CMPB (IP)(IC), ']' self.Sjmp("JNE" , "_not_empty_array_{n}") // JNE _not_empty_array_{n} self.Emit("MOVQ", _AX, _IC) // MOVQ AX, IC - self.StorePtr(_Zero_Base, jit.Ptr(_VP, 0), _AX) // MOVQ $zerobase, (VP) + self.Emit("MOVQ", jit.Imm(_Zero_Base), _AX) + self.WritePtrAX(9, jit.Ptr(_VP, 0), false) self.Emit("PXOR", _X0, _X0) // PXOR X0, X0 self.Emit("MOVOU", _X0, jit.Ptr(_VP, 8)) // MOVOU X0, 8(VP) self.Xjmp("JMP" , p.vi()) // JMP {p.vi()} diff --git a/vendor/github.com/bytedance/sonic/internal/decoder/assembler_stkabi_amd64.go b/vendor/github.com/bytedance/sonic/internal/decoder/assembler_stkabi_amd64.go index 57a38b420..9e2acc23f 100644 --- a/vendor/github.com/bytedance/sonic/internal/decoder/assembler_stkabi_amd64.go +++ b/vendor/github.com/bytedance/sonic/internal/decoder/assembler_stkabi_amd64.go @@ -1651,7 +1651,8 @@ func (self *_Assembler) _asm_OP_check_empty(p *_Instr) { self.Emit("CMPB", jit.Sib(_IP, _IC, 1, 0), jit.Imm(int64(rbracket))) // CMPB (IP)(IC), ']' self.Sjmp("JNE" , "_not_empty_array_{n}") // JNE _not_empty_array_{n} self.Emit("MOVQ", _AX, _IC) // MOVQ AX, IC - self.StorePtr(_Zero_Base, jit.Ptr(_VP, 0), _AX) // MOVQ $zerobase, (VP) + self.Emit("MOVQ", jit.Imm(_Zero_Base), _AX) + self.WritePtrAX(9, jit.Ptr(_VP, 0), false) self.Emit("PXOR" , _X0, _X0) // PXOR X0, X0 self.Emit("MOVOU", _X0, jit.Ptr(_VP, 8)) // MOVOU X0, 8(VP) self.Xjmp("JMP" , p.vi()) // JMP {p.vi()} diff --git a/vendor/github.com/bytedance/sonic/internal/decoder/compiler.go b/vendor/github.com/bytedance/sonic/internal/decoder/compiler.go index e9e2b77fc..b350c0461 100644 --- a/vendor/github.com/bytedance/sonic/internal/decoder/compiler.go +++ b/vendor/github.com/bytedance/sonic/internal/decoder/compiler.go @@ -527,40 +527,47 @@ func (self *_Compiler) compile(vt reflect.Type) (ret _Program, err error) { return } -func (self *_Compiler) compileOne(p *_Program, sp int, vt reflect.Type) { - /* check for recursive nesting */ - ok := self.tab[vt] - if ok { - p.rtt(_OP_recurse, vt) - return - } - +func (self *_Compiler) checkMarshaler(p *_Program, vt reflect.Type) bool { pt := reflect.PtrTo(vt) /* check for `json.Unmarshaler` with pointer receiver */ if pt.Implements(jsonUnmarshalerType) { p.rtt(_OP_unmarshal_p, pt) - return + return true } /* check for `json.Unmarshaler` */ if vt.Implements(jsonUnmarshalerType) { p.add(_OP_lspace) self.compileUnmarshalJson(p, vt) - return + return true } /* check for `encoding.TextMarshaler` with pointer receiver */ if pt.Implements(encodingTextUnmarshalerType) { p.add(_OP_lspace) self.compileUnmarshalTextPtr(p, pt) - return + return true } /* check for `encoding.TextUnmarshaler` */ if vt.Implements(encodingTextUnmarshalerType) { p.add(_OP_lspace) self.compileUnmarshalText(p, vt) + return true + } + return false +} + +func (self *_Compiler) compileOne(p *_Program, sp int, vt reflect.Type) { + /* check for recursive nesting */ + ok := self.tab[vt] + if ok { + p.rtt(_OP_recurse, vt) + return + } + + if self.checkMarshaler(p, vt) { return } @@ -683,17 +690,9 @@ func (self *_Compiler) compilePtr(p *_Program, sp int, et reflect.Type) { /* dereference all the way down */ for et.Kind() == reflect.Ptr { - if et.Implements(jsonUnmarshalerType) { - p.rtt(_OP_unmarshal_p, et) + if self.checkMarshaler(p, et) { return } - - if et.Implements(encodingTextUnmarshalerType) { - p.add(_OP_lspace) - self.compileUnmarshalTextPtr(p, et) - return - } - et = et.Elem() p.rtt(_OP_deref, et) } @@ -706,7 +705,7 @@ func (self *_Compiler) compilePtr(p *_Program, sp int, et reflect.Type) { /* enter the recursion */ p.add(_OP_lspace) self.tab[et] = true - + /* not inline the pointer type * recursing the defined pointer type's elem will casue issue379. */ @@ -716,8 +715,12 @@ func (self *_Compiler) compilePtr(p *_Program, sp int, et reflect.Type) { j := p.pc() p.add(_OP_goto) + + // set val pointer as nil p.pin(i) p.add(_OP_nil_1) + + // nothing todo p.pin(j) } diff --git a/vendor/github.com/bytedance/sonic/internal/decoder/generic_regabi_amd64.go b/vendor/github.com/bytedance/sonic/internal/decoder/generic_regabi_amd64.go index 337af054c..c7514cb41 100644 --- a/vendor/github.com/bytedance/sonic/internal/decoder/generic_regabi_amd64.go +++ b/vendor/github.com/bytedance/sonic/internal/decoder/generic_regabi_amd64.go @@ -1,4 +1,4 @@ -// +build go1.17,!go1.22 +// +build go1.17,!go1.23 /* * Copyright 2021 ByteDance Inc. @@ -119,9 +119,9 @@ func (self *_ValueDecoder) call_go(fn obj.Addr) { } func (self *_ValueDecoder) callc(fn obj.Addr) { - self.Emit("XCHGQ", _IP, _BP) + self.save(_IP) self.call(fn) - self.Emit("XCHGQ", _IP, _BP) + self.load(_IP) } func (self *_ValueDecoder) call_c(fn obj.Addr) { diff --git a/vendor/github.com/bytedance/sonic/internal/decoder/generic_regabi_amd64_test.s b/vendor/github.com/bytedance/sonic/internal/decoder/generic_regabi_amd64_test.s index 1c46928de..b4b0de183 100644 --- a/vendor/github.com/bytedance/sonic/internal/decoder/generic_regabi_amd64_test.s +++ b/vendor/github.com/bytedance/sonic/internal/decoder/generic_regabi_amd64_test.s @@ -1,4 +1,4 @@ -// +build go1.17,!go1.22 +// +build go1.17,!go1.23 // // Copyright 2021 ByteDance Inc. diff --git a/vendor/github.com/bytedance/sonic/internal/decoder/stream.go b/vendor/github.com/bytedance/sonic/internal/decoder/stream.go index a3716435a..7eb8a6951 100644 --- a/vendor/github.com/bytedance/sonic/internal/decoder/stream.go +++ b/vendor/github.com/bytedance/sonic/internal/decoder/stream.go @@ -23,11 +23,12 @@ import ( `github.com/bytedance/sonic/internal/native` `github.com/bytedance/sonic/internal/native/types` + `github.com/bytedance/sonic/internal/rt` `github.com/bytedance/sonic/option` ) var ( - minLeftBufferShift uint = 1 + minLeftBufferShift uint = 1 ) // StreamDecoder is the decoder context object for streaming input. @@ -58,95 +59,71 @@ func NewStreamDecoder(r io.Reader) *StreamDecoder { // Either io error from underlying io.Reader (except io.EOF) // or syntax error from data will be recorded and stop subsequently decoding. func (self *StreamDecoder) Decode(val interface{}) (err error) { - if self.err != nil { - return self.err - } - - var buf = self.buf[self.scanp:] - var p = 0 - var recycle bool - if cap(buf) == 0 { - buf = bufPool.Get().([]byte) - recycle = true - } - - var first = true - var repeat = true - -read_more: - for { - l := len(buf) - realloc(&buf) - n, err := self.r.Read(buf[l:cap(buf)]) - buf = buf[:l+n] - if err != nil { - repeat = false - if err == io.EOF { - if len(buf) == 0 { - return err - } - break - } - self.err = err - return err - } - if n > 0 || first { - break - } - } - first = false - - l := len(buf) - if l > 0 { - self.Decoder.Reset(string(buf)) - - var x int - if ret := native.SkipOneFast(&self.s, &x); ret < 0 { - if repeat { - goto read_more + // read more data into buf + if self.More() { + // println(string(self.buf)) + var s = self.scanp + try_skip: + var e = len(self.buf) + // println("s:", s, "e:", e, "scanned:",self.scanned, "scanp:",self.scanp, self.buf) + var src = rt.Mem2Str(self.buf[s:e]) + // if len(src) > 5 { + // println(src[:5], src[len(src)-5:]) + // } else { + // println(src) + // } + // try skip + var x = 0; + if y := native.SkipOneFast(&src, &x); y < 0 { + if self.readMore() { + // println("more") + goto try_skip } else { - err = SyntaxError{x, self.s, types.ParsingError(-ret), ""} - self.err = err + // println("no more") + err = SyntaxError{e, self.s, types.ParsingError(-s), ""} + self.setErr(err) return } + } else { + s = y + s + e = x + s } - + + // println("decode: ", s, e) + // must copy string here for safety + self.Decoder.Reset(string(self.buf[s:e])) err = self.Decoder.Decode(val) if err != nil { - self.err = err + self.setErr(err) + return } - p = self.Decoder.Pos() - self.scanned += int64(p) - self.scanp = 0 - } - - if l > p { - // remain undecoded bytes, so copy them into self.buf - self.buf = append(self.buf[:0], buf[p:]...) - } else { - self.buf = nil - recycle = true - } + self.scanp = e + _, empty := self.scan() + if empty { + // println("recycle") + // no remain valid bytes, thus we just recycle buffer + mem := self.buf + self.buf = nil + bufPool.Put(mem[:0]) + } else { + // println("keep") + // remain undecoded bytes, move them onto head + n := copy(self.buf, self.buf[self.scanp:]) + self.buf = self.buf[:n] + } - if recycle { - buf = buf[:0] - bufPool.Put(buf) - } - return err -} + self.scanned += int64(self.scanp) + self.scanp = 0 + } -func (self StreamDecoder) repeatable(err error) bool { - if ee, ok := err.(SyntaxError); ok && - (ee.Code == types.ERR_EOF || (ee.Code == types.ERR_INVALID_CHAR && self.i >= len(self.s)-1)) { - return true - } - return false + return self.err } // InputOffset returns the input stream byte offset of the current decoder position. // The offset gives the location of the end of the most recently returned token and the beginning of the next token. func (self *StreamDecoder) InputOffset() int64 { + // println("input offset",self.scanned, self.scanp) return self.scanned + int64(self.scanp) } @@ -166,28 +143,72 @@ func (self *StreamDecoder) More() bool { return err == nil && c != ']' && c != '}' } +// More reports whether there is another element in the +// current array or object being parsed. +func (self *StreamDecoder) readMore() bool { + if self.err != nil { + return false + } + + var err error + var n int + for { + // Grow buffer if not large enough. + l := len(self.buf) + realloc(&self.buf) + + n, err = self.r.Read(self.buf[l:cap(self.buf)]) + self.buf = self.buf[: l+n] + + self.scanp = l + _, empty := self.scan() + if !empty { + return true + } + + // buffer has been scanned, now report any error + if err != nil { + self.setErr(err) + return false + } + } +} + +func (self *StreamDecoder) setErr(err error) { + self.err = err + mem := self.buf[:0] + self.buf = nil + bufPool.Put(mem) +} + func (self *StreamDecoder) peek() (byte, error) { var err error for { - for i := self.scanp; i < len(self.buf); i++ { - c := self.buf[i] - if isSpace(c) { - continue - } - self.scanp = i - return c, nil + c, empty := self.scan() + if !empty { + return byte(c), nil } // buffer has been scanned, now report any error if err != nil { - if err != io.EOF { - self.err = err - } + self.setErr(err) return 0, err } err = self.refill() } } +func (self *StreamDecoder) scan() (byte, bool) { + for i := self.scanp; i < len(self.buf); i++ { + c := self.buf[i] + if isSpace(c) { + continue + } + self.scanp = i + return c, false + } + return 0, true +} + func isSpace(c byte) bool { return types.SPACE_MASK & (1 << c) != 0 } @@ -212,17 +233,25 @@ func (self *StreamDecoder) refill() error { return err } -func realloc(buf *[]byte) { +func realloc(buf *[]byte) bool { l := uint(len(*buf)) c := uint(cap(*buf)) + if c == 0 { + // println("use pool!") + *buf = bufPool.Get().([]byte) + return true + } if c - l <= c >> minLeftBufferShift { + // println("realloc!") e := l+(l>>minLeftBufferShift) - if e < option.DefaultDecoderBufferSize { - e = option.DefaultDecoderBufferSize + if e <= c { + e = c*2 } tmp := make([]byte, l, e) copy(tmp, *buf) *buf = tmp + return true } + return false } diff --git a/vendor/github.com/bytedance/sonic/internal/encoder/asm_stubs_amd64_go121.go b/vendor/github.com/bytedance/sonic/internal/encoder/asm_stubs_amd64_go121.go index 2f9445ac4..9f7ff65e6 100644 --- a/vendor/github.com/bytedance/sonic/internal/encoder/asm_stubs_amd64_go121.go +++ b/vendor/github.com/bytedance/sonic/internal/encoder/asm_stubs_amd64_go121.go @@ -1,4 +1,4 @@ -// +build go1.21,!go1.22 +// +build go1.21,!go1.23 // Copyright 2023 CloudWeGo Authors // diff --git a/vendor/github.com/bytedance/sonic/internal/encoder/assembler_regabi_amd64.go b/vendor/github.com/bytedance/sonic/internal/encoder/assembler_regabi_amd64.go index a89364b14..4584c6d29 100644 --- a/vendor/github.com/bytedance/sonic/internal/encoder/assembler_regabi_amd64.go +++ b/vendor/github.com/bytedance/sonic/internal/encoder/assembler_regabi_amd64.go @@ -1,5 +1,4 @@ -//go:build go1.17 && !go1.22 -// +build go1.17,!go1.22 +// +build go1.17,!go1.23 /* * Copyright 2021 ByteDance Inc. @@ -171,7 +170,7 @@ var ( ) var ( - _REG_ffi = []obj.Addr{ _RP, _RL, _RC} + _REG_ffi = []obj.Addr{ _RP, _RL, _RC, _SP_q} _REG_b64 = []obj.Addr{_SP_p, _SP_q} _REG_all = []obj.Addr{_ST, _SP_x, _SP_f, _SP_p, _SP_q, _RP, _RL, _RC} @@ -510,11 +509,9 @@ func (self *_Assembler) call_b64(pc obj.Addr) { func (self *_Assembler) call_c(pc obj.Addr) { self.Emit("XCHGQ", _SP_p, _BX) - self.Emit("XCHGQ", _SP_q, _BP) self.call(pc) // CALL $pc self.xload(_REG_ffi...) // LOAD $REG_ffi self.Emit("XCHGQ", _SP_p, _BX) - self.Emit("XCHGQ", _SP_q, _BP) } func (self *_Assembler) call_go(pc obj.Addr) { diff --git a/vendor/github.com/bytedance/sonic/internal/encoder/compiler.go b/vendor/github.com/bytedance/sonic/internal/encoder/compiler.go index a949c90f7..ca0be8f40 100644 --- a/vendor/github.com/bytedance/sonic/internal/encoder/compiler.go +++ b/vendor/github.com/bytedance/sonic/internal/encoder/compiler.go @@ -831,7 +831,7 @@ func (self *_Compiler) compileStructFieldZero(p *_Program, vt reflect.Type) { case reflect.Float32 : p.add(_OP_is_zero_4) case reflect.Float64 : p.add(_OP_is_zero_8) case reflect.String : p.add(_OP_is_nil_p1) - case reflect.Interface : p.add(_OP_is_nil_p1) + case reflect.Interface : p.add(_OP_is_nil) case reflect.Map : p.add(_OP_is_zero_map) case reflect.Ptr : p.add(_OP_is_nil) case reflect.Slice : p.add(_OP_is_nil_p1) diff --git a/vendor/github.com/bytedance/sonic/internal/encoder/debug_go117.go b/vendor/github.com/bytedance/sonic/internal/encoder/debug_go117.go index 56a6cbf5e..37e6f7d4f 100644 --- a/vendor/github.com/bytedance/sonic/internal/encoder/debug_go117.go +++ b/vendor/github.com/bytedance/sonic/internal/encoder/debug_go117.go @@ -1,4 +1,4 @@ -// +build go1.17,!go1.22 +// +build go1.17,!go1.23 /* * Copyright 2021 ByteDance Inc. diff --git a/vendor/github.com/bytedance/sonic/internal/encoder/encoder.go b/vendor/github.com/bytedance/sonic/internal/encoder/encoder.go index bd8bae357..0a46455eb 100644 --- a/vendor/github.com/bytedance/sonic/internal/encoder/encoder.go +++ b/vendor/github.com/bytedance/sonic/internal/encoder/encoder.go @@ -41,6 +41,7 @@ const ( bitNoNullSliceOrMap bitValidateString bitNoValidateJSONMarshaler + bitNoEncoderNewline // used for recursive compile bitPointerValue = 63 @@ -76,6 +77,9 @@ const ( // NoValidateJSONMarshaler indicates that the encoder should not validate the output string // after encoding the JSONMarshaler to JSON. NoValidateJSONMarshaler Options = 1 << bitNoValidateJSONMarshaler + + // NoEncoderNewline indicates that the encoder should not add a newline after every message + NoEncoderNewline Options = 1 << bitNoEncoderNewline // CompatibleWithStd is used to be compatible with std encoder. CompatibleWithStd Options = SortMapKeys | EscapeHTML | CompactMarshaler @@ -129,6 +133,16 @@ func (self *Encoder) SetNoValidateJSONMarshaler(f bool) { } } +// SetNoEncoderNewline specifies if option NoEncoderNewline opens +func (self *Encoder) SetNoEncoderNewline(f bool) { + if f { + self.Opts |= NoEncoderNewline + } else { + self.Opts &= ^NoEncoderNewline + } +} + + // SetCompactMarshaler specifies if option CompactMarshaler opens func (self *Encoder) SetCompactMarshaler(f bool) { if f { diff --git a/vendor/github.com/bytedance/sonic/internal/encoder/primitives.go b/vendor/github.com/bytedance/sonic/internal/encoder/primitives.go index 0e47987c7..0f3c40881 100644 --- a/vendor/github.com/bytedance/sonic/internal/encoder/primitives.go +++ b/vendor/github.com/bytedance/sonic/internal/encoder/primitives.go @@ -154,17 +154,17 @@ var ( ) var ( - _F_assertI2I = jit.Func(assertI2I) + _F_assertI2I = jit.Func(rt.AssertI2I2) ) func asText(v unsafe.Pointer) (string, error) { - text := assertI2I(_T_encoding_TextMarshaler, *(*rt.GoIface)(v)) + text := rt.AssertI2I2(_T_encoding_TextMarshaler, *(*rt.GoIface)(v)) r, e := (*(*encoding.TextMarshaler)(unsafe.Pointer(&text))).MarshalText() return rt.Mem2Str(r), e } func asJson(v unsafe.Pointer) (string, error) { - text := assertI2I(_T_json_Marshaler, *(*rt.GoIface)(v)) + text := rt.AssertI2I2(_T_json_Marshaler, *(*rt.GoIface)(v)) r, e := (*(*json.Marshaler)(unsafe.Pointer(&text))).MarshalJSON() return rt.Mem2Str(r), e } diff --git a/vendor/github.com/bytedance/sonic/internal/encoder/stream.go b/vendor/github.com/bytedance/sonic/internal/encoder/stream.go index b6f3ce5fb..d498f68fc 100644 --- a/vendor/github.com/bytedance/sonic/internal/encoder/stream.go +++ b/vendor/github.com/bytedance/sonic/internal/encoder/stream.go @@ -36,7 +36,8 @@ func NewStreamEncoder(w io.Writer) *StreamEncoder { // Encode encodes interface{} as JSON to io.Writer func (enc *StreamEncoder) Encode(val interface{}) (err error) { - out := newBytes() + buf := newBytes() + out := buf /* encode into the buffer */ err = EncodeInto(&out, val, enc.Opts) @@ -54,7 +55,9 @@ func (enc *StreamEncoder) Encode(val interface{}) (err error) { } // according to standard library, terminate each value with a newline... - buf.WriteByte('\n') + if enc.Opts & NoEncoderNewline == 0 { + buf.WriteByte('\n') + } /* copy into io.Writer */ _, err = io.Copy(enc.w, buf) @@ -75,10 +78,12 @@ func (enc *StreamEncoder) Encode(val interface{}) (err error) { } // according to standard library, terminate each value with a newline... - enc.w.Write([]byte{'\n'}) + if enc.Opts & NoEncoderNewline == 0 { + enc.w.Write([]byte{'\n'}) + } } free_bytes: - freeBytes(out) + freeBytes(buf) return err } diff --git a/vendor/github.com/bytedance/sonic/internal/encoder/stubs_go116.go b/vendor/github.com/bytedance/sonic/internal/encoder/stubs_go116.go index 5577c58d7..a21b6b4a6 100644 --- a/vendor/github.com/bytedance/sonic/internal/encoder/stubs_go116.go +++ b/vendor/github.com/bytedance/sonic/internal/encoder/stubs_go116.go @@ -38,10 +38,6 @@ func memmove(to unsafe.Pointer, from unsafe.Pointer, n uintptr) //goland:noinspection GoUnusedParameter func growslice(et *rt.GoType, old rt.GoSlice, cap int) rt.GoSlice -//go:linkname assertI2I runtime.assertI2I -//goland:noinspection GoUnusedParameter -func assertI2I(inter *rt.GoType, i rt.GoIface) rt.GoIface - //go:linkname mapiternext runtime.mapiternext //goland:noinspection GoUnusedParameter func mapiternext(it *rt.GoMapIterator) diff --git a/vendor/github.com/bytedance/sonic/internal/encoder/stubs_go117.go b/vendor/github.com/bytedance/sonic/internal/encoder/stubs_go117.go index 6c8c6ec75..7d934be33 100644 --- a/vendor/github.com/bytedance/sonic/internal/encoder/stubs_go117.go +++ b/vendor/github.com/bytedance/sonic/internal/encoder/stubs_go117.go @@ -38,10 +38,6 @@ func memmove(to unsafe.Pointer, from unsafe.Pointer, n uintptr) //goland:noinspection GoUnusedParameter func growslice(et *rt.GoType, old rt.GoSlice, cap int) rt.GoSlice -//go:linkname assertI2I runtime.assertI2I2 -//goland:noinspection GoUnusedParameter -func assertI2I(inter *rt.GoType, i rt.GoIface) rt.GoIface - //go:linkname mapiternext runtime.mapiternext //goland:noinspection GoUnusedParameter func mapiternext(it *rt.GoMapIterator) diff --git a/vendor/github.com/bytedance/sonic/internal/encoder/stubs_go120.go b/vendor/github.com/bytedance/sonic/internal/encoder/stubs_go120.go index 94a2c0f56..ce3c88e9a 100644 --- a/vendor/github.com/bytedance/sonic/internal/encoder/stubs_go120.go +++ b/vendor/github.com/bytedance/sonic/internal/encoder/stubs_go120.go @@ -38,10 +38,6 @@ func memmove(to unsafe.Pointer, from unsafe.Pointer, n uintptr) //goland:noinspection GoUnusedParameter func growslice(et *rt.GoType, old rt.GoSlice, cap int) rt.GoSlice -//go:linkname assertI2I runtime.assertI2I2 -//goland:noinspection GoUnusedParameter -func assertI2I(inter *rt.GoType, i rt.GoIface) rt.GoIface - //go:linkname mapiternext runtime.mapiternext //goland:noinspection GoUnusedParameter func mapiternext(it *rt.GoMapIterator) diff --git a/vendor/github.com/bytedance/sonic/internal/encoder/stubs_go121.go b/vendor/github.com/bytedance/sonic/internal/encoder/stubs_go121.go index e194fbbf3..700ddf8b5 100644 --- a/vendor/github.com/bytedance/sonic/internal/encoder/stubs_go121.go +++ b/vendor/github.com/bytedance/sonic/internal/encoder/stubs_go121.go @@ -38,10 +38,6 @@ func memmove(to unsafe.Pointer, from unsafe.Pointer, n uintptr) //goland:noinspection GoUnusedParameter func growslice(et *rt.GoType, old rt.GoSlice, cap int) rt.GoSlice -//go:linkname assertI2I runtime.assertI2I2 -//goland:noinspection GoUnusedParameter -func assertI2I(inter *rt.GoType, i rt.GoIface) rt.GoIface - //go:linkname mapiternext runtime.mapiternext //goland:noinspection GoUnusedParameter func mapiternext(it *rt.GoMapIterator) diff --git a/vendor/github.com/bytedance/sonic/internal/jit/assembler_amd64.go b/vendor/github.com/bytedance/sonic/internal/jit/assembler_amd64.go index d7d1751e5..00e6009db 100644 --- a/vendor/github.com/bytedance/sonic/internal/jit/assembler_amd64.go +++ b/vendor/github.com/bytedance/sonic/internal/jit/assembler_amd64.go @@ -72,18 +72,6 @@ func (self *BaseAssembler) NOPn(n int) { } } -func (self *BaseAssembler) StorePtr(ptr int64, to obj.Addr, tmp obj.Addr) { - if (to.Type != obj.TYPE_MEM) || (tmp.Type != obj.TYPE_REG) { - panic("must store imm to memory, tmp must be register") - } - if (ptr >> 32) != 0 { - self.Emit("MOVQ", Imm(ptr), tmp) - self.Emit("MOVQ", tmp, to) - } else { - self.Emit("MOVQ", Imm(ptr), to); - } -} - func (self *BaseAssembler) Byte(v ...byte) { for ; len(v) >= 8; v = v[8:] { self.From("QUAD", Imm(rt.Get64(v))) } for ; len(v) >= 4; v = v[4:] { self.From("LONG", Imm(int64(rt.Get32(v)))) } diff --git a/vendor/github.com/bytedance/sonic/internal/jit/runtime.go b/vendor/github.com/bytedance/sonic/internal/jit/runtime.go index ec69d067a..e4bc829da 100644 --- a/vendor/github.com/bytedance/sonic/internal/jit/runtime.go +++ b/vendor/github.com/bytedance/sonic/internal/jit/runtime.go @@ -24,11 +24,6 @@ import ( `github.com/twitchyliquid64/golang-asm/obj` ) -//go:noescape -//go:linkname getitab runtime.getitab -//goland:noinspection ALL -func getitab(inter *rt.GoType, typ *rt.GoType, canfail bool) *rt.GoItab - func Func(f interface{}) obj.Addr { if p := rt.UnpackEface(f); p.Type.Kind() != reflect.Func { panic("f is not a function") @@ -42,7 +37,7 @@ func Type(t reflect.Type) obj.Addr { } func Itab(i *rt.GoType, t reflect.Type) obj.Addr { - return Imm(int64(uintptr(unsafe.Pointer(getitab(i, rt.UnpackType(t), false))))) + return Imm(int64(uintptr(unsafe.Pointer(rt.Getitab(rt.IfaceType(i), rt.UnpackType(t), false))))) } func Gitab(i *rt.GoItab) obj.Addr { diff --git a/vendor/github.com/bytedance/sonic/internal/rt/asm_amd64.s b/vendor/github.com/bytedance/sonic/internal/rt/asm_amd64.s index 8250e38d3..4998d5f79 100644 --- a/vendor/github.com/bytedance/sonic/internal/rt/asm_amd64.s +++ b/vendor/github.com/bytedance/sonic/internal/rt/asm_amd64.s @@ -1,5 +1,4 @@ -// +build !noasm !appengine -// Code generated by asm2asm, DO NOT EDIT· +// +build !noasm,amd64 !appengine,amd64 #include "go_asm.h" #include "funcdata.h" diff --git a/vendor/github.com/bytedance/sonic/internal/rt/asm_arm64.s b/vendor/github.com/bytedance/sonic/internal/rt/asm_arm64.s deleted file mode 100644 index a168a8266..000000000 --- a/vendor/github.com/bytedance/sonic/internal/rt/asm_arm64.s +++ /dev/null @@ -1,10 +0,0 @@ -// +build !noasm !appengine -// Code generated by asm2asm, DO NOT EDIT. - -#include "go_asm.h" -#include "funcdata.h" -#include "textflag.h" - -TEXT ·MoreStack(SB), NOSPLIT, $0 - 8 - NO_LOCAL_POINTERS - RET diff --git a/vendor/github.com/bytedance/sonic/internal/rt/asm_compat.s b/vendor/github.com/bytedance/sonic/internal/rt/asm_compat.s new file mode 100644 index 000000000..7d50b6483 --- /dev/null +++ b/vendor/github.com/bytedance/sonic/internal/rt/asm_compat.s @@ -0,0 +1,9 @@ +// +build !noasm,!amd64 !appengine,!amd64 + +#include "go_asm.h" +#include "funcdata.h" +#include "textflag.h" + +TEXT ·MoreStack(SB), NOSPLIT, $0 - 8 + NO_LOCAL_POINTERS + RET diff --git a/vendor/github.com/bytedance/sonic/internal/rt/fastmem.go b/vendor/github.com/bytedance/sonic/internal/rt/fastmem.go index e3bf0db91..a68d98aff 100644 --- a/vendor/github.com/bytedance/sonic/internal/rt/fastmem.go +++ b/vendor/github.com/bytedance/sonic/internal/rt/fastmem.go @@ -66,15 +66,16 @@ func FuncAddr(f interface{}) unsafe.Pointer { } } +//go:nocheckptr func IndexChar(src string, index int) unsafe.Pointer { return unsafe.Pointer(uintptr((*GoString)(unsafe.Pointer(&src)).Ptr) + uintptr(index)) } +//go:nocheckptr func IndexByte(ptr []byte, index int) unsafe.Pointer { return unsafe.Pointer(uintptr((*GoSlice)(unsafe.Pointer(&ptr)).Ptr) + uintptr(index)) } -//go:nosplit func GuardSlice(buf *[]byte, n int) { c := cap(*buf) l := len(*buf) diff --git a/vendor/github.com/bytedance/sonic/internal/rt/fastvalue.go b/vendor/github.com/bytedance/sonic/internal/rt/fastvalue.go index 2b2757f5b..befaeb715 100644 --- a/vendor/github.com/bytedance/sonic/internal/rt/fastvalue.go +++ b/vendor/github.com/bytedance/sonic/internal/rt/fastvalue.go @@ -211,3 +211,24 @@ func findReflectRtypeItab() *GoItab { v := reflect.TypeOf(struct{}{}) return (*GoIface)(unsafe.Pointer(&v)).Itab } + +func AssertI2I2(t *GoType, i GoIface) (r GoIface) { + inter := IfaceType(t) + tab := i.Itab + if tab == nil { + return + } + if (*GoInterfaceType)(tab.it) != inter { + tab = Getitab(inter, tab.Vt, true) + if tab == nil { + return + } + } + r.Itab = tab + r.Value = i.Value + return +} + +//go:noescape +//go:linkname Getitab runtime.getitab +func Getitab(inter *GoInterfaceType, typ *GoType, canfail bool) *GoItab diff --git a/vendor/github.com/bytedance/sonic/internal/rt/int48.go b/vendor/github.com/bytedance/sonic/internal/rt/int48.go index e9f82d731..a0eb64ad7 100644 --- a/vendor/github.com/bytedance/sonic/internal/rt/int48.go +++ b/vendor/github.com/bytedance/sonic/internal/rt/int48.go @@ -17,12 +17,12 @@ package rt const ( - MinInt48 = -(1 << 47) - MaxInt48 = +(1 << 47) - 1 + MinInt48 int64 = -(1 << 47) + MaxInt48 int64 = +(1 << 47) - 1 ) func PackInt(v int) uint64 { - if u := uint64(v); v < MinInt48 || v > MaxInt48 { + if u := uint64(v); int64(v) < MinInt48 || int64(v) > MaxInt48 { panic("int48 out of range") } else { return ((u >> 63) << 47) | (u & 0x00007fffffffffff) diff --git a/vendor/github.com/bytedance/sonic/loader/funcdata_go121.go b/vendor/github.com/bytedance/sonic/loader/funcdata_go121.go index f50663e2a..ebeaca5a7 100644 --- a/vendor/github.com/bytedance/sonic/loader/funcdata_go121.go +++ b/vendor/github.com/bytedance/sonic/loader/funcdata_go121.go @@ -1,5 +1,5 @@ -//go:build go1.21 && !go1.22 -// +build go1.21,!go1.22 +//go:build go1.21 && !go1.23 +// +build go1.21,!go1.23 /* * Copyright 2021 ByteDance Inc. diff --git a/vendor/github.com/bytedance/sonic/loader/funcdata_latest.go b/vendor/github.com/bytedance/sonic/loader/funcdata_latest.go index 52c6097fb..08618dca4 100644 --- a/vendor/github.com/bytedance/sonic/loader/funcdata_latest.go +++ b/vendor/github.com/bytedance/sonic/loader/funcdata_latest.go @@ -1,5 +1,5 @@ -// go:build go1.18 && !go1.22 -// +build go1.18,!go1.22 +// go:build go1.18 && !go1.23 +// +build go1.18,!go1.23 /* * Copyright 2021 ByteDance Inc. diff --git a/vendor/github.com/bytedance/sonic/loader/loader_latest.go b/vendor/github.com/bytedance/sonic/loader/loader_latest.go index b6e3e75f8..3664c04ba 100644 --- a/vendor/github.com/bytedance/sonic/loader/loader_latest.go +++ b/vendor/github.com/bytedance/sonic/loader/loader_latest.go @@ -1,5 +1,4 @@ -//go:build go1.16 && !go1.22 -// +build go1.16,!go1.22 +// +build go1.16,!go1.23 /* * Copyright 2021 ByteDance Inc. diff --git a/vendor/github.com/bytedance/sonic/loader/mmap_unix.go b/vendor/github.com/bytedance/sonic/loader/mmap_unix.go index 3ea944ed6..26bdb6584 100644 --- a/vendor/github.com/bytedance/sonic/loader/mmap_unix.go +++ b/vendor/github.com/bytedance/sonic/loader/mmap_unix.go @@ -1,5 +1,5 @@ -//go:build darwin || linux -// +build darwin linux +//go:build !windows +// +build !windows /** * Copyright 2023 ByteDance Inc. diff --git a/vendor/github.com/bytedance/sonic/loader/stubs.go b/vendor/github.com/bytedance/sonic/loader/stubs.go index 8377649b7..80f8de836 100644 --- a/vendor/github.com/bytedance/sonic/loader/stubs.go +++ b/vendor/github.com/bytedance/sonic/loader/stubs.go @@ -17,7 +17,8 @@ package loader import ( - `sync` + "sync/atomic" + "unsafe" _ `unsafe` ) @@ -25,16 +26,35 @@ import ( //goland:noinspection GoUnusedGlobalVariable var lastmoduledatap *moduledata -var moduledataMux sync.Mutex - func registerModule(mod *moduledata) { - moduledataMux.Lock() - lastmoduledatap.next = mod - lastmoduledatap = mod - moduledataMux.Unlock() + registerModuleLockFree(&lastmoduledatap, mod) } //go:linkname moduledataverify1 runtime.moduledataverify1 func moduledataverify1(_ *moduledata) +func registerModuleLockFree(tail **moduledata, mod *moduledata) { + for { + oldTail := loadModule(tail) + if casModule(tail, oldTail, mod) { + storeModule(&oldTail.next, mod) + break + } + } +} + +func loadModule(p **moduledata) *moduledata { + return (*moduledata)(atomic.LoadPointer((*unsafe.Pointer)(unsafe.Pointer(p)))) +} +func storeModule(p **moduledata, value *moduledata) { + atomic.StorePointer((*unsafe.Pointer)(unsafe.Pointer(p)), unsafe.Pointer(value)) +} + +func casModule(p **moduledata, oldValue *moduledata, newValue *moduledata) bool { + return atomic.CompareAndSwapPointer( + (*unsafe.Pointer)(unsafe.Pointer(p)), + unsafe.Pointer(oldValue), + unsafe.Pointer(newValue), + ) +} diff --git a/vendor/github.com/bytedance/sonic/sonic.go b/vendor/github.com/bytedance/sonic/sonic.go index 1da238895..145527fc0 100644 --- a/vendor/github.com/bytedance/sonic/sonic.go +++ b/vendor/github.com/bytedance/sonic/sonic.go @@ -1,4 +1,4 @@ -// +build amd64,go1.16,!go1.22 +// +build amd64,go1.16,!go1.23 /* * Copyright 2021 ByteDance Inc. @@ -61,6 +61,9 @@ func (cfg Config) Froze() API { if cfg.NoValidateJSONMarshaler { api.encoderOpts |= encoder.NoValidateJSONMarshaler } + if cfg.NoEncoderNewline { + api.encoderOpts |= encoder.NoEncoderNewline + } // configure decoder options: if cfg.UseInt64 { diff --git a/vendor/github.com/chenzhuoyu/iasm/x86_64/operands.go b/vendor/github.com/chenzhuoyu/iasm/x86_64/operands.go index 966090225..8c4bc9f65 100644 --- a/vendor/github.com/chenzhuoyu/iasm/x86_64/operands.go +++ b/vendor/github.com/chenzhuoyu/iasm/x86_64/operands.go @@ -1,13 +1,13 @@ package x86_64 import ( - `errors` - `fmt` - `math` - `reflect` - `strconv` - `strings` - `sync/atomic` + "errors" + "fmt" + "math" + "reflect" + "strconv" + "strings" + "sync/atomic" ) // RelativeOffset represents an RIP-relative offset. @@ -15,496 +15,635 @@ type RelativeOffset int32 // String implements the fmt.Stringer interface. func (self RelativeOffset) String() string { - if self == 0 { - return "(%rip)" - } else { - return fmt.Sprintf("%d(%%rip)", self) - } + if self == 0 { + return "(%rip)" + } else { + return fmt.Sprintf("%d(%%rip)", self) + } } // RoundingControl represents a floating-point rounding option. type RoundingControl uint8 const ( - // RN_SAE represents "Round Nearest", which is the default rounding option. - RN_SAE RoundingControl = iota + // RN_SAE represents "Round Nearest", which is the default rounding option. + RN_SAE RoundingControl = iota - // RD_SAE represents "Round Down". - RD_SAE + // RD_SAE represents "Round Down". + RD_SAE - // RU_SAE represents "Round Up". - RU_SAE + // RU_SAE represents "Round Up". + RU_SAE - // RZ_SAE represents "Round towards Zero". - RZ_SAE + // RZ_SAE represents "Round towards Zero". + RZ_SAE ) -var _RC_NAMES = map[RoundingControl]string { - RN_SAE: "rn-sae", - RD_SAE: "rd-sae", - RU_SAE: "ru-sae", - RZ_SAE: "rz-sae", +var _RC_NAMES = map[RoundingControl]string{ + RN_SAE: "rn-sae", + RD_SAE: "rd-sae", + RU_SAE: "ru-sae", + RZ_SAE: "rz-sae", } func (self RoundingControl) String() string { - if v, ok := _RC_NAMES[self]; ok { - return v - } else { - panic("invalid RoundingControl value") - } + if v, ok := _RC_NAMES[self]; ok { + return v + } else { + panic("invalid RoundingControl value") + } } // ExceptionControl represents the "Suppress All Exceptions" flag. type ExceptionControl uint8 const ( - // SAE represents the flag "Suppress All Exceptions" for floating point operations. - SAE ExceptionControl = iota + // SAE represents the flag "Suppress All Exceptions" for floating point operations. + SAE ExceptionControl = iota ) func (ExceptionControl) String() string { - return "sae" + return "sae" } // AddressType indicates which kind of value that an Addressable object contains. type AddressType uint const ( - // None indicates the Addressable does not contain any addressable value. - None AddressType = iota + // None indicates the Addressable does not contain any addressable value. + None AddressType = iota - // Memory indicates the Addressable contains a memory address. - Memory + // Memory indicates the Addressable contains a memory address. + Memory - // Offset indicates the Addressable contains an RIP-relative offset. - Offset + // Offset indicates the Addressable contains an RIP-relative offset. + Offset - // Reference indicates the Addressable contains a label reference. - Reference + // Reference indicates the Addressable contains a label reference. + Reference ) // Disposable is a type of object that can be Free'd manually. type Disposable interface { - Free() + Free() } // Label represents a location within the program. type Label struct { - refs int64 - Name string - Dest *Instruction + refs int64 + Name string + Dest *Instruction } func (self *Label) offset(p uintptr, n int) RelativeOffset { - if self.Dest == nil { - panic("unresolved label: " + self.Name) - } else { - return RelativeOffset(self.Dest.pc - p - uintptr(n)) - } + if self.Dest == nil { + panic("unresolved label: " + self.Name) + } else { + return RelativeOffset(self.Dest.pc - p - uintptr(n)) + } } // Free decreases the reference count of a Label, if the // refcount drops to 0, the Label will be recycled. func (self *Label) Free() { - if atomic.AddInt64(&self.refs, -1) == 0 { - freeLabel(self) - } + if atomic.AddInt64(&self.refs, -1) == 0 { + //freeLabel(self) + } } // String implements the fmt.Stringer interface. func (self *Label) String() string { - if self.Dest == nil { - return fmt.Sprintf("%s(%%rip)", self.Name) - } else { - return fmt.Sprintf("%s(%%rip)@%#x", self.Name, self.Dest.pc) - } + if self.Dest == nil { + return fmt.Sprintf("%s(%%rip)", self.Name) + } else { + return fmt.Sprintf("%s(%%rip)@%#x", self.Name, self.Dest.pc) + } } // Retain increases the reference count of a Label. func (self *Label) Retain() *Label { - atomic.AddInt64(&self.refs, 1) - return self + atomic.AddInt64(&self.refs, 1) + return self } // Evaluate implements the interface expr.Term. func (self *Label) Evaluate() (int64, error) { - if self.Dest != nil { - return int64(self.Dest.pc), nil - } else { - return 0, errors.New("unresolved label: " + self.Name) - } + if self.Dest != nil { + return int64(self.Dest.pc), nil + } else { + return 0, errors.New("unresolved label: " + self.Name) + } } // Addressable is a union to represent an addressable operand. type Addressable struct { - Type AddressType - Memory MemoryAddress - Offset RelativeOffset - Reference *Label + Type AddressType + Memory MemoryAddress + Offset RelativeOffset + Reference *Label } // String implements the fmt.Stringer interface. func (self *Addressable) String() string { - switch self.Type { - case None : return "(not addressable)" - case Memory : return self.Memory.String() - case Offset : return self.Offset.String() - case Reference : return self.Reference.String() - default : return "(invalid addressable)" - } + switch self.Type { + case None: + return "(not addressable)" + case Memory: + return self.Memory.String() + case Offset: + return self.Offset.String() + case Reference: + return self.Reference.String() + default: + return "(invalid addressable)" + } } // MemoryOperand represents a memory operand for an instruction. type MemoryOperand struct { - refs int64 - Size int - Addr Addressable - Mask RegisterMask - Masked bool - Broadcast uint8 + refs int64 + Size int + Addr Addressable + Mask RegisterMask + Masked bool + Broadcast uint8 } const ( - _Sizes = 0b10000000100010111 // bit-mask for valid sizes (0, 1, 2, 4, 8, 16) + _Sizes = 0b10000000100010111 // bit-mask for valid sizes (0, 1, 2, 4, 8, 16) ) func (self *MemoryOperand) isVMX(evex bool) bool { - return self.Addr.Type == Memory && self.Addr.Memory.isVMX(evex) + return self.Addr.Type == Memory && self.Addr.Memory.isVMX(evex) } func (self *MemoryOperand) isVMY(evex bool) bool { - return self.Addr.Type == Memory && self.Addr.Memory.isVMY(evex) + return self.Addr.Type == Memory && self.Addr.Memory.isVMY(evex) } func (self *MemoryOperand) isVMZ() bool { - return self.Addr.Type == Memory && self.Addr.Memory.isVMZ() + return self.Addr.Type == Memory && self.Addr.Memory.isVMZ() } func (self *MemoryOperand) isMem() bool { - if (_Sizes & (1 << self.Broadcast)) == 0 { - return false - } else if self.Addr.Type == Memory { - return self.Addr.Memory.isMem() - } else if self.Addr.Type == Offset { - return true - } else if self.Addr.Type == Reference { - return true - } else { - return false - } + if (_Sizes & (1 << self.Broadcast)) == 0 { + return false + } else if self.Addr.Type == Memory { + return self.Addr.Memory.isMem() + } else if self.Addr.Type == Offset { + return true + } else if self.Addr.Type == Reference { + return true + } else { + return false + } } func (self *MemoryOperand) isSize(n int) bool { - return self.Size == 0 || self.Size == n + return self.Size == 0 || self.Size == n } func (self *MemoryOperand) isBroadcast(n int, b uint8) bool { - return self.Size == n && self.Broadcast == b + return self.Size == n && self.Broadcast == b } func (self *MemoryOperand) formatMask() string { - if !self.Masked { - return "" - } else { - return self.Mask.String() - } + if !self.Masked { + return "" + } else { + return self.Mask.String() + } } func (self *MemoryOperand) formatBroadcast() string { - if self.Broadcast == 0 { - return "" - } else { - return fmt.Sprintf("{1to%d}", self.Broadcast) - } + if self.Broadcast == 0 { + return "" + } else { + return fmt.Sprintf("{1to%d}", self.Broadcast) + } } func (self *MemoryOperand) ensureAddrValid() { - switch self.Addr.Type { - case None : break - case Memory : self.Addr.Memory.EnsureValid() - case Offset : break - case Reference : break - default : panic("invalid address type") - } + switch self.Addr.Type { + case None: + break + case Memory: + self.Addr.Memory.EnsureValid() + case Offset: + break + case Reference: + break + default: + panic("invalid address type") + } } func (self *MemoryOperand) ensureSizeValid() { - if (_Sizes & (1 << self.Size)) == 0 { - panic("invalid memory operand size") - } + if (_Sizes & (1 << self.Size)) == 0 { + panic("invalid memory operand size") + } } func (self *MemoryOperand) ensureBroadcastValid() { - if (_Sizes & (1 << self.Broadcast)) == 0 { - panic("invalid memory operand broadcast") - } + if (_Sizes & (1 << self.Broadcast)) == 0 { + panic("invalid memory operand broadcast") + } } // Free decreases the reference count of a MemoryOperand, if the // refcount drops to 0, the Label will be recycled. func (self *MemoryOperand) Free() { - if atomic.AddInt64(&self.refs, -1) == 0 { - freeMemoryOperand(self) - } + if atomic.AddInt64(&self.refs, -1) == 0 { + //freeMemoryOperand(self) + } } // String implements the fmt.Stringer interface. func (self *MemoryOperand) String() string { - return self.Addr.String() + self.formatMask() + self.formatBroadcast() + return self.Addr.String() + self.formatMask() + self.formatBroadcast() } // Retain increases the reference count of a MemoryOperand. func (self *MemoryOperand) Retain() *MemoryOperand { - atomic.AddInt64(&self.refs, 1) - return self + atomic.AddInt64(&self.refs, 1) + return self } // EnsureValid checks if the memory operand is valid, if not, it panics. func (self *MemoryOperand) EnsureValid() { - self.ensureAddrValid() - self.ensureSizeValid() - self.ensureBroadcastValid() + self.ensureAddrValid() + self.ensureSizeValid() + self.ensureBroadcastValid() } // MemoryAddress represents a memory address. type MemoryAddress struct { - Base Register - Index Register - Scale uint8 - Displacement int32 + Base Register + Index Register + Scale uint8 + Displacement int32 } const ( - _Scales = 0b100010111 // bit-mask for valid scales (0, 1, 2, 4, 8) + _Scales = 0b100010111 // bit-mask for valid scales (0, 1, 2, 4, 8) ) func (self *MemoryAddress) isVMX(evex bool) bool { - return self.isMemBase() && (self.Index == nil || isXMM(self.Index) || (evex && isEVEXXMM(self.Index))) + return self.isMemBase() && (self.Index == nil || isXMM(self.Index) || (evex && isEVEXXMM(self.Index))) } func (self *MemoryAddress) isVMY(evex bool) bool { - return self.isMemBase() && (self.Index == nil || isYMM(self.Index) || (evex && isEVEXYMM(self.Index))) + return self.isMemBase() && (self.Index == nil || isYMM(self.Index) || (evex && isEVEXYMM(self.Index))) } func (self *MemoryAddress) isVMZ() bool { - return self.isMemBase() && (self.Index == nil || isZMM(self.Index)) + return self.isMemBase() && (self.Index == nil || isZMM(self.Index)) } func (self *MemoryAddress) isMem() bool { - return self.isMemBase() && (self.Index == nil || isReg64(self.Index)) + return self.isMemBase() && (self.Index == nil || isReg64(self.Index)) } func (self *MemoryAddress) isMemBase() bool { - return (self.Base == nil || isReg64(self.Base)) && // `Base` must be 64-bit if present - (self.Scale == 0) == (self.Index == nil) && // `Scale` and `Index` depends on each other - (_Scales & (1 << self.Scale)) != 0 // `Scale` can only be 0, 1, 2, 4 or 8 + return (self.Base == nil || isReg64(self.Base)) && // `Base` must be 64-bit if present + (self.Scale == 0) == (self.Index == nil) && // `Scale` and `Index` depends on each other + (_Scales&(1<= 2 { - sb.WriteByte(',') - sb.WriteString(strconv.Itoa(int(self.Scale))) - } - } + /* scale is also optional */ + if self.Scale >= 2 { + sb.WriteByte(',') + sb.WriteString(strconv.Itoa(int(self.Scale))) + } + } - /* close the bracket */ - sb.WriteByte(')') - return sb.String() + /* close the bracket */ + sb.WriteByte(')') + return sb.String() } // EnsureValid checks if the memory address is valid, if not, it panics. func (self *MemoryAddress) EnsureValid() { - if !self.isMemBase() || (self.Index != nil && !isIndexable(self.Index)) { - panic("not a valid memory address") - } + if !self.isMemBase() || (self.Index != nil && !isIndexable(self.Index)) { + panic("not a valid memory address") + } } // Ref constructs a memory reference to a label. func Ref(ref *Label) (v *MemoryOperand) { - v = CreateMemoryOperand() - v.Addr.Type = Reference - v.Addr.Reference = ref - return + v = CreateMemoryOperand() + v.Addr.Type = Reference + v.Addr.Reference = ref + return } // Abs construct a simple memory address that represents absolute addressing. func Abs(disp int32) *MemoryOperand { - return Sib(nil, nil, 0, disp) + return Sib(nil, nil, 0, disp) } // Ptr constructs a simple memory operand with base and displacement. func Ptr(base Register, disp int32) *MemoryOperand { - return Sib(base, nil, 0, disp) + return Sib(base, nil, 0, disp) } // Sib constructs a simple memory operand that represents a complete memory address. func Sib(base Register, index Register, scale uint8, disp int32) (v *MemoryOperand) { - v = CreateMemoryOperand() - v.Addr.Type = Memory - v.Addr.Memory.Base = base - v.Addr.Memory.Index = index - v.Addr.Memory.Scale = scale - v.Addr.Memory.Displacement = disp - v.EnsureValid() - return + v = CreateMemoryOperand() + v.Addr.Type = Memory + v.Addr.Memory.Base = base + v.Addr.Memory.Index = index + v.Addr.Memory.Scale = scale + v.Addr.Memory.Displacement = disp + v.EnsureValid() + return } /** Operand Matching Helpers **/ -const _IntMask = - (1 << reflect.Int ) | - (1 << reflect.Int8 ) | - (1 << reflect.Int16 ) | - (1 << reflect.Int32 ) | - (1 << reflect.Int64 ) | - (1 << reflect.Uint ) | - (1 << reflect.Uint8 ) | - (1 << reflect.Uint16 ) | - (1 << reflect.Uint32 ) | - (1 << reflect.Uint64 ) | - (1 << reflect.Uintptr) +const _IntMask = (1 << reflect.Int) | + (1 << reflect.Int8) | + (1 << reflect.Int16) | + (1 << reflect.Int32) | + (1 << reflect.Int64) | + (1 << reflect.Uint) | + (1 << reflect.Uint8) | + (1 << reflect.Uint16) | + (1 << reflect.Uint32) | + (1 << reflect.Uint64) | + (1 << reflect.Uintptr) func isInt(k reflect.Kind) bool { - return (_IntMask & (1 << k)) != 0 + return (_IntMask & (1 << k)) != 0 } func asInt64(v interface{}) (int64, bool) { - if isSpecial(v) { - return 0, false - } else if x := efaceOf(v); isInt(x.kind()) { - return x.toInt64(), true - } else { - return 0, false - } + if isSpecial(v) { + return 0, false + } else if x := efaceOf(v); isInt(x.kind()) { + return x.toInt64(), true + } else { + return 0, false + } } func inRange(v interface{}, low int64, high int64) bool { - x, ok := asInt64(v) - return ok && x >= low && x <= high + x, ok := asInt64(v) + return ok && x >= low && x <= high } func isSpecial(v interface{}) bool { - switch v.(type) { - case Register8 : return true - case Register16 : return true - case Register32 : return true - case Register64 : return true - case KRegister : return true - case MMRegister : return true - case XMMRegister : return true - case YMMRegister : return true - case ZMMRegister : return true - case RelativeOffset : return true - case RoundingControl : return true - case ExceptionControl : return true - default : return false - } + switch v.(type) { + case Register8: + return true + case Register16: + return true + case Register32: + return true + case Register64: + return true + case KRegister: + return true + case MMRegister: + return true + case XMMRegister: + return true + case YMMRegister: + return true + case ZMMRegister: + return true + case RelativeOffset: + return true + case RoundingControl: + return true + case ExceptionControl: + return true + default: + return false + } } func isIndexable(v interface{}) bool { - return isZMM(v) || isReg64(v) || isEVEXXMM(v) || isEVEXYMM(v) -} - -func isImm4 (v interface{}) bool { return inRange(v, 0, 15) } -func isImm8 (v interface{}) bool { return inRange(v, math.MinInt8, math.MaxUint8) } -func isImm16 (v interface{}) bool { return inRange(v, math.MinInt16, math.MaxUint16) } -func isImm32 (v interface{}) bool { return inRange(v, math.MinInt32, math.MaxUint32) } -func isImm64 (v interface{}) bool { _, r := asInt64(v) ; return r } -func isConst1 (v interface{}) bool { x, r := asInt64(v) ; return r && x == 1 } -func isConst3 (v interface{}) bool { x, r := asInt64(v) ; return r && x == 3 } -func isRel8 (v interface{}) bool { x, r := v.(RelativeOffset) ; return r && x >= math.MinInt8 && x <= math.MaxInt8 } -func isRel32 (v interface{}) bool { _, r := v.(RelativeOffset) ; return r } -func isLabel (v interface{}) bool { _, r := v.(*Label) ; return r } -func isReg8 (v interface{}) bool { _, r := v.(Register8) ; return r } -func isReg8REX (v interface{}) bool { x, r := v.(Register8) ; return r && (x & 0x80) == 0 && x >= SPL } -func isReg16 (v interface{}) bool { _, r := v.(Register16) ; return r } -func isReg32 (v interface{}) bool { _, r := v.(Register32) ; return r } -func isReg64 (v interface{}) bool { _, r := v.(Register64) ; return r } -func isMM (v interface{}) bool { _, r := v.(MMRegister) ; return r } -func isXMM (v interface{}) bool { x, r := v.(XMMRegister) ; return r && x <= XMM15 } -func isEVEXXMM (v interface{}) bool { _, r := v.(XMMRegister) ; return r } -func isXMMk (v interface{}) bool { x, r := v.(MaskedRegister) ; return isXMM(v) || (r && isXMM(x.Reg) && !x.Mask.Z) } -func isXMMkz (v interface{}) bool { x, r := v.(MaskedRegister) ; return isXMM(v) || (r && isXMM(x.Reg)) } -func isYMM (v interface{}) bool { x, r := v.(YMMRegister) ; return r && x <= YMM15 } -func isEVEXYMM (v interface{}) bool { _, r := v.(YMMRegister) ; return r } -func isYMMk (v interface{}) bool { x, r := v.(MaskedRegister) ; return isYMM(v) || (r && isYMM(x.Reg) && !x.Mask.Z) } -func isYMMkz (v interface{}) bool { x, r := v.(MaskedRegister) ; return isYMM(v) || (r && isYMM(x.Reg)) } -func isZMM (v interface{}) bool { _, r := v.(ZMMRegister) ; return r } -func isZMMk (v interface{}) bool { x, r := v.(MaskedRegister) ; return isZMM(v) || (r && isZMM(x.Reg) && !x.Mask.Z) } -func isZMMkz (v interface{}) bool { x, r := v.(MaskedRegister) ; return isZMM(v) || (r && isZMM(x.Reg)) } -func isK (v interface{}) bool { _, r := v.(KRegister) ; return r } -func isKk (v interface{}) bool { x, r := v.(MaskedRegister) ; return isK(v) || (r && isK(x.Reg) && !x.Mask.Z) } -func isM (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && x.isMem() && x.Broadcast == 0 && !x.Masked } -func isMk (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && x.isMem() && x.Broadcast == 0 && !(x.Masked && x.Mask.Z) } -func isMkz (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && x.isMem() && x.Broadcast == 0 } -func isM8 (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && isM(v) && x.isSize(1) } -func isM16 (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && isM(v) && x.isSize(2) } -func isM16kz (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && isMkz(v) && x.isSize(2) } -func isM32 (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && isM(v) && x.isSize(4) } -func isM32k (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && isMk(v) && x.isSize(4) } -func isM32kz (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && isMkz(v) && x.isSize(4) } -func isM64 (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && isM(v) && x.isSize(8) } -func isM64k (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && isMk(v) && x.isSize(8) } -func isM64kz (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && isMkz(v) && x.isSize(8) } -func isM128 (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && isM(v) && x.isSize(16) } -func isM128kz (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && isMkz(v) && x.isSize(16) } -func isM256 (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && isM(v) && x.isSize(32) } -func isM256kz (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && isMkz(v) && x.isSize(32) } -func isM512 (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && isM(v) && x.isSize(64) } -func isM512kz (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && isMkz(v) && x.isSize(64) } -func isM64M32bcst (v interface{}) bool { x, r := v.(*MemoryOperand) ; return isM64(v) || (r && x.isBroadcast(4, 2)) } -func isM128M32bcst (v interface{}) bool { x, r := v.(*MemoryOperand) ; return isM128(v) || (r && x.isBroadcast(4, 4)) } -func isM256M32bcst (v interface{}) bool { x, r := v.(*MemoryOperand) ; return isM256(v) || (r && x.isBroadcast(4, 8)) } -func isM512M32bcst (v interface{}) bool { x, r := v.(*MemoryOperand) ; return isM512(v) || (r && x.isBroadcast(4, 16)) } -func isM128M64bcst (v interface{}) bool { x, r := v.(*MemoryOperand) ; return isM128(v) || (r && x.isBroadcast(8, 2)) } -func isM256M64bcst (v interface{}) bool { x, r := v.(*MemoryOperand) ; return isM256(v) || (r && x.isBroadcast(8, 4)) } -func isM512M64bcst (v interface{}) bool { x, r := v.(*MemoryOperand) ; return isM512(v) || (r && x.isBroadcast(8, 8)) } -func isVMX (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && x.isVMX(false) && !x.Masked } -func isEVEXVMX (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && x.isVMX(true) && !x.Masked } -func isVMXk (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && x.isVMX(true) } -func isVMY (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && x.isVMY(false) && !x.Masked } -func isEVEXVMY (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && x.isVMY(true) && !x.Masked } -func isVMYk (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && x.isVMY(true) } -func isVMZ (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && x.isVMZ() && !x.Masked } -func isVMZk (v interface{}) bool { x, r := v.(*MemoryOperand) ; return r && x.isVMZ() } -func isSAE (v interface{}) bool { _, r := v.(ExceptionControl) ; return r } -func isER (v interface{}) bool { _, r := v.(RoundingControl) ; return r } + return isZMM(v) || isReg64(v) || isEVEXXMM(v) || isEVEXYMM(v) +} + +func isImm4(v interface{}) bool { return inRange(v, 0, 15) } +func isImm8(v interface{}) bool { return inRange(v, math.MinInt8, math.MaxUint8) } +func isImm16(v interface{}) bool { return inRange(v, math.MinInt16, math.MaxUint16) } +func isImm32(v interface{}) bool { return inRange(v, math.MinInt32, math.MaxUint32) } +func isImm64(v interface{}) bool { _, r := asInt64(v); return r } +func isConst1(v interface{}) bool { x, r := asInt64(v); return r && x == 1 } +func isConst3(v interface{}) bool { x, r := asInt64(v); return r && x == 3 } +func isRel8(v interface{}) bool { + x, r := v.(RelativeOffset) + return r && x >= math.MinInt8 && x <= math.MaxInt8 +} +func isRel32(v interface{}) bool { _, r := v.(RelativeOffset); return r } +func isLabel(v interface{}) bool { _, r := v.(*Label); return r } +func isReg8(v interface{}) bool { _, r := v.(Register8); return r } +func isReg8REX(v interface{}) bool { + x, r := v.(Register8) + return r && (x&0x80) == 0 && x >= SPL +} +func isReg16(v interface{}) bool { _, r := v.(Register16); return r } +func isReg32(v interface{}) bool { _, r := v.(Register32); return r } +func isReg64(v interface{}) bool { _, r := v.(Register64); return r } +func isMM(v interface{}) bool { _, r := v.(MMRegister); return r } +func isXMM(v interface{}) bool { x, r := v.(XMMRegister); return r && x <= XMM15 } +func isEVEXXMM(v interface{}) bool { _, r := v.(XMMRegister); return r } +func isXMMk(v interface{}) bool { + x, r := v.(MaskedRegister) + return isXMM(v) || (r && isXMM(x.Reg) && !x.Mask.Z) +} +func isXMMkz(v interface{}) bool { + x, r := v.(MaskedRegister) + return isXMM(v) || (r && isXMM(x.Reg)) +} +func isYMM(v interface{}) bool { x, r := v.(YMMRegister); return r && x <= YMM15 } +func isEVEXYMM(v interface{}) bool { _, r := v.(YMMRegister); return r } +func isYMMk(v interface{}) bool { + x, r := v.(MaskedRegister) + return isYMM(v) || (r && isYMM(x.Reg) && !x.Mask.Z) +} +func isYMMkz(v interface{}) bool { + x, r := v.(MaskedRegister) + return isYMM(v) || (r && isYMM(x.Reg)) +} +func isZMM(v interface{}) bool { _, r := v.(ZMMRegister); return r } +func isZMMk(v interface{}) bool { + x, r := v.(MaskedRegister) + return isZMM(v) || (r && isZMM(x.Reg) && !x.Mask.Z) +} +func isZMMkz(v interface{}) bool { + x, r := v.(MaskedRegister) + return isZMM(v) || (r && isZMM(x.Reg)) +} +func isK(v interface{}) bool { _, r := v.(KRegister); return r } +func isKk(v interface{}) bool { + x, r := v.(MaskedRegister) + return isK(v) || (r && isK(x.Reg) && !x.Mask.Z) +} +func isM(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && x.isMem() && x.Broadcast == 0 && !x.Masked +} +func isMk(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && x.isMem() && x.Broadcast == 0 && !(x.Masked && x.Mask.Z) +} +func isMkz(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && x.isMem() && x.Broadcast == 0 +} +func isM8(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && isM(v) && x.isSize(1) +} +func isM16(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && isM(v) && x.isSize(2) +} +func isM16kz(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && isMkz(v) && x.isSize(2) +} +func isM32(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && isM(v) && x.isSize(4) +} +func isM32k(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && isMk(v) && x.isSize(4) +} +func isM32kz(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && isMkz(v) && x.isSize(4) +} +func isM64(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && isM(v) && x.isSize(8) +} +func isM64k(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && isMk(v) && x.isSize(8) +} +func isM64kz(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && isMkz(v) && x.isSize(8) +} +func isM128(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && isM(v) && x.isSize(16) +} +func isM128kz(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && isMkz(v) && x.isSize(16) +} +func isM256(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && isM(v) && x.isSize(32) +} +func isM256kz(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && isMkz(v) && x.isSize(32) +} +func isM512(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && isM(v) && x.isSize(64) +} +func isM512kz(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && isMkz(v) && x.isSize(64) +} +func isM64M32bcst(v interface{}) bool { + x, r := v.(*MemoryOperand) + return isM64(v) || (r && x.isBroadcast(4, 2)) +} +func isM128M32bcst(v interface{}) bool { + x, r := v.(*MemoryOperand) + return isM128(v) || (r && x.isBroadcast(4, 4)) +} +func isM256M32bcst(v interface{}) bool { + x, r := v.(*MemoryOperand) + return isM256(v) || (r && x.isBroadcast(4, 8)) +} +func isM512M32bcst(v interface{}) bool { + x, r := v.(*MemoryOperand) + return isM512(v) || (r && x.isBroadcast(4, 16)) +} +func isM128M64bcst(v interface{}) bool { + x, r := v.(*MemoryOperand) + return isM128(v) || (r && x.isBroadcast(8, 2)) +} +func isM256M64bcst(v interface{}) bool { + x, r := v.(*MemoryOperand) + return isM256(v) || (r && x.isBroadcast(8, 4)) +} +func isM512M64bcst(v interface{}) bool { + x, r := v.(*MemoryOperand) + return isM512(v) || (r && x.isBroadcast(8, 8)) +} +func isVMX(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && x.isVMX(false) && !x.Masked +} +func isEVEXVMX(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && x.isVMX(true) && !x.Masked +} +func isVMXk(v interface{}) bool { x, r := v.(*MemoryOperand); return r && x.isVMX(true) } +func isVMY(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && x.isVMY(false) && !x.Masked +} +func isEVEXVMY(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && x.isVMY(true) && !x.Masked +} +func isVMYk(v interface{}) bool { x, r := v.(*MemoryOperand); return r && x.isVMY(true) } +func isVMZ(v interface{}) bool { + x, r := v.(*MemoryOperand) + return r && x.isVMZ() && !x.Masked +} +func isVMZk(v interface{}) bool { x, r := v.(*MemoryOperand); return r && x.isVMZ() } +func isSAE(v interface{}) bool { _, r := v.(ExceptionControl); return r } +func isER(v interface{}) bool { _, r := v.(RoundingControl); return r } func isImmExt(v interface{}, ext int, min int64, max int64) bool { - if x, ok := asInt64(v); !ok { - return false - } else if m := int64(1) << (8 * ext); x < m && x >= m + min { - return true - } else { - return x <= max && x >= min - } + if x, ok := asInt64(v); !ok { + return false + } else if m := int64(1) << (8 * ext); x < m && x >= m+min { + return true + } else { + return x <= max && x >= min + } } func isImm8Ext(v interface{}, ext int) bool { - return isImmExt(v, ext, math.MinInt8, math.MaxInt8) + return isImmExt(v, ext, math.MinInt8, math.MaxInt8) } func isImm32Ext(v interface{}, ext int) bool { - return isImmExt(v, ext, math.MinInt32, math.MaxInt32) + return isImmExt(v, ext, math.MinInt32, math.MaxInt32) } diff --git a/vendor/github.com/chenzhuoyu/iasm/x86_64/pools.go b/vendor/github.com/chenzhuoyu/iasm/x86_64/pools.go index 06f85ac26..8e6cbbd8a 100644 --- a/vendor/github.com/chenzhuoyu/iasm/x86_64/pools.go +++ b/vendor/github.com/chenzhuoyu/iasm/x86_64/pools.go @@ -1,117 +1,38 @@ package x86_64 -import ( - `sync` -) - -var ( - labelPool sync.Pool - programPool sync.Pool - instructionPool sync.Pool - memoryOperandPool sync.Pool -) - -func freeLabel(v *Label) { - labelPool.Put(v) -} - -func clearLabel(p *Label) *Label { - *p = Label{} - return p -} - // CreateLabel creates a new Label, it may allocate a new one or grab one from a pool. func CreateLabel(name string) *Label { - var p *Label - var v interface{} + p := new(Label) - /* attempt to grab from the pool */ - if v = labelPool.Get(); v == nil { - p = new(Label) - } else { - p = clearLabel(v.(*Label)) - } - - /* initialize the label */ - p.refs = 1 - p.Name = name - return p + /* initialize the label */ + p.refs = 1 + p.Name = name + return p } func newProgram(arch *Arch) *Program { - var p *Program - var v interface{} - - /* attempt to grab from the pool */ - if v = programPool.Get(); v == nil { - p = new(Program) - } else { - p = clearProgram(v.(*Program)) - } - - /* initialize the program */ - p.arch = arch - return p -} - -func freeProgram(p *Program) { - programPool.Put(p) -} + p := new(Program) -func clearProgram(p *Program) *Program { - *p = Program{} - return p + /* initialize the program */ + p.arch = arch + return p } func newInstruction(name string, argc int, argv Operands) *Instruction { - var v interface{} - var p *Instruction - - /* attempt to grab from the pool */ - if v = instructionPool.Get(); v == nil { - p = new(Instruction) - } else { - p = clearInstruction(v.(*Instruction)) - } - - /* initialize the instruction */ - p.name = name - p.argc = argc - p.argv = argv - return p -} - -func freeInstruction(v *Instruction) { - instructionPool.Put(v) -} + p := new(Instruction) -func clearInstruction(p *Instruction) *Instruction { - *p = Instruction { prefix: p.prefix[:0] } - return p -} - -func freeMemoryOperand(m *MemoryOperand) { - memoryOperandPool.Put(m) -} - -func clearMemoryOperand(m *MemoryOperand) *MemoryOperand { - *m = MemoryOperand{} - return m + /* initialize the instruction */ + p.name = name + p.argc = argc + p.argv = argv + return p } // CreateMemoryOperand creates a new MemoryOperand, it may allocate a new one or grab one from a pool. func CreateMemoryOperand() *MemoryOperand { - var v interface{} - var p *MemoryOperand - - /* attempt to grab from the pool */ - if v = memoryOperandPool.Get(); v == nil { - p = new(MemoryOperand) - } else { - p = clearMemoryOperand(v.(*MemoryOperand)) - } + p := new(MemoryOperand) - /* initialize the memory operand */ - p.refs = 1 - return p + /* initialize the memory operand */ + p.refs = 1 + return p } diff --git a/vendor/github.com/chenzhuoyu/iasm/x86_64/program.go b/vendor/github.com/chenzhuoyu/iasm/x86_64/program.go index 9f80618ef..31562491f 100644 --- a/vendor/github.com/chenzhuoyu/iasm/x86_64/program.go +++ b/vendor/github.com/chenzhuoyu/iasm/x86_64/program.go @@ -1,127 +1,149 @@ package x86_64 import ( - `fmt` - `math` - `math/bits` + "fmt" + "math" + "math/bits" - `github.com/chenzhuoyu/iasm/expr` + "github.com/chenzhuoyu/iasm/expr" ) type ( - _PseudoType int - _InstructionEncoder func(*Program, ...interface{}) *Instruction + _PseudoType int + _InstructionEncoder func(*Program, ...interface{}) *Instruction ) const ( - _PseudoNop _PseudoType = iota + 1 - _PseudoByte - _PseudoWord - _PseudoLong - _PseudoQuad - _PseudoData - _PseudoAlign + _PseudoNop _PseudoType = iota + 1 + _PseudoByte + _PseudoWord + _PseudoLong + _PseudoQuad + _PseudoData + _PseudoAlign ) func (self _PseudoType) String() string { - switch self { - case _PseudoNop : return ".nop" - case _PseudoByte : return ".byte" - case _PseudoWord : return ".word" - case _PseudoLong : return ".long" - case _PseudoQuad : return ".quad" - case _PseudoData : return ".data" - case _PseudoAlign : return ".align" - default : panic("unreachable") - } + switch self { + case _PseudoNop: + return ".nop" + case _PseudoByte: + return ".byte" + case _PseudoWord: + return ".word" + case _PseudoLong: + return ".long" + case _PseudoQuad: + return ".quad" + case _PseudoData: + return ".data" + case _PseudoAlign: + return ".align" + default: + panic("unreachable") + } } type _Pseudo struct { - kind _PseudoType - data []byte - uint uint64 - expr *expr.Expr + kind _PseudoType + data []byte + uint uint64 + expr *expr.Expr } func (self *_Pseudo) free() { - if self.expr != nil { - self.expr.Free() - } + if self.expr != nil { + self.expr.Free() + } } func (self *_Pseudo) encode(m *[]byte, pc uintptr) int { - switch self.kind { - case _PseudoNop : return 0 - case _PseudoByte : self.encodeByte(m) ; return 1 - case _PseudoWord : self.encodeWord(m) ; return 2 - case _PseudoLong : self.encodeLong(m) ; return 4 - case _PseudoQuad : self.encodeQuad(m) ; return 8 - case _PseudoData : self.encodeData(m) ; return len(self.data) - case _PseudoAlign : self.encodeAlign(m, pc) ; return self.alignSize(pc) - default : panic("invalid pseudo instruction") - } + switch self.kind { + case _PseudoNop: + return 0 + case _PseudoByte: + self.encodeByte(m) + return 1 + case _PseudoWord: + self.encodeWord(m) + return 2 + case _PseudoLong: + self.encodeLong(m) + return 4 + case _PseudoQuad: + self.encodeQuad(m) + return 8 + case _PseudoData: + self.encodeData(m) + return len(self.data) + case _PseudoAlign: + self.encodeAlign(m, pc) + return self.alignSize(pc) + default: + panic("invalid pseudo instruction") + } } func (self *_Pseudo) evalExpr(low int64, high int64) int64 { - if v, err := self.expr.Evaluate(); err != nil { - panic(err) - } else if v < low || v > high { - panic(fmt.Sprintf("expression out of range [%d, %d]: %d", low, high, v)) - } else { - return v - } + if v, err := self.expr.Evaluate(); err != nil { + panic(err) + } else if v < low || v > high { + panic(fmt.Sprintf("expression out of range [%d, %d]: %d", low, high, v)) + } else { + return v + } } func (self *_Pseudo) alignSize(pc uintptr) int { - if !ispow2(self.uint) { - panic(fmt.Sprintf("aligment should be a power of 2, not %d", self.uint)) - } else { - return align(int(pc), bits.TrailingZeros64(self.uint)) - int(pc) - } + if !ispow2(self.uint) { + panic(fmt.Sprintf("aligment should be a power of 2, not %d", self.uint)) + } else { + return align(int(pc), bits.TrailingZeros64(self.uint)) - int(pc) + } } func (self *_Pseudo) encodeData(m *[]byte) { - if m != nil { - *m = append(*m, self.data...) - } + if m != nil { + *m = append(*m, self.data...) + } } func (self *_Pseudo) encodeByte(m *[]byte) { - if m != nil { - append8(m, byte(self.evalExpr(math.MinInt8, math.MaxUint8))) - } + if m != nil { + append8(m, byte(self.evalExpr(math.MinInt8, math.MaxUint8))) + } } func (self *_Pseudo) encodeWord(m *[]byte) { - if m != nil { - append16(m, uint16(self.evalExpr(math.MinInt16, math.MaxUint16))) - } + if m != nil { + append16(m, uint16(self.evalExpr(math.MinInt16, math.MaxUint16))) + } } func (self *_Pseudo) encodeLong(m *[]byte) { - if m != nil { - append32(m, uint32(self.evalExpr(math.MinInt32, math.MaxUint32))) - } + if m != nil { + append32(m, uint32(self.evalExpr(math.MinInt32, math.MaxUint32))) + } } func (self *_Pseudo) encodeQuad(m *[]byte) { - if m != nil { - if v, err := self.expr.Evaluate(); err != nil { - panic(err) - } else { - append64(m, uint64(v)) - } - } + if m != nil { + if v, err := self.expr.Evaluate(); err != nil { + panic(err) + } else { + append64(m, uint64(v)) + } + } } func (self *_Pseudo) encodeAlign(m *[]byte, pc uintptr) { - if m != nil { - if self.expr == nil { - expandmm(m, self.alignSize(pc), 0) - } else { - expandmm(m, self.alignSize(pc), byte(self.evalExpr(math.MinInt8, math.MaxUint8))) - } - } + if m != nil { + if self.expr == nil { + expandmm(m, self.alignSize(pc), 0) + } else { + expandmm(m, self.alignSize(pc), byte(self.evalExpr(math.MinInt8, math.MaxUint8))) + } + } } // Operands represents a sequence of operand required by an instruction. @@ -131,15 +153,15 @@ type Operands [_N_args]interface{} type InstructionDomain uint8 const ( - DomainGeneric InstructionDomain = iota - DomainMMXSSE - DomainAVX - DomainFMA - DomainCrypto - DomainMask - DomainAMDSpecific - DomainMisc - DomainPseudo + DomainGeneric InstructionDomain = iota + DomainMMXSSE + DomainAVX + DomainFMA + DomainCrypto + DomainMask + DomainAMDSpecific + DomainMisc + DomainPseudo ) type ( @@ -147,139 +169,139 @@ type ( ) const ( - _B_none _BranchType = iota - _B_conditional - _B_unconditional + _B_none _BranchType = iota + _B_conditional + _B_unconditional ) // Instruction represents an unencoded instruction. type Instruction struct { - next *Instruction - pc uintptr - nb int - len int - argc int - name string - argv Operands - forms [_N_forms]_Encoding - pseudo _Pseudo - branch _BranchType - domain InstructionDomain - prefix []byte + next *Instruction + pc uintptr + nb int + len int + argc int + name string + argv Operands + forms [_N_forms]_Encoding + pseudo _Pseudo + branch _BranchType + domain InstructionDomain + prefix []byte } func (self *Instruction) add(flags int, encoder func(m *_Encoding, v []interface{})) { - self.forms[self.len].flags = flags - self.forms[self.len].encoder = encoder - self.len++ + self.forms[self.len].flags = flags + self.forms[self.len].encoder = encoder + self.len++ } func (self *Instruction) free() { - self.clear() - self.pseudo.free() - freeInstruction(self) + self.clear() + self.pseudo.free() + //freeInstruction(self) } func (self *Instruction) clear() { - for i := 0; i < self.argc; i++ { - if v, ok := self.argv[i].(Disposable); ok { - v.Free() - } - } + for i := 0; i < self.argc; i++ { + if v, ok := self.argv[i].(Disposable); ok { + v.Free() + } + } } func (self *Instruction) check(e *_Encoding) bool { - if (e.flags & _F_rel1) != 0 { - return isRel8(self.argv[0]) - } else if (e.flags & _F_rel4) != 0 { - return isRel32(self.argv[0]) || isLabel(self.argv[0]) - } else { - return true - } + if (e.flags & _F_rel1) != 0 { + return isRel8(self.argv[0]) + } else if (e.flags & _F_rel4) != 0 { + return isRel32(self.argv[0]) || isLabel(self.argv[0]) + } else { + return true + } } func (self *Instruction) encode(m *[]byte) int { - n := math.MaxInt64 - p := (*_Encoding)(nil) - - /* encode prefixes if any */ - if self.nb = len(self.prefix); m != nil { - *m = append(*m, self.prefix...) - } - - /* check for pseudo-instructions */ - if self.pseudo.kind != 0 { - self.nb += self.pseudo.encode(m, self.pc) - return self.nb - } - - /* find the shortest encoding */ - for i := 0; i < self.len; i++ { - if e := &self.forms[i]; self.check(e) { - if v := e.encode(self.argv[:self.argc]); v < n { - n = v - p = e - } - } - } - - /* add to buffer if needed */ - if m != nil { - *m = append(*m, p.bytes[:n]...) - } - - /* update the instruction length */ - self.nb += n - return self.nb + n := math.MaxInt64 + p := (*_Encoding)(nil) + + /* encode prefixes if any */ + if self.nb = len(self.prefix); m != nil { + *m = append(*m, self.prefix...) + } + + /* check for pseudo-instructions */ + if self.pseudo.kind != 0 { + self.nb += self.pseudo.encode(m, self.pc) + return self.nb + } + + /* find the shortest encoding */ + for i := 0; i < self.len; i++ { + if e := &self.forms[i]; self.check(e) { + if v := e.encode(self.argv[:self.argc]); v < n { + n = v + p = e + } + } + } + + /* add to buffer if needed */ + if m != nil { + *m = append(*m, p.bytes[:n]...) + } + + /* update the instruction length */ + self.nb += n + return self.nb } /** Instruction Prefixes **/ const ( - _P_cs = 0x2e - _P_ds = 0x3e - _P_es = 0x26 - _P_fs = 0x64 - _P_gs = 0x65 - _P_ss = 0x36 - _P_lock = 0xf0 + _P_cs = 0x2e + _P_ds = 0x3e + _P_es = 0x26 + _P_fs = 0x64 + _P_gs = 0x65 + _P_ss = 0x36 + _P_lock = 0xf0 ) // CS overrides the memory operation of this instruction to CS. func (self *Instruction) CS() *Instruction { - self.prefix = append(self.prefix, _P_cs) - return self + self.prefix = append(self.prefix, _P_cs) + return self } // DS overrides the memory operation of this instruction to DS, // this is the default section for most instructions if not specified. func (self *Instruction) DS() *Instruction { - self.prefix = append(self.prefix, _P_ds) - return self + self.prefix = append(self.prefix, _P_ds) + return self } // ES overrides the memory operation of this instruction to ES. func (self *Instruction) ES() *Instruction { - self.prefix = append(self.prefix, _P_es) - return self + self.prefix = append(self.prefix, _P_es) + return self } // FS overrides the memory operation of this instruction to FS. func (self *Instruction) FS() *Instruction { - self.prefix = append(self.prefix, _P_fs) - return self + self.prefix = append(self.prefix, _P_fs) + return self } // GS overrides the memory operation of this instruction to GS. func (self *Instruction) GS() *Instruction { - self.prefix = append(self.prefix, _P_gs) - return self + self.prefix = append(self.prefix, _P_gs) + return self } // SS overrides the memory operation of this instruction to SS. func (self *Instruction) SS() *Instruction { - self.prefix = append(self.prefix, _P_ss) - return self + self.prefix = append(self.prefix, _P_ss) + return self } // LOCK causes the processor's LOCK# signal to be asserted during execution of @@ -287,128 +309,132 @@ func (self *Instruction) SS() *Instruction { // In a multiprocessor environment, the LOCK# signal insures that the processor // has exclusive use of any shared memory while the signal is asserted. func (self *Instruction) LOCK() *Instruction { - self.prefix = append(self.prefix, _P_lock) - return self + self.prefix = append(self.prefix, _P_lock) + return self } /** Basic Instruction Properties **/ // Name returns the instruction name. func (self *Instruction) Name() string { - return self.name + return self.name } // Domain returns the domain of this instruction. func (self *Instruction) Domain() InstructionDomain { - return self.domain + return self.domain } // Operands returns the operands of this instruction. func (self *Instruction) Operands() []interface{} { - return self.argv[:self.argc] + return self.argv[:self.argc] } // Program represents a sequence of instructions. type Program struct { - arch *Arch - head *Instruction - tail *Instruction + arch *Arch + head *Instruction + tail *Instruction } const ( - _N_near = 2 // near-branch (-128 ~ +127) takes 2 bytes to encode - _N_far_cond = 6 // conditional far-branch takes 6 bytes to encode - _N_far_uncond = 5 // unconditional far-branch takes 5 bytes to encode + _N_near = 2 // near-branch (-128 ~ +127) takes 2 bytes to encode + _N_far_cond = 6 // conditional far-branch takes 6 bytes to encode + _N_far_uncond = 5 // unconditional far-branch takes 5 bytes to encode ) func (self *Program) clear() { - for p, q := self.head, self.head; p != nil; p = q { - q = p.next - p.free() - } + for p, q := self.head, self.head; p != nil; p = q { + q = p.next + p.free() + } } func (self *Program) alloc(name string, argc int, argv Operands) *Instruction { - p := self.tail - q := newInstruction(name, argc, argv) + p := self.tail + q := newInstruction(name, argc, argv) - /* attach to tail if any */ - if p != nil { - p.next = q - } else { - self.head = q - } + /* attach to tail if any */ + if p != nil { + p.next = q + } else { + self.head = q + } - /* set the new tail */ - self.tail = q - return q + /* set the new tail */ + self.tail = q + return q } func (self *Program) pseudo(kind _PseudoType) (p *Instruction) { - p = self.alloc(kind.String(), 0, Operands{}) - p.domain = DomainPseudo - p.pseudo.kind = kind - return + p = self.alloc(kind.String(), 0, Operands{}) + p.domain = DomainPseudo + p.pseudo.kind = kind + return } func (self *Program) require(isa ISA) { - if !self.arch.HasISA(isa) { - panic("ISA '" + isa.String() + "' was not enabled") - } + if !self.arch.HasISA(isa) { + panic("ISA '" + isa.String() + "' was not enabled") + } } func (self *Program) branchSize(p *Instruction) int { - switch p.branch { - case _B_none : panic("p is not a branch") - case _B_conditional : return _N_far_cond - case _B_unconditional : return _N_far_uncond - default : panic("invalid instruction") - } + switch p.branch { + case _B_none: + panic("p is not a branch") + case _B_conditional: + return _N_far_cond + case _B_unconditional: + return _N_far_uncond + default: + panic("invalid instruction") + } } /** Pseudo-Instructions **/ // Byte is a pseudo-instruction to add raw byte to the assembled code. func (self *Program) Byte(v *expr.Expr) (p *Instruction) { - p = self.pseudo(_PseudoByte) - p.pseudo.expr = v - return + p = self.pseudo(_PseudoByte) + p.pseudo.expr = v + return } // Word is a pseudo-instruction to add raw uint16 as little-endian to the assembled code. func (self *Program) Word(v *expr.Expr) (p *Instruction) { - p = self.pseudo(_PseudoWord) - p.pseudo.expr = v - return + p = self.pseudo(_PseudoWord) + p.pseudo.expr = v + return } // Long is a pseudo-instruction to add raw uint32 as little-endian to the assembled code. func (self *Program) Long(v *expr.Expr) (p *Instruction) { - p = self.pseudo(_PseudoLong) - p.pseudo.expr = v - return + p = self.pseudo(_PseudoLong) + p.pseudo.expr = v + return } // Quad is a pseudo-instruction to add raw uint64 as little-endian to the assembled code. func (self *Program) Quad(v *expr.Expr) (p *Instruction) { - p = self.pseudo(_PseudoQuad) - p.pseudo.expr = v - return + p = self.pseudo(_PseudoQuad) + p.pseudo.expr = v + return } // Data is a pseudo-instruction to add raw bytes to the assembled code. func (self *Program) Data(v []byte) (p *Instruction) { - p = self.pseudo(_PseudoData) - p.pseudo.data = v - return + p = self.pseudo(_PseudoData) + p.pseudo.data = v + return } // Align is a pseudo-instruction to ensure the PC is aligned to a certain value. func (self *Program) Align(align uint64, padding *expr.Expr) (p *Instruction) { - p = self.pseudo(_PseudoAlign) - p.pseudo.uint = align - p.pseudo.expr = padding - return + p = self.pseudo(_PseudoAlign) + p.pseudo.uint = align + p.pseudo.expr = padding + return } /** Program Assembler **/ @@ -417,126 +443,126 @@ func (self *Program) Align(align uint64, padding *expr.Expr) (p *Instruction) { // Any operation performed after Free is undefined behavior. // // NOTE: This also frees all the instructions, labels, memory -// operands and expressions associated with this program. // +// operands and expressions associated with this program. func (self *Program) Free() { - self.clear() - freeProgram(self) + self.clear() + //freeProgram(self) } // Link pins a label at the current position. func (self *Program) Link(p *Label) { - if p.Dest != nil { - panic("lable was alreay linked") - } else { - p.Dest = self.pseudo(_PseudoNop) - } + if p.Dest != nil { + panic("lable was alreay linked") + } else { + p.Dest = self.pseudo(_PseudoNop) + } } // Assemble assembles and links the entire program into machine code. func (self *Program) Assemble(pc uintptr) (ret []byte) { - orig := pc - next := true - offs := uintptr(0) - - /* Pass 0: PC-precompute, assume all labeled branches are far-branches. */ - for p := self.head; p != nil; p = p.next { - if p.pc = pc; !isLabel(p.argv[0]) || p.branch == _B_none { - pc += uintptr(p.encode(nil)) - } else { - pc += uintptr(self.branchSize(p)) - } - } - - /* allocate space for the machine code */ - nb := int(pc - orig) - ret = make([]byte, 0, nb) - - /* Pass 1: adjust all the jumps */ - for next { - next = false - offs = uintptr(0) - - /* scan all the branches */ - for p := self.head; p != nil; p = p.next { - var ok bool - var lb *Label - - /* re-calculate the alignment here */ - if nb = p.nb; p.pseudo.kind == _PseudoAlign { - p.pc -= offs - offs += uintptr(nb - p.encode(nil)) - continue - } - - /* adjust the program counter */ - p.pc -= offs - lb, ok = p.argv[0].(*Label) - - /* only care about labeled far-branches */ - if !ok || p.nb == _N_near || p.branch == _B_none { - continue - } - - /* calculate the jump offset */ - size := self.branchSize(p) - diff := lb.offset(p.pc, size) - - /* too far to be a near jump */ - if diff > 127 || diff < -128 { - p.nb = size - continue - } - - /* a far jump becomes a near jump, calculate - * the PC adjustment value and assemble again */ - next = true - p.nb = _N_near - offs += uintptr(size - _N_near) - } - } - - /* Pass 3: link all the cross-references */ - for p := self.head; p != nil; p = p.next { - for i := 0; i < p.argc; i++ { - var ok bool - var lb *Label - var op *MemoryOperand - - /* resolve labels */ - if lb, ok = p.argv[i].(*Label); ok { - p.argv[i] = lb.offset(p.pc, p.nb) - continue - } - - /* check for memory operands */ - if op, ok = p.argv[i].(*MemoryOperand); !ok { - continue - } - - /* check for label references */ - if op.Addr.Type != Reference { - continue - } - - /* replace the label with the real offset */ - op.Addr.Type = Offset - op.Addr.Offset = op.Addr.Reference.offset(p.pc, p.nb) - } - } - - /* Pass 4: actually encode all the instructions */ - for p := self.head; p != nil; p = p.next { - p.encode(&ret) - } - - /* all done */ - return ret + orig := pc + next := true + offs := uintptr(0) + + /* Pass 0: PC-precompute, assume all labeled branches are far-branches. */ + for p := self.head; p != nil; p = p.next { + if p.pc = pc; !isLabel(p.argv[0]) || p.branch == _B_none { + pc += uintptr(p.encode(nil)) + } else { + pc += uintptr(self.branchSize(p)) + } + } + + /* allocate space for the machine code */ + nb := int(pc - orig) + ret = make([]byte, 0, nb) + + /* Pass 1: adjust all the jumps */ + for next { + next = false + offs = uintptr(0) + + /* scan all the branches */ + for p := self.head; p != nil; p = p.next { + var ok bool + var lb *Label + + /* re-calculate the alignment here */ + if nb = p.nb; p.pseudo.kind == _PseudoAlign { + p.pc -= offs + offs += uintptr(nb - p.encode(nil)) + continue + } + + /* adjust the program counter */ + p.pc -= offs + lb, ok = p.argv[0].(*Label) + + /* only care about labeled far-branches */ + if !ok || p.nb == _N_near || p.branch == _B_none { + continue + } + + /* calculate the jump offset */ + size := self.branchSize(p) + diff := lb.offset(p.pc, size) + + /* too far to be a near jump */ + if diff > 127 || diff < -128 { + p.nb = size + continue + } + + /* a far jump becomes a near jump, calculate + * the PC adjustment value and assemble again */ + next = true + p.nb = _N_near + offs += uintptr(size - _N_near) + } + } + + /* Pass 3: link all the cross-references */ + for p := self.head; p != nil; p = p.next { + for i := 0; i < p.argc; i++ { + var ok bool + var lb *Label + var op *MemoryOperand + + /* resolve labels */ + if lb, ok = p.argv[i].(*Label); ok { + p.argv[i] = lb.offset(p.pc, p.nb) + continue + } + + /* check for memory operands */ + if op, ok = p.argv[i].(*MemoryOperand); !ok { + continue + } + + /* check for label references */ + if op.Addr.Type != Reference { + continue + } + + /* replace the label with the real offset */ + op.Addr.Type = Offset + op.Addr.Offset = op.Addr.Reference.offset(p.pc, p.nb) + } + } + + /* Pass 4: actually encode all the instructions */ + for p := self.head; p != nil; p = p.next { + p.encode(&ret) + } + + /* all done */ + return ret } // AssembleAndFree is like Assemble, but it frees the Program after assembling. func (self *Program) AssembleAndFree(pc uintptr) (ret []byte) { - ret = self.Assemble(pc) - self.Free() - return -} \ No newline at end of file + ret = self.Assemble(pc) + self.Free() + return +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/README.md b/vendor/github.com/gabriel-vasile/mimetype/README.md index d310928de..231b29190 100644 --- a/vendor/github.com/gabriel-vasile/mimetype/README.md +++ b/vendor/github.com/gabriel-vasile/mimetype/README.md @@ -10,9 +10,6 @@

- - Build Status - Go Reference diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/binary.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/binary.go index 29bdded3e..f1e944987 100644 --- a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/binary.go +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/binary.go @@ -150,32 +150,34 @@ func Marc(raw []byte, limit uint32) bool { } // Glb matches a glTF model format file. -// GLB is the binary file format representation of 3D models save in +// GLB is the binary file format representation of 3D models saved in // the GL transmission Format (glTF). -// see more: https://docs.fileformat.com/3d/glb/ -// https://www.iana.org/assignments/media-types/model/gltf-binary -// GLB file format is based on little endian and its header structure -// show below: +// GLB uses little endian and its header structure is as follows: // -// <-- 12-byte header --> -// | magic | version | length | -// | (uint32) | (uint32) | (uint32) | -// | \x67\x6C\x54\x46 | \x01\x00\x00\x00 | ... | -// | g l T F | 1 | ... | +// <-- 12-byte header --> +// | magic | version | length | +// | (uint32) | (uint32) | (uint32) | +// | \x67\x6C\x54\x46 | \x01\x00\x00\x00 | ... | +// | g l T F | 1 | ... | +// +// Visit [glTF specification] and [IANA glTF entry] for more details. +// +// [glTF specification]: https://registry.khronos.org/glTF/specs/2.0/glTF-2.0.html +// [IANA glTF entry]: https://www.iana.org/assignments/media-types/model/gltf-binary var Glb = prefix([]byte("\x67\x6C\x54\x46\x02\x00\x00\x00"), []byte("\x67\x6C\x54\x46\x01\x00\x00\x00")) // TzIf matches a Time Zone Information Format (TZif) file. // See more: https://tools.ietf.org/id/draft-murchison-tzdist-tzif-00.html#rfc.section.3 // Its header structure is shown below: -// +---------------+---+ -// | magic (4) | <-+-- version (1) -// +---------------+---+---------------------------------------+ -// | [unused - reserved for future use] (15) | -// +---------------+---------------+---------------+-----------+ -// | isutccnt (4) | isstdcnt (4) | leapcnt (4) | -// +---------------+---------------+---------------+ -// | timecnt (4) | typecnt (4) | charcnt (4) | +// +---------------+---+ +// | magic (4) | <-+-- version (1) +// +---------------+---+---------------------------------------+ +// | [unused - reserved for future use] (15) | +// +---------------+---------------+---------------+-----------+ +// | isutccnt (4) | isstdcnt (4) | leapcnt (4) | +// +---------------+---------------+---------------+ +// | timecnt (4) | typecnt (4) | charcnt (4) | func TzIf(raw []byte, limit uint32) bool { // File is at least 44 bytes (header size). if len(raw) < 44 { diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/magic.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/magic.go index 466058fbe..34b84f401 100644 --- a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/magic.go +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/magic.go @@ -177,7 +177,9 @@ func newXMLSig(localName, xmlns string) xmlSig { // and, optionally, followed by the arguments for the interpreter. // // Ex: -// #! /usr/bin/env php +// +// #! /usr/bin/env php +// // /usr/bin/env is the interpreter, php is the first and only argument. func shebang(sigs ...[]byte) Detector { return func(raw []byte, limit uint32) bool { diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/text_csv.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/text_csv.go index 6a1561923..84ed64928 100644 --- a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/text_csv.go +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/text_csv.go @@ -3,6 +3,7 @@ package magic import ( "bytes" "encoding/csv" + "errors" "io" ) @@ -19,12 +20,23 @@ func Tsv(raw []byte, limit uint32) bool { func sv(in []byte, comma rune, limit uint32) bool { r := csv.NewReader(dropLastLine(in, limit)) r.Comma = comma - r.TrimLeadingSpace = true + r.ReuseRecord = true r.LazyQuotes = true r.Comment = '#' - lines, err := r.ReadAll() - return err == nil && r.FieldsPerRecord > 1 && len(lines) > 1 + lines := 0 + for { + _, err := r.Read() + if errors.Is(err, io.EOF) { + break + } + if err != nil { + return false + } + lines++ + } + + return r.FieldsPerRecord > 1 && lines > 1 } // dropLastLine drops the last incomplete line from b. diff --git a/vendor/github.com/gabriel-vasile/mimetype/mimetype.go b/vendor/github.com/gabriel-vasile/mimetype/mimetype.go index 08e68e334..1b5909b75 100644 --- a/vendor/github.com/gabriel-vasile/mimetype/mimetype.go +++ b/vendor/github.com/gabriel-vasile/mimetype/mimetype.go @@ -39,7 +39,8 @@ func Detect(in []byte) *MIME { // // DetectReader assumes the reader offset is at the start. If the input is an // io.ReadSeeker you previously read from, it should be rewinded before detection: -// reader.Seek(0, io.SeekStart) +// +// reader.Seek(0, io.SeekStart) func DetectReader(r io.Reader) (*MIME, error) { var in []byte var err error diff --git a/vendor/github.com/gabriel-vasile/mimetype/supported_mimes.md b/vendor/github.com/gabriel-vasile/mimetype/supported_mimes.md index cdec4e674..5ec6f6b65 100644 --- a/vendor/github.com/gabriel-vasile/mimetype/supported_mimes.md +++ b/vendor/github.com/gabriel-vasile/mimetype/supported_mimes.md @@ -1,4 +1,4 @@ -## 172 Supported MIME types +## 173 Supported MIME types This file is automatically generated when running tests. Do not edit manually. Extension | MIME type | Aliases diff --git a/vendor/github.com/gin-contrib/cors/config.go b/vendor/github.com/gin-contrib/cors/config.go index 427cfc00b..8a295e3db 100644 --- a/vendor/github.com/gin-contrib/cors/config.go +++ b/vendor/github.com/gin-contrib/cors/config.go @@ -8,14 +8,15 @@ import ( ) type cors struct { - allowAllOrigins bool - allowCredentials bool - allowOriginFunc func(string) bool - allowOrigins []string - normalHeaders http.Header - preflightHeaders http.Header - wildcardOrigins [][]string - optionsResponseStatusCode int + allowAllOrigins bool + allowCredentials bool + allowOriginFunc func(string) bool + allowOriginWithContextFunc func(*gin.Context, string) bool + allowOrigins []string + normalHeaders http.Header + preflightHeaders http.Header + wildcardOrigins [][]string + optionsResponseStatusCode int } var ( @@ -54,14 +55,15 @@ func newCors(config Config) *cors { } return &cors{ - allowOriginFunc: config.AllowOriginFunc, - allowAllOrigins: config.AllowAllOrigins, - allowCredentials: config.AllowCredentials, - allowOrigins: normalize(config.AllowOrigins), - normalHeaders: generateNormalHeaders(config), - preflightHeaders: generatePreflightHeaders(config), - wildcardOrigins: config.parseWildcardRules(), - optionsResponseStatusCode: config.OptionsResponseStatusCode, + allowOriginFunc: config.AllowOriginFunc, + allowOriginWithContextFunc: config.AllowOriginWithContextFunc, + allowAllOrigins: config.AllowAllOrigins, + allowCredentials: config.AllowCredentials, + allowOrigins: normalize(config.AllowOrigins), + normalHeaders: generateNormalHeaders(config), + preflightHeaders: generatePreflightHeaders(config), + wildcardOrigins: config.parseWildcardRules(), + optionsResponseStatusCode: config.OptionsResponseStatusCode, } } @@ -79,7 +81,7 @@ func (cors *cors) applyCors(c *gin.Context) { return } - if !cors.validateOrigin(origin) { + if !cors.isOriginValid(c, origin) { c.AbortWithStatus(http.StatusForbidden) return } @@ -112,6 +114,14 @@ func (cors *cors) validateWildcardOrigin(origin string) bool { return false } +func (cors *cors) isOriginValid(c *gin.Context, origin string) bool { + valid := cors.validateOrigin(origin) + if !valid && cors.allowOriginWithContextFunc != nil { + valid = cors.allowOriginWithContextFunc(c, origin) + } + return valid +} + func (cors *cors) validateOrigin(origin string) bool { if cors.allowAllOrigins { return true diff --git a/vendor/github.com/gin-contrib/cors/cors.go b/vendor/github.com/gin-contrib/cors/cors.go index b32522277..2261df759 100644 --- a/vendor/github.com/gin-contrib/cors/cors.go +++ b/vendor/github.com/gin-contrib/cors/cors.go @@ -2,6 +2,7 @@ package cors import ( "errors" + "fmt" "strings" "time" @@ -22,6 +23,12 @@ type Config struct { // set, the content of AllowOrigins is ignored. AllowOriginFunc func(origin string) bool + // Same as AllowOriginFunc except also receives the full request context. + // This function should use the context as a read only source and not + // have any side effects on the request, such as aborting or injecting + // values on the request. + AllowOriginWithContextFunc func(c *gin.Context, origin string) bool + // AllowMethods is a list of methods the client is allowed to use with // cross-domain requests. Default value is simple methods (GET, POST, PUT, PATCH, DELETE, HEAD, and OPTIONS) AllowMethods []string @@ -51,6 +58,9 @@ type Config struct { // Allows usage of popular browser extensions schemas AllowBrowserExtensions bool + // Allows to add custom schema like tauri:// + CustomSchemas []string + // Allows usage of WebSocket protocol AllowWebSockets bool @@ -87,6 +97,9 @@ func (c Config) getAllowedSchemas() []string { if c.AllowFiles { allowedSchemas = append(allowedSchemas, FileSchemas...) } + if c.CustomSchemas != nil { + allowedSchemas = append(allowedSchemas, c.CustomSchemas...) + } return allowedSchemas } @@ -102,10 +115,21 @@ func (c Config) validateAllowedSchemas(origin string) bool { // Validate is check configuration of user defined. func (c Config) Validate() error { - if c.AllowAllOrigins && (c.AllowOriginFunc != nil || len(c.AllowOrigins) > 0) { - return errors.New("conflict settings: all origins are allowed. AllowOriginFunc or AllowOrigins is not needed") + hasOriginFn := c.AllowOriginFunc != nil + hasOriginFn = hasOriginFn || c.AllowOriginWithContextFunc != nil + + if c.AllowAllOrigins && (hasOriginFn || len(c.AllowOrigins) > 0) { + originFields := strings.Join([]string{ + "AllowOriginFunc", + "AllowOriginFuncWithContext", + "AllowOrigins", + }, " or ") + return fmt.Errorf( + "conflict settings: all origins enabled. %s is not needed", + originFields, + ) } - if !c.AllowAllOrigins && c.AllowOriginFunc == nil && len(c.AllowOrigins) == 0 { + if !c.AllowAllOrigins && !hasOriginFn && len(c.AllowOrigins) == 0 { return errors.New("conflict settings: all origins disabled") } for _, origin := range c.AllowOrigins { @@ -138,7 +162,7 @@ func (c Config) parseWildcardRules() [][]string { continue } if i == (len(o) - 1) { - wRules = append(wRules, []string{o[:i-1], "*"}) + wRules = append(wRules, []string{o[:i], "*"}) continue } diff --git a/vendor/github.com/go-playground/validator/v10/Makefile b/vendor/github.com/go-playground/validator/v10/Makefile index 09f171ba1..e097dfaf2 100644 --- a/vendor/github.com/go-playground/validator/v10/Makefile +++ b/vendor/github.com/go-playground/validator/v10/Makefile @@ -1,4 +1,4 @@ -GOCMD=GO111MODULE=on go +GOCMD=go linters-install: @golangci-lint --version >/dev/null 2>&1 || { \ @@ -15,4 +15,4 @@ test: bench: $(GOCMD) test -run=NONE -bench=. -benchmem ./... -.PHONY: test lint linters-install \ No newline at end of file +.PHONY: test lint linters-install diff --git a/vendor/github.com/go-playground/validator/v10/README.md b/vendor/github.com/go-playground/validator/v10/README.md index 8e80d52a5..a6e1d0b51 100644 --- a/vendor/github.com/go-playground/validator/v10/README.md +++ b/vendor/github.com/go-playground/validator/v10/README.md @@ -1,7 +1,7 @@ Package validator ================= [![Join the chat at https://gitter.im/go-playground/validator](https://badges.gitter.im/Join%20Chat.svg)](https://gitter.im/go-playground/validator?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge&utm_content=badge) -![Project status](https://img.shields.io/badge/version-10.15.4-green.svg) +![Project status](https://img.shields.io/badge/version-10.19.0-green.svg) [![Build Status](https://travis-ci.org/go-playground/validator.svg?branch=master)](https://travis-ci.org/go-playground/validator) [![Coverage Status](https://coveralls.io/repos/go-playground/validator/badge.svg?branch=master&service=github)](https://coveralls.io/github/go-playground/validator?branch=master) [![Go Report Card](https://goreportcard.com/badge/github.com/go-playground/validator)](https://goreportcard.com/report/github.com/go-playground/validator) @@ -178,6 +178,7 @@ validate := validator.New(validator.WithRequiredStructEnabled()) | isbn | International Standard Book Number | | isbn10 | International Standard Book Number 10 | | isbn13 | International Standard Book Number 13 | +| issn | International Standard Serial Number | | iso3166_1_alpha2 | Two-letter country code (ISO 3166-1 alpha-2) | | iso3166_1_alpha3 | Three-letter country code (ISO 3166-1 alpha-3) | | iso3166_1_alpha_numeric | Numeric country code (ISO 3166-1 numeric) | diff --git a/vendor/github.com/go-playground/validator/v10/baked_in.go b/vendor/github.com/go-playground/validator/v10/baked_in.go index 0b6233070..95f56e008 100644 --- a/vendor/github.com/go-playground/validator/v10/baked_in.go +++ b/vendor/github.com/go-playground/validator/v10/baked_in.go @@ -51,6 +51,7 @@ var ( endKeysTag: {}, structOnlyTag: {}, omitempty: {}, + omitnil: {}, skipValidationTag: {}, utf8HexComma: {}, utf8Pipe: {}, @@ -149,6 +150,7 @@ var ( "isbn": isISBN, "isbn10": isISBN10, "isbn13": isISBN13, + "issn": isISSN, "eth_addr": isEthereumAddress, "eth_addr_checksum": isEthereumAddressChecksum, "btc_addr": isBitcoinAddress, @@ -508,47 +510,47 @@ func isASCII(fl FieldLevel) bool { // isUUID5 is the validation function for validating if the field's value is a valid v5 UUID. func isUUID5(fl FieldLevel) bool { - return uUID5Regex.MatchString(fl.Field().String()) + return fieldMatchesRegexByStringerValOrString(uUID5Regex, fl) } // isUUID4 is the validation function for validating if the field's value is a valid v4 UUID. func isUUID4(fl FieldLevel) bool { - return uUID4Regex.MatchString(fl.Field().String()) + return fieldMatchesRegexByStringerValOrString(uUID4Regex, fl) } // isUUID3 is the validation function for validating if the field's value is a valid v3 UUID. func isUUID3(fl FieldLevel) bool { - return uUID3Regex.MatchString(fl.Field().String()) + return fieldMatchesRegexByStringerValOrString(uUID3Regex, fl) } // isUUID is the validation function for validating if the field's value is a valid UUID of any version. func isUUID(fl FieldLevel) bool { - return uUIDRegex.MatchString(fl.Field().String()) + return fieldMatchesRegexByStringerValOrString(uUIDRegex, fl) } // isUUID5RFC4122 is the validation function for validating if the field's value is a valid RFC4122 v5 UUID. func isUUID5RFC4122(fl FieldLevel) bool { - return uUID5RFC4122Regex.MatchString(fl.Field().String()) + return fieldMatchesRegexByStringerValOrString(uUID5RFC4122Regex, fl) } // isUUID4RFC4122 is the validation function for validating if the field's value is a valid RFC4122 v4 UUID. func isUUID4RFC4122(fl FieldLevel) bool { - return uUID4RFC4122Regex.MatchString(fl.Field().String()) + return fieldMatchesRegexByStringerValOrString(uUID4RFC4122Regex, fl) } // isUUID3RFC4122 is the validation function for validating if the field's value is a valid RFC4122 v3 UUID. func isUUID3RFC4122(fl FieldLevel) bool { - return uUID3RFC4122Regex.MatchString(fl.Field().String()) + return fieldMatchesRegexByStringerValOrString(uUID3RFC4122Regex, fl) } // isUUIDRFC4122 is the validation function for validating if the field's value is a valid RFC4122 UUID of any version. func isUUIDRFC4122(fl FieldLevel) bool { - return uUIDRFC4122Regex.MatchString(fl.Field().String()) + return fieldMatchesRegexByStringerValOrString(uUIDRFC4122Regex, fl) } // isULID is the validation function for validating if the field's value is a valid ULID. func isULID(fl FieldLevel) bool { - return uLIDRegex.MatchString(fl.Field().String()) + return fieldMatchesRegexByStringerValOrString(uLIDRegex, fl) } // isMD4 is the validation function for validating if the field's value is a valid MD4. @@ -650,6 +652,32 @@ func isISBN10(fl FieldLevel) bool { return checksum%11 == 0 } +// isISSN is the validation function for validating if the field's value is a valid ISSN. +func isISSN(fl FieldLevel) bool { + s := fl.Field().String() + + if !iSSNRegex.MatchString(s) { + return false + } + s = strings.ReplaceAll(s, "-", "") + + pos := 8 + checksum := 0 + + for i := 0; i < 7; i++ { + checksum += pos * int(s[i]-'0') + pos-- + } + + if s[7] == 'X' { + checksum += 10 + } else { + checksum += int(s[7] - '0') + } + + return checksum%11 == 0 +} + // isEthereumAddress is the validation function for validating if the field's value is a valid Ethereum address. func isEthereumAddress(fl FieldLevel) bool { address := fl.Field().String() @@ -1413,6 +1441,15 @@ func isURI(fl FieldLevel) bool { panic(fmt.Sprintf("Bad field type %T", field.Interface())) } +// isFileURL is the helper function for validating if the `path` valid file URL as per RFC8089 +func isFileURL(path string) bool { + if !strings.HasPrefix(path, "file:/") { + return false + } + _, err := url.ParseRequestURI(path) + return err == nil +} + // isURL is the validation function for validating if the current field's value is a valid URL. func isURL(fl FieldLevel) bool { field := fl.Field() @@ -1420,12 +1457,16 @@ func isURL(fl FieldLevel) bool { switch field.Kind() { case reflect.String: - s := field.String() + s := strings.ToLower(field.String()) if len(s) == 0 { return false } + if isFileURL(s) { + return true + } + url, err := url.Parse(s) if err != nil || url.Scheme == "" { return false diff --git a/vendor/github.com/go-playground/validator/v10/cache.go b/vendor/github.com/go-playground/validator/v10/cache.go index bbfd2a4af..b6bdd11a1 100644 --- a/vendor/github.com/go-playground/validator/v10/cache.go +++ b/vendor/github.com/go-playground/validator/v10/cache.go @@ -20,6 +20,7 @@ const ( typeOr typeKeys typeEndKeys + typeOmitNil ) const ( @@ -125,7 +126,7 @@ func (v *Validate) extractStructCache(current reflect.Value, sName string) *cStr fld = typ.Field(i) - if !fld.Anonymous && len(fld.PkgPath) > 0 { + if !v.privateFieldValidation && !fld.Anonymous && len(fld.PkgPath) > 0 { continue } @@ -252,6 +253,10 @@ func (v *Validate) parseFieldTagsRecursive(tag string, fieldName string, alias s current.typeof = typeOmitEmpty continue + case omitnil: + current.typeof = typeOmitNil + continue + case structOnlyTag: current.typeof = typeStructOnly continue diff --git a/vendor/github.com/go-playground/validator/v10/doc.go b/vendor/github.com/go-playground/validator/v10/doc.go index c4dbb595f..b47409188 100644 --- a/vendor/github.com/go-playground/validator/v10/doc.go +++ b/vendor/github.com/go-playground/validator/v10/doc.go @@ -194,6 +194,13 @@ such as min or max won't run, but if a value is set validation will run. Usage: omitempty +# Omit Nil + +Allows to skip the validation if the value is nil (same as omitempty, but +only for the nil-values). + + Usage: omitnil + # Dive This tells the validator to dive into a slice, array or map and validate that diff --git a/vendor/github.com/go-playground/validator/v10/errors.go b/vendor/github.com/go-playground/validator/v10/errors.go index 5856d57c8..be2676e9e 100644 --- a/vendor/github.com/go-playground/validator/v10/errors.go +++ b/vendor/github.com/go-playground/validator/v10/errors.go @@ -257,15 +257,19 @@ func (fe *fieldError) Error() string { // NOTE: if no registered translation can be found, it returns the original // untranslated error message. func (fe *fieldError) Translate(ut ut.Translator) string { + var fn TranslationFunc m, ok := fe.v.transTagFunc[ut] if !ok { return fe.Error() } - fn, ok := m[fe.tag] + fn, ok = m[fe.tag] if !ok { - return fe.Error() + fn, ok = m[fe.actualTag] + if !ok { + return fe.Error() + } } return fn(ut, fe) diff --git a/vendor/github.com/go-playground/validator/v10/options.go b/vendor/github.com/go-playground/validator/v10/options.go index 1dea56fd7..86a0db218 100644 --- a/vendor/github.com/go-playground/validator/v10/options.go +++ b/vendor/github.com/go-playground/validator/v10/options.go @@ -14,3 +14,13 @@ func WithRequiredStructEnabled() Option { v.requiredStructEnabled = true } } + +// WithPrivateFieldValidation activates validation for unexported fields via the use of the `unsafe` package. +// +// By opting into this feature you are acknowledging that you are aware of the risks and accept any current or future +// consequences of using this feature. +func WithPrivateFieldValidation() Option { + return func(v *Validate) { + v.privateFieldValidation = true + } +} diff --git a/vendor/github.com/go-playground/validator/v10/regexes.go b/vendor/github.com/go-playground/validator/v10/regexes.go index 6c8f98560..af98d8daa 100644 --- a/vendor/github.com/go-playground/validator/v10/regexes.go +++ b/vendor/github.com/go-playground/validator/v10/regexes.go @@ -22,6 +22,7 @@ const ( base64RawURLRegexString = "^(?:[A-Za-z0-9-_]{4})*(?:[A-Za-z0-9-_]{2,4})$" iSBN10RegexString = "^(?:[0-9]{9}X|[0-9]{10})$" iSBN13RegexString = "^(?:(?:97(?:8|9))[0-9]{10})$" + iSSNRegexString = "^(?:[0-9]{4}-[0-9]{3}[0-9X])$" uUID3RegexString = "^[0-9a-f]{8}-[0-9a-f]{4}-3[0-9a-f]{3}-[0-9a-f]{4}-[0-9a-f]{12}$" uUID4RegexString = "^[0-9a-f]{8}-[0-9a-f]{4}-4[0-9a-f]{3}-[89ab][0-9a-f]{3}-[0-9a-f]{12}$" uUID5RegexString = "^[0-9a-f]{8}-[0-9a-f]{4}-5[0-9a-f]{3}-[89ab][0-9a-f]{3}-[0-9a-f]{12}$" @@ -93,6 +94,7 @@ var ( base64RawURLRegex = regexp.MustCompile(base64RawURLRegexString) iSBN10Regex = regexp.MustCompile(iSBN10RegexString) iSBN13Regex = regexp.MustCompile(iSBN13RegexString) + iSSNRegex = regexp.MustCompile(iSSNRegexString) uUID3Regex = regexp.MustCompile(uUID3RegexString) uUID4Regex = regexp.MustCompile(uUID4RegexString) uUID5Regex = regexp.MustCompile(uUID5RegexString) diff --git a/vendor/github.com/go-playground/validator/v10/util.go b/vendor/github.com/go-playground/validator/v10/util.go index 4bd947bdf..16851593d 100644 --- a/vendor/github.com/go-playground/validator/v10/util.go +++ b/vendor/github.com/go-playground/validator/v10/util.go @@ -1,7 +1,9 @@ package validator import ( + "fmt" "reflect" + "regexp" "strconv" "strings" "time" @@ -292,3 +294,18 @@ func panicIf(err error) { panic(err.Error()) } } + +// Checks if field value matches regex. If fl.Field can be cast to Stringer, it uses the Stringer interfaces +// String() return value. Otherwise, it uses fl.Field's String() value. +func fieldMatchesRegexByStringerValOrString(regex *regexp.Regexp, fl FieldLevel) bool { + switch fl.Field().Kind() { + case reflect.String: + return regex.MatchString(fl.Field().String()) + default: + if stringer, ok := fl.Field().Interface().(fmt.Stringer); ok { + return regex.MatchString(stringer.String()) + } else { + return regex.MatchString(fl.Field().String()) + } + } +} diff --git a/vendor/github.com/go-playground/validator/v10/validator.go b/vendor/github.com/go-playground/validator/v10/validator.go index 342c4ec24..901e7b50a 100644 --- a/vendor/github.com/go-playground/validator/v10/validator.go +++ b/vendor/github.com/go-playground/validator/v10/validator.go @@ -5,6 +5,7 @@ import ( "fmt" "reflect" "strconv" + "unsafe" ) // per validate construct @@ -112,6 +113,10 @@ func (v *validate) traverseField(ctx context.Context, parent reflect.Value, curr return } + if ct.typeof == typeOmitNil && (kind != reflect.Invalid && current.IsNil()) { + return + } + if ct.hasTag { if kind == reflect.Invalid { v.str1 = string(append(ns, cf.altName...)) @@ -152,7 +157,7 @@ func (v *validate) traverseField(ctx context.Context, parent reflect.Value, curr structNs: v.str2, fieldLen: uint8(len(cf.altName)), structfieldLen: uint8(len(cf.name)), - value: current.Interface(), + value: getValue(current), param: ct.param, kind: kind, typ: current.Type(), @@ -233,6 +238,26 @@ OUTER: ct = ct.next continue + case typeOmitNil: + v.slflParent = parent + v.flField = current + v.cf = cf + v.ct = ct + + switch field := v.Field(); field.Kind() { + case reflect.Slice, reflect.Map, reflect.Ptr, reflect.Interface, reflect.Chan, reflect.Func: + if field.IsNil() { + return + } + default: + if v.fldIsPointer && field.Interface() == nil { + return + } + } + + ct = ct.next + continue + case typeEndKeys: return @@ -386,7 +411,7 @@ OUTER: structNs: v.str2, fieldLen: uint8(len(cf.altName)), structfieldLen: uint8(len(cf.name)), - value: current.Interface(), + value: getValue(current), param: ct.param, kind: kind, typ: typ, @@ -406,7 +431,7 @@ OUTER: structNs: v.str2, fieldLen: uint8(len(cf.altName)), structfieldLen: uint8(len(cf.name)), - value: current.Interface(), + value: getValue(current), param: ct.param, kind: kind, typ: typ, @@ -446,7 +471,7 @@ OUTER: structNs: v.str2, fieldLen: uint8(len(cf.altName)), structfieldLen: uint8(len(cf.name)), - value: current.Interface(), + value: getValue(current), param: ct.param, kind: kind, typ: typ, @@ -460,3 +485,26 @@ OUTER: } } + +func getValue(val reflect.Value) interface{} { + if val.CanInterface() { + return val.Interface() + } + + if val.CanAddr() { + return reflect.NewAt(val.Type(), unsafe.Pointer(val.UnsafeAddr())).Elem().Interface() + } + + switch val.Kind() { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return val.Int() + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return val.Uint() + case reflect.Complex64, reflect.Complex128: + return val.Complex() + case reflect.Float32, reflect.Float64: + return val.Float() + default: + return val.String() + } +} diff --git a/vendor/github.com/go-playground/validator/v10/validator_instance.go b/vendor/github.com/go-playground/validator/v10/validator_instance.go index a4dbdd098..1a345138e 100644 --- a/vendor/github.com/go-playground/validator/v10/validator_instance.go +++ b/vendor/github.com/go-playground/validator/v10/validator_instance.go @@ -22,6 +22,7 @@ const ( structOnlyTag = "structonly" noStructLevelTag = "nostructlevel" omitempty = "omitempty" + omitnil = "omitnil" isdefault = "isdefault" requiredWithoutAllTag = "required_without_all" requiredWithoutTag = "required_without" @@ -79,20 +80,21 @@ type internalValidationFuncWrapper struct { // Validate contains the validator settings and cache type Validate struct { - tagName string - pool *sync.Pool - tagNameFunc TagNameFunc - structLevelFuncs map[reflect.Type]StructLevelFuncCtx - customFuncs map[reflect.Type]CustomTypeFunc - aliases map[string]string - validations map[string]internalValidationFuncWrapper - transTagFunc map[ut.Translator]map[string]TranslationFunc // map[]map[]TranslationFunc - rules map[reflect.Type]map[string]string - tagCache *tagCache - structCache *structCache - hasCustomFuncs bool - hasTagNameFunc bool - requiredStructEnabled bool + tagName string + pool *sync.Pool + tagNameFunc TagNameFunc + structLevelFuncs map[reflect.Type]StructLevelFuncCtx + customFuncs map[reflect.Type]CustomTypeFunc + aliases map[string]string + validations map[string]internalValidationFuncWrapper + transTagFunc map[ut.Translator]map[string]TranslationFunc // map[]map[]TranslationFunc + rules map[reflect.Type]map[string]string + tagCache *tagCache + structCache *structCache + hasCustomFuncs bool + hasTagNameFunc bool + requiredStructEnabled bool + privateFieldValidation bool } // New returns a new instance of 'validate' with sane defaults. diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go index 15b760337..805f5e7b4 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -67,195 +67,200 @@ const ( // Keep index -1 as unknown UNKNOWN = -1 - // Add features - ADX FeatureID = iota // Intel ADX (Multi-Precision Add-Carry Instruction Extensions) - AESNI // Advanced Encryption Standard New Instructions - AMD3DNOW // AMD 3DNOW - AMD3DNOWEXT // AMD 3DNowExt - AMXBF16 // Tile computational operations on BFLOAT16 numbers - AMXFP16 // Tile computational operations on FP16 numbers - AMXINT8 // Tile computational operations on 8-bit integers - AMXTILE // Tile architecture - APX_F // Intel APX - AVX // AVX functions - AVX10 // If set the Intel AVX10 Converged Vector ISA is supported - AVX10_128 // If set indicates that AVX10 128-bit vector support is present - AVX10_256 // If set indicates that AVX10 256-bit vector support is present - AVX10_512 // If set indicates that AVX10 512-bit vector support is present - AVX2 // AVX2 functions - AVX512BF16 // AVX-512 BFLOAT16 Instructions - AVX512BITALG // AVX-512 Bit Algorithms - AVX512BW // AVX-512 Byte and Word Instructions - AVX512CD // AVX-512 Conflict Detection Instructions - AVX512DQ // AVX-512 Doubleword and Quadword Instructions - AVX512ER // AVX-512 Exponential and Reciprocal Instructions - AVX512F // AVX-512 Foundation - AVX512FP16 // AVX-512 FP16 Instructions - AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions - AVX512PF // AVX-512 Prefetch Instructions - AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions - AVX512VBMI2 // AVX-512 Vector Bit Manipulation Instructions, Version 2 - AVX512VL // AVX-512 Vector Length Extensions - AVX512VNNI // AVX-512 Vector Neural Network Instructions - AVX512VP2INTERSECT // AVX-512 Intersect for D/Q - AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword - AVXIFMA // AVX-IFMA instructions - AVXNECONVERT // AVX-NE-CONVERT instructions - AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one - AVXVNNI // AVX (VEX encoded) VNNI neural network instructions - AVXVNNIINT8 // AVX-VNNI-INT8 instructions - BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 - BMI1 // Bit Manipulation Instruction Set 1 - BMI2 // Bit Manipulation Instruction Set 2 - CETIBT // Intel CET Indirect Branch Tracking - CETSS // Intel CET Shadow Stack - CLDEMOTE // Cache Line Demote - CLMUL // Carry-less Multiplication - CLZERO // CLZERO instruction supported - CMOV // i686 CMOV - CMPCCXADD // CMPCCXADD instructions - CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB - CMPXCHG8 // CMPXCHG8 instruction - CPBOOST // Core Performance Boost - CPPC // AMD: Collaborative Processor Performance Control - CX16 // CMPXCHG16B Instruction - EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ - ENQCMD // Enqueue Command - ERMS // Enhanced REP MOVSB/STOSB - F16C // Half-precision floating-point conversion - FLUSH_L1D // Flush L1D cache - FMA3 // Intel FMA 3. Does not imply AVX. - FMA4 // Bulldozer FMA4 functions - FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide - FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide - FSRM // Fast Short Rep Mov - FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9 - FXSROPT // FXSAVE/FXRSTOR optimizations - GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. - HLE // Hardware Lock Elision - HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR - HTT // Hyperthreading (enabled) - HWA // Hardware assert supported. Indicates support for MSRC001_10 - HYBRID_CPU // This part has CPUs of more than one type. - HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors - IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel) - IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR - IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) - IBRS // AMD: Indirect Branch Restricted Speculation - IBRS_PREFERRED // AMD: IBRS is preferred over software solution - IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection - IBS // Instruction Based Sampling (AMD) - IBSBRNTRGT // Instruction Based Sampling Feature (AMD) - IBSFETCHSAM // Instruction Based Sampling Feature (AMD) - IBSFFV // Instruction Based Sampling Feature (AMD) - IBSOPCNT // Instruction Based Sampling Feature (AMD) - IBSOPCNTEXT // Instruction Based Sampling Feature (AMD) - IBSOPSAM // Instruction Based Sampling Feature (AMD) - IBSRDWROPCNT // Instruction Based Sampling Feature (AMD) - IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD) - IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported - IBS_OPDATA4 // AMD: IBS op data 4 MSR supported - IBS_OPFUSE // AMD: Indicates support for IbsOpFuse - IBS_PREVENTHOST // Disallowing IBS use by the host supported - IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4 - IDPRED_CTRL // IPRED_DIS - INT_WBINVD // WBINVD/WBNOINVD are interruptible. - INVLPGB // NVLPGB and TLBSYNC instruction supported - KEYLOCKER // Key locker - KEYLOCKERW // Key locker wide - LAHF // LAHF/SAHF in long mode - LAM // If set, CPU supports Linear Address Masking - LBRVIRT // LBR virtualization - LZCNT // LZCNT instruction - MCAOVERFLOW // MCA overflow recovery support. - MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. - MCOMMIT // MCOMMIT instruction supported - MD_CLEAR // VERW clears CPU buffers - MMX // standard MMX - MMXEXT // SSE integer functions or AMD MMX ext - MOVBE // MOVBE instruction (big-endian) - MOVDIR64B // Move 64 Bytes as Direct Store - MOVDIRI // Move Doubleword as Direct Store - MOVSB_ZL // Fast Zero-Length MOVSB - MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD - MPX // Intel MPX (Memory Protection Extensions) - MSRIRC // Instruction Retired Counter MSR available - MSRLIST // Read/Write List of Model Specific Registers - MSR_PAGEFLUSH // Page Flush MSR available - NRIPS // Indicates support for NRIP save on VMEXIT - NX // NX (No-Execute) bit - OSXSAVE // XSAVE enabled by OS - PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption - POPCNT // POPCNT instruction - PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled - PREFETCHI // PREFETCHIT0/1 instructions - PSFD // Predictive Store Forward Disable - RDPRU // RDPRU instruction supported - RDRAND // RDRAND instruction is available - RDSEED // RDSEED instruction is available - RDTSCP // RDTSCP Instruction - RRSBA_CTRL // Restricted RSB Alternate - RTM // Restricted Transactional Memory - RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort. - SERIALIZE // Serialize Instruction Execution - SEV // AMD Secure Encrypted Virtualization supported - SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host - SEV_ALTERNATIVE // AMD SEV Alternate Injection supported - SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests - SEV_ES // AMD SEV Encrypted State supported - SEV_RESTRICTED // AMD SEV Restricted Injection supported - SEV_SNP // AMD SEV Secure Nested Paging supported - SGX // Software Guard Extensions - SGXLC // Software Guard Extensions Launch Control - SHA // Intel SHA Extensions - SME // AMD Secure Memory Encryption supported - SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced - SPEC_CTRL_SSBD // Speculative Store Bypass Disable - SRBDS_CTRL // SRBDS mitigation MSR available - SSE // SSE functions - SSE2 // P4 SSE functions - SSE3 // Prescott SSE3 functions - SSE4 // Penryn SSE4.1 functions - SSE42 // Nehalem SSE4.2 functions - SSE4A // AMD Barcelona microarchitecture SSE4a instructions - SSSE3 // Conroe SSSE3 functions - STIBP // Single Thread Indirect Branch Predictors - STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On - STOSB_SHORT // Fast short STOSB - SUCCOR // Software uncorrectable error containment and recovery capability. - SVM // AMD Secure Virtual Machine - SVMDA // Indicates support for the SVM decode assists. - SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control - SVML // AMD SVM lock. Indicates support for SVM-Lock. - SVMNP // AMD SVM nested paging - SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter - SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold - SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions. - SYSEE // SYSENTER and SYSEXIT instructions - TBM // AMD Trailing Bit Manipulation - TDX_GUEST // Intel Trust Domain Extensions Guest - TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations - TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. - TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. - TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 - TSXLDTRK // Intel TSX Suspend Load Address Tracking - VAES // Vector AES. AVX(512) versions requires additional checks. - VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits. - VMPL // AMD VM Permission Levels supported - VMSA_REGPROT // AMD VMSA Register Protection supported - VMX // Virtual Machine Extensions - VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. - VTE // AMD Virtual Transparent Encryption supported - WAITPKG // TPAUSE, UMONITOR, UMWAIT - WBNOINVD // Write Back and Do Not Invalidate Cache - WRMSRNS // Non-Serializing Write to Model Specific Register - X87 // FPU - XGETBV1 // Supports XGETBV with ECX = 1 - XOP // Bulldozer XOP functions - XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV - XSAVEC // Supports XSAVEC and the compacted form of XRSTOR. - XSAVEOPT // XSAVEOPT available - XSAVES // Supports XSAVES/XRSTORS and IA32_XSS + // x86 features + ADX FeatureID = iota // Intel ADX (Multi-Precision Add-Carry Instruction Extensions) + AESNI // Advanced Encryption Standard New Instructions + AMD3DNOW // AMD 3DNOW + AMD3DNOWEXT // AMD 3DNowExt + AMXBF16 // Tile computational operations on BFLOAT16 numbers + AMXFP16 // Tile computational operations on FP16 numbers + AMXINT8 // Tile computational operations on 8-bit integers + AMXTILE // Tile architecture + APX_F // Intel APX + AVX // AVX functions + AVX10 // If set the Intel AVX10 Converged Vector ISA is supported + AVX10_128 // If set indicates that AVX10 128-bit vector support is present + AVX10_256 // If set indicates that AVX10 256-bit vector support is present + AVX10_512 // If set indicates that AVX10 512-bit vector support is present + AVX2 // AVX2 functions + AVX512BF16 // AVX-512 BFLOAT16 Instructions + AVX512BITALG // AVX-512 Bit Algorithms + AVX512BW // AVX-512 Byte and Word Instructions + AVX512CD // AVX-512 Conflict Detection Instructions + AVX512DQ // AVX-512 Doubleword and Quadword Instructions + AVX512ER // AVX-512 Exponential and Reciprocal Instructions + AVX512F // AVX-512 Foundation + AVX512FP16 // AVX-512 FP16 Instructions + AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions + AVX512PF // AVX-512 Prefetch Instructions + AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions + AVX512VBMI2 // AVX-512 Vector Bit Manipulation Instructions, Version 2 + AVX512VL // AVX-512 Vector Length Extensions + AVX512VNNI // AVX-512 Vector Neural Network Instructions + AVX512VP2INTERSECT // AVX-512 Intersect for D/Q + AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword + AVXIFMA // AVX-IFMA instructions + AVXNECONVERT // AVX-NE-CONVERT instructions + AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one + AVXVNNI // AVX (VEX encoded) VNNI neural network instructions + AVXVNNIINT8 // AVX-VNNI-INT8 instructions + BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 + BMI1 // Bit Manipulation Instruction Set 1 + BMI2 // Bit Manipulation Instruction Set 2 + CETIBT // Intel CET Indirect Branch Tracking + CETSS // Intel CET Shadow Stack + CLDEMOTE // Cache Line Demote + CLMUL // Carry-less Multiplication + CLZERO // CLZERO instruction supported + CMOV // i686 CMOV + CMPCCXADD // CMPCCXADD instructions + CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB + CMPXCHG8 // CMPXCHG8 instruction + CPBOOST // Core Performance Boost + CPPC // AMD: Collaborative Processor Performance Control + CX16 // CMPXCHG16B Instruction + EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ + ENQCMD // Enqueue Command + ERMS // Enhanced REP MOVSB/STOSB + F16C // Half-precision floating-point conversion + FLUSH_L1D // Flush L1D cache + FMA3 // Intel FMA 3. Does not imply AVX. + FMA4 // Bulldozer FMA4 functions + FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide + FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide + FSRM // Fast Short Rep Mov + FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9 + FXSROPT // FXSAVE/FXRSTOR optimizations + GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. + HLE // Hardware Lock Elision + HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR + HTT // Hyperthreading (enabled) + HWA // Hardware assert supported. Indicates support for MSRC001_10 + HYBRID_CPU // This part has CPUs of more than one type. + HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors + IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel) + IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR + IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) + IBPB_BRTYPE // Indicates that MSR 49h (PRED_CMD) bit 0 (IBPB) flushes all branch type predictions from the CPU branch predictor + IBRS // AMD: Indirect Branch Restricted Speculation + IBRS_PREFERRED // AMD: IBRS is preferred over software solution + IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection + IBS // Instruction Based Sampling (AMD) + IBSBRNTRGT // Instruction Based Sampling Feature (AMD) + IBSFETCHSAM // Instruction Based Sampling Feature (AMD) + IBSFFV // Instruction Based Sampling Feature (AMD) + IBSOPCNT // Instruction Based Sampling Feature (AMD) + IBSOPCNTEXT // Instruction Based Sampling Feature (AMD) + IBSOPSAM // Instruction Based Sampling Feature (AMD) + IBSRDWROPCNT // Instruction Based Sampling Feature (AMD) + IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD) + IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported + IBS_OPDATA4 // AMD: IBS op data 4 MSR supported + IBS_OPFUSE // AMD: Indicates support for IbsOpFuse + IBS_PREVENTHOST // Disallowing IBS use by the host supported + IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4 + IDPRED_CTRL // IPRED_DIS + INT_WBINVD // WBINVD/WBNOINVD are interruptible. + INVLPGB // NVLPGB and TLBSYNC instruction supported + KEYLOCKER // Key locker + KEYLOCKERW // Key locker wide + LAHF // LAHF/SAHF in long mode + LAM // If set, CPU supports Linear Address Masking + LBRVIRT // LBR virtualization + LZCNT // LZCNT instruction + MCAOVERFLOW // MCA overflow recovery support. + MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. + MCOMMIT // MCOMMIT instruction supported + MD_CLEAR // VERW clears CPU buffers + MMX // standard MMX + MMXEXT // SSE integer functions or AMD MMX ext + MOVBE // MOVBE instruction (big-endian) + MOVDIR64B // Move 64 Bytes as Direct Store + MOVDIRI // Move Doubleword as Direct Store + MOVSB_ZL // Fast Zero-Length MOVSB + MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD + MPX // Intel MPX (Memory Protection Extensions) + MSRIRC // Instruction Retired Counter MSR available + MSRLIST // Read/Write List of Model Specific Registers + MSR_PAGEFLUSH // Page Flush MSR available + NRIPS // Indicates support for NRIP save on VMEXIT + NX // NX (No-Execute) bit + OSXSAVE // XSAVE enabled by OS + PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption + POPCNT // POPCNT instruction + PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled + PREFETCHI // PREFETCHIT0/1 instructions + PSFD // Predictive Store Forward Disable + RDPRU // RDPRU instruction supported + RDRAND // RDRAND instruction is available + RDSEED // RDSEED instruction is available + RDTSCP // RDTSCP Instruction + RRSBA_CTRL // Restricted RSB Alternate + RTM // Restricted Transactional Memory + RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort. + SBPB // Indicates support for the Selective Branch Predictor Barrier + SERIALIZE // Serialize Instruction Execution + SEV // AMD Secure Encrypted Virtualization supported + SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host + SEV_ALTERNATIVE // AMD SEV Alternate Injection supported + SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests + SEV_ES // AMD SEV Encrypted State supported + SEV_RESTRICTED // AMD SEV Restricted Injection supported + SEV_SNP // AMD SEV Secure Nested Paging supported + SGX // Software Guard Extensions + SGXLC // Software Guard Extensions Launch Control + SHA // Intel SHA Extensions + SME // AMD Secure Memory Encryption supported + SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced + SPEC_CTRL_SSBD // Speculative Store Bypass Disable + SRBDS_CTRL // SRBDS mitigation MSR available + SRSO_MSR_FIX // Indicates that software may use MSR BP_CFG[BpSpecReduce] to mitigate SRSO. + SRSO_NO // Indicates the CPU is not subject to the SRSO vulnerability + SRSO_USER_KERNEL_NO // Indicates the CPU is not subject to the SRSO vulnerability across user/kernel boundaries + SSE // SSE functions + SSE2 // P4 SSE functions + SSE3 // Prescott SSE3 functions + SSE4 // Penryn SSE4.1 functions + SSE42 // Nehalem SSE4.2 functions + SSE4A // AMD Barcelona microarchitecture SSE4a instructions + SSSE3 // Conroe SSSE3 functions + STIBP // Single Thread Indirect Branch Predictors + STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On + STOSB_SHORT // Fast short STOSB + SUCCOR // Software uncorrectable error containment and recovery capability. + SVM // AMD Secure Virtual Machine + SVMDA // Indicates support for the SVM decode assists. + SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control + SVML // AMD SVM lock. Indicates support for SVM-Lock. + SVMNP // AMD SVM nested paging + SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter + SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold + SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions. + SYSEE // SYSENTER and SYSEXIT instructions + TBM // AMD Trailing Bit Manipulation + TDX_GUEST // Intel Trust Domain Extensions Guest + TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations + TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. + TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. + TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 + TSXLDTRK // Intel TSX Suspend Load Address Tracking + VAES // Vector AES. AVX(512) versions requires additional checks. + VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits. + VMPL // AMD VM Permission Levels supported + VMSA_REGPROT // AMD VMSA Register Protection supported + VMX // Virtual Machine Extensions + VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. + VTE // AMD Virtual Transparent Encryption supported + WAITPKG // TPAUSE, UMONITOR, UMWAIT + WBNOINVD // Write Back and Do Not Invalidate Cache + WRMSRNS // Non-Serializing Write to Model Specific Register + X87 // FPU + XGETBV1 // Supports XGETBV with ECX = 1 + XOP // Bulldozer XOP functions + XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV + XSAVEC // Supports XSAVEC and the compacted form of XRSTOR. + XSAVEOPT // XSAVEOPT available + XSAVES // Supports XSAVES/XRSTORS and IA32_XSS // ARM features: AESARM // AES instructions @@ -309,10 +314,11 @@ type CPUInfo struct { L2 int // L2 Cache (per core or shared). Will be -1 if undetected L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected } - SGX SGXSupport - AVX10Level uint8 - maxFunc uint32 - maxExFunc uint32 + SGX SGXSupport + AMDMemEncryption AMDMemEncryptionSupport + AVX10Level uint8 + maxFunc uint32 + maxExFunc uint32 } var cpuid func(op uint32) (eax, ebx, ecx, edx uint32) @@ -1079,6 +1085,32 @@ func hasSGX(available, lc bool) (rval SGXSupport) { return } +type AMDMemEncryptionSupport struct { + Available bool + CBitPossition uint32 + NumVMPL uint32 + PhysAddrReduction uint32 + NumEntryptedGuests uint32 + MinSevNoEsAsid uint32 +} + +func hasAMDMemEncryption(available bool) (rval AMDMemEncryptionSupport) { + rval.Available = available + if !available { + return + } + + _, b, c, d := cpuidex(0x8000001f, 0) + + rval.CBitPossition = b & 0x3f + rval.PhysAddrReduction = (b >> 6) & 0x3F + rval.NumVMPL = (b >> 12) & 0xf + rval.NumEntryptedGuests = c + rval.MinSevNoEsAsid = d + + return +} + func support() flagSet { var fs flagSet mfi := maxFunctionID() @@ -1418,6 +1450,15 @@ func support() flagSet { fs.setIf((a>>24)&1 == 1, VMSA_REGPROT) } + if maxExtendedFunction() >= 0x80000021 && vend == AMD { + a, _, _, _ := cpuid(0x80000021) + fs.setIf((a>>31)&1 == 1, SRSO_MSR_FIX) + fs.setIf((a>>30)&1 == 1, SRSO_USER_KERNEL_NO) + fs.setIf((a>>29)&1 == 1, SRSO_NO) + fs.setIf((a>>28)&1 == 1, IBPB_BRTYPE) + fs.setIf((a>>27)&1 == 1, SBPB) + } + if mfi >= 0x20 { // Microsoft has decided to purposefully hide the information // of the guest TEE when VMs are being created using Hyper-V. diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go index c7dfa125d..799b400c2 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -27,6 +27,7 @@ func addInfo(c *CPUInfo, safe bool) { c.Family, c.Model, c.Stepping = familyModel() c.featureSet = support() c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC)) + c.AMDMemEncryption = hasAMDMemEncryption(c.featureSet.inSet(SME) || c.featureSet.inSet(SEV)) c.ThreadsPerCore = threadsPerCore() c.LogicalCores = logicalCores() c.PhysicalCores = physicalCores() diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go index 43bd05f51..57a085a53 100644 --- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -81,152 +81,157 @@ func _() { _ = x[IA32_ARCH_CAP-71] _ = x[IA32_CORE_CAP-72] _ = x[IBPB-73] - _ = x[IBRS-74] - _ = x[IBRS_PREFERRED-75] - _ = x[IBRS_PROVIDES_SMP-76] - _ = x[IBS-77] - _ = x[IBSBRNTRGT-78] - _ = x[IBSFETCHSAM-79] - _ = x[IBSFFV-80] - _ = x[IBSOPCNT-81] - _ = x[IBSOPCNTEXT-82] - _ = x[IBSOPSAM-83] - _ = x[IBSRDWROPCNT-84] - _ = x[IBSRIPINVALIDCHK-85] - _ = x[IBS_FETCH_CTLX-86] - _ = x[IBS_OPDATA4-87] - _ = x[IBS_OPFUSE-88] - _ = x[IBS_PREVENTHOST-89] - _ = x[IBS_ZEN4-90] - _ = x[IDPRED_CTRL-91] - _ = x[INT_WBINVD-92] - _ = x[INVLPGB-93] - _ = x[KEYLOCKER-94] - _ = x[KEYLOCKERW-95] - _ = x[LAHF-96] - _ = x[LAM-97] - _ = x[LBRVIRT-98] - _ = x[LZCNT-99] - _ = x[MCAOVERFLOW-100] - _ = x[MCDT_NO-101] - _ = x[MCOMMIT-102] - _ = x[MD_CLEAR-103] - _ = x[MMX-104] - _ = x[MMXEXT-105] - _ = x[MOVBE-106] - _ = x[MOVDIR64B-107] - _ = x[MOVDIRI-108] - _ = x[MOVSB_ZL-109] - _ = x[MOVU-110] - _ = x[MPX-111] - _ = x[MSRIRC-112] - _ = x[MSRLIST-113] - _ = x[MSR_PAGEFLUSH-114] - _ = x[NRIPS-115] - _ = x[NX-116] - _ = x[OSXSAVE-117] - _ = x[PCONFIG-118] - _ = x[POPCNT-119] - _ = x[PPIN-120] - _ = x[PREFETCHI-121] - _ = x[PSFD-122] - _ = x[RDPRU-123] - _ = x[RDRAND-124] - _ = x[RDSEED-125] - _ = x[RDTSCP-126] - _ = x[RRSBA_CTRL-127] - _ = x[RTM-128] - _ = x[RTM_ALWAYS_ABORT-129] - _ = x[SERIALIZE-130] - _ = x[SEV-131] - _ = x[SEV_64BIT-132] - _ = x[SEV_ALTERNATIVE-133] - _ = x[SEV_DEBUGSWAP-134] - _ = x[SEV_ES-135] - _ = x[SEV_RESTRICTED-136] - _ = x[SEV_SNP-137] - _ = x[SGX-138] - _ = x[SGXLC-139] - _ = x[SHA-140] - _ = x[SME-141] - _ = x[SME_COHERENT-142] - _ = x[SPEC_CTRL_SSBD-143] - _ = x[SRBDS_CTRL-144] - _ = x[SSE-145] - _ = x[SSE2-146] - _ = x[SSE3-147] - _ = x[SSE4-148] - _ = x[SSE42-149] - _ = x[SSE4A-150] - _ = x[SSSE3-151] - _ = x[STIBP-152] - _ = x[STIBP_ALWAYSON-153] - _ = x[STOSB_SHORT-154] - _ = x[SUCCOR-155] - _ = x[SVM-156] - _ = x[SVMDA-157] - _ = x[SVMFBASID-158] - _ = x[SVML-159] - _ = x[SVMNP-160] - _ = x[SVMPF-161] - _ = x[SVMPFT-162] - _ = x[SYSCALL-163] - _ = x[SYSEE-164] - _ = x[TBM-165] - _ = x[TDX_GUEST-166] - _ = x[TLB_FLUSH_NESTED-167] - _ = x[TME-168] - _ = x[TOPEXT-169] - _ = x[TSCRATEMSR-170] - _ = x[TSXLDTRK-171] - _ = x[VAES-172] - _ = x[VMCBCLEAN-173] - _ = x[VMPL-174] - _ = x[VMSA_REGPROT-175] - _ = x[VMX-176] - _ = x[VPCLMULQDQ-177] - _ = x[VTE-178] - _ = x[WAITPKG-179] - _ = x[WBNOINVD-180] - _ = x[WRMSRNS-181] - _ = x[X87-182] - _ = x[XGETBV1-183] - _ = x[XOP-184] - _ = x[XSAVE-185] - _ = x[XSAVEC-186] - _ = x[XSAVEOPT-187] - _ = x[XSAVES-188] - _ = x[AESARM-189] - _ = x[ARMCPUID-190] - _ = x[ASIMD-191] - _ = x[ASIMDDP-192] - _ = x[ASIMDHP-193] - _ = x[ASIMDRDM-194] - _ = x[ATOMICS-195] - _ = x[CRC32-196] - _ = x[DCPOP-197] - _ = x[EVTSTRM-198] - _ = x[FCMA-199] - _ = x[FP-200] - _ = x[FPHP-201] - _ = x[GPA-202] - _ = x[JSCVT-203] - _ = x[LRCPC-204] - _ = x[PMULL-205] - _ = x[SHA1-206] - _ = x[SHA2-207] - _ = x[SHA3-208] - _ = x[SHA512-209] - _ = x[SM3-210] - _ = x[SM4-211] - _ = x[SVE-212] - _ = x[lastID-213] + _ = x[IBPB_BRTYPE-74] + _ = x[IBRS-75] + _ = x[IBRS_PREFERRED-76] + _ = x[IBRS_PROVIDES_SMP-77] + _ = x[IBS-78] + _ = x[IBSBRNTRGT-79] + _ = x[IBSFETCHSAM-80] + _ = x[IBSFFV-81] + _ = x[IBSOPCNT-82] + _ = x[IBSOPCNTEXT-83] + _ = x[IBSOPSAM-84] + _ = x[IBSRDWROPCNT-85] + _ = x[IBSRIPINVALIDCHK-86] + _ = x[IBS_FETCH_CTLX-87] + _ = x[IBS_OPDATA4-88] + _ = x[IBS_OPFUSE-89] + _ = x[IBS_PREVENTHOST-90] + _ = x[IBS_ZEN4-91] + _ = x[IDPRED_CTRL-92] + _ = x[INT_WBINVD-93] + _ = x[INVLPGB-94] + _ = x[KEYLOCKER-95] + _ = x[KEYLOCKERW-96] + _ = x[LAHF-97] + _ = x[LAM-98] + _ = x[LBRVIRT-99] + _ = x[LZCNT-100] + _ = x[MCAOVERFLOW-101] + _ = x[MCDT_NO-102] + _ = x[MCOMMIT-103] + _ = x[MD_CLEAR-104] + _ = x[MMX-105] + _ = x[MMXEXT-106] + _ = x[MOVBE-107] + _ = x[MOVDIR64B-108] + _ = x[MOVDIRI-109] + _ = x[MOVSB_ZL-110] + _ = x[MOVU-111] + _ = x[MPX-112] + _ = x[MSRIRC-113] + _ = x[MSRLIST-114] + _ = x[MSR_PAGEFLUSH-115] + _ = x[NRIPS-116] + _ = x[NX-117] + _ = x[OSXSAVE-118] + _ = x[PCONFIG-119] + _ = x[POPCNT-120] + _ = x[PPIN-121] + _ = x[PREFETCHI-122] + _ = x[PSFD-123] + _ = x[RDPRU-124] + _ = x[RDRAND-125] + _ = x[RDSEED-126] + _ = x[RDTSCP-127] + _ = x[RRSBA_CTRL-128] + _ = x[RTM-129] + _ = x[RTM_ALWAYS_ABORT-130] + _ = x[SBPB-131] + _ = x[SERIALIZE-132] + _ = x[SEV-133] + _ = x[SEV_64BIT-134] + _ = x[SEV_ALTERNATIVE-135] + _ = x[SEV_DEBUGSWAP-136] + _ = x[SEV_ES-137] + _ = x[SEV_RESTRICTED-138] + _ = x[SEV_SNP-139] + _ = x[SGX-140] + _ = x[SGXLC-141] + _ = x[SHA-142] + _ = x[SME-143] + _ = x[SME_COHERENT-144] + _ = x[SPEC_CTRL_SSBD-145] + _ = x[SRBDS_CTRL-146] + _ = x[SRSO_MSR_FIX-147] + _ = x[SRSO_NO-148] + _ = x[SRSO_USER_KERNEL_NO-149] + _ = x[SSE-150] + _ = x[SSE2-151] + _ = x[SSE3-152] + _ = x[SSE4-153] + _ = x[SSE42-154] + _ = x[SSE4A-155] + _ = x[SSSE3-156] + _ = x[STIBP-157] + _ = x[STIBP_ALWAYSON-158] + _ = x[STOSB_SHORT-159] + _ = x[SUCCOR-160] + _ = x[SVM-161] + _ = x[SVMDA-162] + _ = x[SVMFBASID-163] + _ = x[SVML-164] + _ = x[SVMNP-165] + _ = x[SVMPF-166] + _ = x[SVMPFT-167] + _ = x[SYSCALL-168] + _ = x[SYSEE-169] + _ = x[TBM-170] + _ = x[TDX_GUEST-171] + _ = x[TLB_FLUSH_NESTED-172] + _ = x[TME-173] + _ = x[TOPEXT-174] + _ = x[TSCRATEMSR-175] + _ = x[TSXLDTRK-176] + _ = x[VAES-177] + _ = x[VMCBCLEAN-178] + _ = x[VMPL-179] + _ = x[VMSA_REGPROT-180] + _ = x[VMX-181] + _ = x[VPCLMULQDQ-182] + _ = x[VTE-183] + _ = x[WAITPKG-184] + _ = x[WBNOINVD-185] + _ = x[WRMSRNS-186] + _ = x[X87-187] + _ = x[XGETBV1-188] + _ = x[XOP-189] + _ = x[XSAVE-190] + _ = x[XSAVEC-191] + _ = x[XSAVEOPT-192] + _ = x[XSAVES-193] + _ = x[AESARM-194] + _ = x[ARMCPUID-195] + _ = x[ASIMD-196] + _ = x[ASIMDDP-197] + _ = x[ASIMDHP-198] + _ = x[ASIMDRDM-199] + _ = x[ATOMICS-200] + _ = x[CRC32-201] + _ = x[DCPOP-202] + _ = x[EVTSTRM-203] + _ = x[FCMA-204] + _ = x[FP-205] + _ = x[FPHP-206] + _ = x[GPA-207] + _ = x[JSCVT-208] + _ = x[LRCPC-209] + _ = x[PMULL-210] + _ = x[SHA1-211] + _ = x[SHA2-212] + _ = x[SHA3-213] + _ = x[SHA512-214] + _ = x[SM3-215] + _ = x[SM4-216] + _ = x[SVE-217] + _ = x[lastID-218] _ = x[firstID-0] } -const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" -var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 319, 323, 327, 333, 338, 346, 351, 357, 361, 370, 388, 396, 403, 407, 411, 425, 431, 435, 439, 448, 452, 456, 461, 466, 470, 474, 481, 485, 488, 494, 497, 500, 510, 520, 533, 546, 550, 554, 568, 585, 588, 598, 609, 615, 623, 634, 642, 654, 670, 684, 695, 705, 720, 728, 739, 749, 756, 765, 775, 779, 782, 789, 794, 805, 812, 819, 827, 830, 836, 841, 850, 857, 865, 869, 872, 878, 885, 898, 903, 905, 912, 919, 925, 929, 938, 942, 947, 953, 959, 965, 975, 978, 994, 1003, 1006, 1015, 1030, 1043, 1049, 1063, 1070, 1073, 1078, 1081, 1084, 1096, 1110, 1120, 1123, 1127, 1131, 1135, 1140, 1145, 1150, 1155, 1169, 1180, 1186, 1189, 1194, 1203, 1207, 1212, 1217, 1223, 1230, 1235, 1238, 1247, 1263, 1266, 1272, 1282, 1290, 1294, 1303, 1307, 1319, 1322, 1332, 1335, 1342, 1350, 1357, 1360, 1367, 1370, 1375, 1381, 1389, 1395, 1401, 1409, 1414, 1421, 1428, 1436, 1443, 1448, 1453, 1460, 1464, 1466, 1470, 1473, 1478, 1483, 1488, 1492, 1496, 1500, 1506, 1509, 1512, 1515, 1521} +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 319, 323, 327, 333, 338, 346, 351, 357, 361, 370, 388, 396, 403, 407, 411, 425, 431, 435, 439, 448, 452, 456, 461, 466, 470, 474, 481, 485, 488, 494, 497, 500, 510, 520, 533, 546, 550, 561, 565, 579, 596, 599, 609, 620, 626, 634, 645, 653, 665, 681, 695, 706, 716, 731, 739, 750, 760, 767, 776, 786, 790, 793, 800, 805, 816, 823, 830, 838, 841, 847, 852, 861, 868, 876, 880, 883, 889, 896, 909, 914, 916, 923, 930, 936, 940, 949, 953, 958, 964, 970, 976, 986, 989, 1005, 1009, 1018, 1021, 1030, 1045, 1058, 1064, 1078, 1085, 1088, 1093, 1096, 1099, 1111, 1125, 1135, 1147, 1154, 1173, 1176, 1180, 1184, 1188, 1193, 1198, 1203, 1208, 1222, 1233, 1239, 1242, 1247, 1256, 1260, 1265, 1270, 1276, 1283, 1288, 1291, 1300, 1316, 1319, 1325, 1335, 1343, 1347, 1356, 1360, 1372, 1375, 1385, 1388, 1395, 1403, 1410, 1413, 1420, 1423, 1428, 1434, 1442, 1448, 1454, 1462, 1467, 1474, 1481, 1489, 1496, 1501, 1506, 1513, 1517, 1519, 1523, 1526, 1531, 1536, 1541, 1545, 1549, 1553, 1559, 1562, 1565, 1568, 1574} func (i FeatureID) String() string { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { diff --git a/vendor/github.com/leodido/go-urn/.gitignore b/vendor/github.com/leodido/go-urn/.gitignore index 89d4bc55d..427454f8f 100644 --- a/vendor/github.com/leodido/go-urn/.gitignore +++ b/vendor/github.com/leodido/go-urn/.gitignore @@ -9,4 +9,5 @@ *.txt vendor/ -/removecomments \ No newline at end of file +/removecomments +/snake2camel \ No newline at end of file diff --git a/vendor/github.com/leodido/go-urn/README.md b/vendor/github.com/leodido/go-urn/README.md index 731eecbb5..619475bfb 100644 --- a/vendor/github.com/leodido/go-urn/README.md +++ b/vendor/github.com/leodido/go-urn/README.md @@ -2,21 +2,34 @@ **A parser for URNs**. -> As seen on [RFC 2141](https://tools.ietf.org/html/rfc2141#ref-1). +> As seen on [RFC 2141](https://datatracker.ietf.org/doc/html/rfc2141), [RFC 7643](https://datatracker.ietf.org/doc/html/rfc7643#section-10), and on [RFC 8141](https://datatracker.ietf.org/doc/html/rfc8141). [API documentation](https://godoc.org/github.com/leodido/go-urn). +Starting with version 1.3 this library also supports [RFC 7643 SCIM URNs](https://datatracker.ietf.org/doc/html/rfc7643#section-10). + +Starting with version 1.4 this library also supports [RFC 8141 URNs (2017)](https://datatracker.ietf.org/doc/html/rfc8141). + ## Installation ``` go get github.com/leodido/go-urn ``` +## Features + +1. RFC 2141 URNs parsing (default) +2. RFC 8141 URNs parsing (supersedes RFC 2141) +3. RFC 7643 SCIM URNs parsing +4. Normalization as per RFCs +5. Lexical equivalence as per RFCs +6. Precise, fine-grained errors + ## Performances This implementation results to be really fast. -Usually below ½ microsecond on my machine[1](#mymachine). +Usually below 400 ns on my machine[1](#mymachine). Notice it also performs, while parsing: @@ -24,35 +37,64 @@ Notice it also performs, while parsing: 2. specific-string normalization ``` -ok/00/urn:a:b______________________________________/-4 20000000 265 ns/op 182 B/op 6 allocs/op -ok/01/URN:foo:a123,456_____________________________/-4 30000000 296 ns/op 200 B/op 6 allocs/op -ok/02/urn:foo:a123%2c456___________________________/-4 20000000 331 ns/op 208 B/op 6 allocs/op -ok/03/urn:ietf:params:scim:schemas:core:2.0:User___/-4 20000000 430 ns/op 280 B/op 6 allocs/op -ok/04/urn:ietf:params:scim:schemas:extension:enterp/-4 20000000 411 ns/op 312 B/op 6 allocs/op -ok/05/urn:ietf:params:scim:schemas:extension:enterp/-4 20000000 472 ns/op 344 B/op 6 allocs/op -ok/06/urn:burnout:nss______________________________/-4 30000000 257 ns/op 192 B/op 6 allocs/op -ok/07/urn:abcdefghilmnopqrstuvzabcdefghilm:x_______/-4 20000000 375 ns/op 213 B/op 6 allocs/op -ok/08/urn:urnurnurn:urn____________________________/-4 30000000 265 ns/op 197 B/op 6 allocs/op -ok/09/urn:ciao:@!=%2c(xyz)+a,b.*@g=$_'_____________/-4 20000000 307 ns/op 248 B/op 6 allocs/op -ok/10/URN:x:abc%1dz%2f%3az_________________________/-4 30000000 259 ns/op 212 B/op 6 allocs/op -no/11/URN:-xxx:x___________________________________/-4 20000000 445 ns/op 320 B/op 6 allocs/op -no/12/urn::colon:nss_______________________________/-4 20000000 461 ns/op 320 B/op 6 allocs/op -no/13/urn:abcdefghilmnopqrstuvzabcdefghilmn:specifi/-4 10000000 660 ns/op 320 B/op 6 allocs/op -no/14/URN:a!?:x____________________________________/-4 20000000 507 ns/op 320 B/op 6 allocs/op -no/15/urn:urn:NSS__________________________________/-4 20000000 429 ns/op 288 B/op 6 allocs/op -no/16/urn:white_space:NSS__________________________/-4 20000000 482 ns/op 320 B/op 6 allocs/op -no/17/urn:concat:no_spaces_________________________/-4 20000000 539 ns/op 328 B/op 7 allocs/op -no/18/urn:a:/______________________________________/-4 20000000 470 ns/op 320 B/op 7 allocs/op -no/19/urn:UrN:NSS__________________________________/-4 20000000 399 ns/op 288 B/op 6 allocs/op +ok/00/urn:a:b______________________________________/-10 51372006 109.0 ns/op 275 B/op 3 allocs/op +ok/01/URN:foo:a123,456_____________________________/-10 36024072 160.8 ns/op 296 B/op 6 allocs/op +ok/02/urn:foo:a123%2C456___________________________/-10 31901007 188.4 ns/op 320 B/op 7 allocs/op +ok/03/urn:ietf:params:scim:schemas:core:2.0:User___/-10 22736756 266.6 ns/op 376 B/op 6 allocs/op +ok/04/urn:ietf:params:scim:schemas:extension:enterp/-10 18291859 335.2 ns/op 408 B/op 6 allocs/op +ok/05/urn:ietf:params:scim:schemas:extension:enterp/-10 15283087 379.4 ns/op 440 B/op 6 allocs/op +ok/06/urn:burnout:nss______________________________/-10 39407593 155.1 ns/op 288 B/op 6 allocs/op +ok/07/urn:abcdefghilmnopqrstuvzabcdefghilm:x_______/-10 27832718 211.4 ns/op 307 B/op 4 allocs/op +ok/08/urn:urnurnurn:urn____________________________/-10 33269596 168.1 ns/op 293 B/op 6 allocs/op +ok/09/urn:ciao:!!*_________________________________/-10 41100675 148.8 ns/op 288 B/op 6 allocs/op +ok/10/urn:ciao:=@__________________________________/-10 37214253 149.7 ns/op 284 B/op 6 allocs/op +ok/11/urn:ciao:@!=%2C(xyz)+a,b.*@g=$_'_____________/-10 26534240 229.8 ns/op 336 B/op 7 allocs/op +ok/12/URN:x:abc%1Dz%2F%3az_________________________/-10 28166396 211.8 ns/op 336 B/op 7 allocs/op +no/13/URN:---xxx:x_________________________________/-10 23635159 255.6 ns/op 419 B/op 5 allocs/op +no/14/urn::colon:nss_______________________________/-10 23594779 258.4 ns/op 419 B/op 5 allocs/op +no/15/URN:@,:x_____________________________________/-10 23742535 261.5 ns/op 419 B/op 5 allocs/op +no/16/URN:URN:NSS__________________________________/-10 27432714 223.3 ns/op 371 B/op 5 allocs/op +no/17/urn:UrN:NSS__________________________________/-10 26922117 224.9 ns/op 371 B/op 5 allocs/op +no/18/urn:a:%______________________________________/-10 24926733 224.6 ns/op 371 B/op 5 allocs/op +no/19/urn:urn:NSS__________________________________/-10 27652641 220.7 ns/op 371 B/op 5 allocs/op ``` ---- - -* [1]: Intel Core i7-7600U CPU @ 2.80GHz +* [1]: Apple M1 Pro ---- ## Example + +For more examples take a look at the [examples file](examples_test.go). + + +```go +package main + +import ( + "fmt" + "github.com/leodido/go-urn" +) + +func main() { + var uid = "URN:foo:a123,456" + + // Parse the input string as a RFC 2141 URN only + u, e := urn.NewMachine().Parse(uid) + if e != nil { + fmt.Errorf(err) + + return + } + + fmt.Println(u.ID) + fmt.Println(u.SS) + + // Output: + // foo + // a123,456 +} +``` + ```go package main @@ -64,6 +106,7 @@ import ( func main() { var uid = "URN:foo:a123,456" + // Parse the input string as a RFC 2141 URN only u, ok := urn.Parse([]byte(uid)) if !ok { panic("error parsing urn") @@ -78,4 +121,33 @@ func main() { } ``` -[![Analytics](https://ga-beacon.appspot.com/UA-49657176-1/go-urn?flat)](https://github.com/igrigorik/ga-beacon) \ No newline at end of file +```go +package main + +import ( + "fmt" + "github.com/leodido/go-urn" +) + +func main() { + input := "urn:ietf:params:scim:api:messages:2.0:ListResponse" + + // Parsing the input string as a RFC 7643 SCIM URN + u, ok := urn.Parse([]byte(input), urn.WithParsingMode(urn.RFC7643Only)) + if !ok { + panic("error parsing urn") + } + + fmt.Println(u.IsSCIM()) + scim := u.SCIM() + fmt.Println(scim.Type.String()) + fmt.Println(scim.Name) + fmt.Println(scim.Other) + + // Output: + // true + // api + // messages + // 2.0:ListResponse +} +``` \ No newline at end of file diff --git a/vendor/github.com/leodido/go-urn/kind.go b/vendor/github.com/leodido/go-urn/kind.go new file mode 100644 index 000000000..f5e140f0a --- /dev/null +++ b/vendor/github.com/leodido/go-urn/kind.go @@ -0,0 +1,10 @@ +package urn + +type Kind int + +const ( + NONE Kind = iota + RFC2141 + RFC7643 + RFC8141 +) diff --git a/vendor/github.com/leodido/go-urn/machine.go b/vendor/github.com/leodido/go-urn/machine.go index f8d57b412..aec1ba69c 100644 --- a/vendor/github.com/leodido/go-urn/machine.go +++ b/vendor/github.com/leodido/go-urn/machine.go @@ -2,27 +2,98 @@ package urn import ( "fmt" + + scimschema "github.com/leodido/go-urn/scim/schema" ) var ( - errPrefix = "expecting the prefix to be the \"urn\" string (whatever case) [col %d]" - errIdentifier = "expecting the identifier to be string (1..31 alnum chars, also containing dashes but not at its start) [col %d]" - errSpecificString = "expecting the specific string to be a string containing alnum, hex, or others ([()+,-.:=@;$_!*']) chars [col %d]" - errNoUrnWithinID = "expecting the identifier to not contain the \"urn\" reserved string [col %d]" - errHex = "expecting the specific string hex chars to be well-formed (%%alnum{2}) [col %d]" - errParse = "parsing error [col %d]" + errPrefix = "expecting the prefix to be the \"urn\" string (whatever case) [col %d]" + errIdentifier = "expecting the identifier to be string (1..31 alnum chars, also containing dashes but not at its beginning) [col %d]" + errSpecificString = "expecting the specific string to be a string containing alnum, hex, or others ([()+,-.:=@;$_!*']) chars [col %d]" + errNoUrnWithinID = "expecting the identifier to not contain the \"urn\" reserved string [col %d]" + errHex = "expecting the percent encoded chars to be well-formed (%%alnum{2}) [col %d]" + errSCIMNamespace = "expecing the SCIM namespace identifier (ietf:params:scim) [col %d]" + errSCIMType = "expecting a correct SCIM type (schemas, api, param) [col %d]" + errSCIMName = "expecting one or more alnum char in the SCIM name part [col %d]" + errSCIMOther = "expecting a well-formed other SCIM part [col %d]" + errSCIMOtherIncomplete = "expecting a not empty SCIM other part after colon [col %d]" + err8141InformalID = "informal URN namespace must be in the form urn-[1-9][0-9] [col %d]" + err8141SpecificString = "expecting the specific string to contain alnum, hex, or others ([~&()+,-.:=@;$_!*'] or [/?] not in first position) chars [col %d]" + err8141Identifier = "expecting the indentifier to be a string with (length 2 to 32 chars) containing alnum (or dashes) not starting or ending with a dash [col %d]" + err8141RComponentStart = "expecting only one r-component (starting with the ?+ sequence) [col %d]" + err8141QComponentStart = "expecting only one q-component (starting with the ?= sequence) [col %d]" + err8141MalformedRComp = "expecting a non-empty r-component containing alnum, hex, or others ([~&()+,-.:=@;$_!*'] or [/?] but not at its beginning) [col %d]" + err8141MalformedQComp = "expecting a non-empty q-component containing alnum, hex, or others ([~&()+,-.:=@;$_!*'] or [/?] but not at its beginning) [col %d]" ) +var _toStateActions []byte = []byte{ + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 33, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, +} + +var _eofActions []byte = []byte{ + 0, 1, 1, 1, 1, 4, 6, 6, + 6, 6, 6, 6, 6, 6, 6, 6, + 6, 6, 6, 6, 6, 6, 6, 6, + 6, 6, 6, 6, 6, 6, 6, 6, + 6, 6, 6, 6, 6, 6, 8, 9, + 9, 4, 4, 11, 1, 1, 1, 1, + 12, 12, 12, 12, 12, 12, 12, 12, + 12, 12, 12, 12, 12, 12, 12, 12, + 12, 14, 14, 14, 14, 16, 18, 20, + 20, 14, 14, 14, 14, 14, 14, 14, + 14, 14, 14, 1, 1, 1, 1, 21, + 22, 22, 22, 22, 22, 22, 22, 22, + 22, 22, 22, 22, 22, 22, 22, 22, + 22, 22, 22, 22, 22, 22, 22, 22, + 22, 22, 22, 22, 22, 22, 22, 22, + 23, 24, 24, 25, 25, 0, 26, 28, + 28, 29, 29, 30, 30, 26, 26, 31, + 31, 22, 22, 22, 22, 22, 22, 22, + 22, 22, 22, 22, 22, 22, 22, 22, + 22, 22, 22, 22, 22, 22, 22, 22, + 22, 22, 22, 22, 22, 22, 22, 21, + 21, 22, 22, 22, 34, 34, 35, 37, + 37, 38, 40, 41, 41, 38, 42, 42, + 42, 44, 42, 48, 48, 48, 50, 44, + 50, 0, +} const start int = 1 -const firstFinal int = 44 +const firstFinal int = 172 -const enFail int = 46 +const enScimOnly int = 44 +const enRfc8141Only int = 83 +const enFail int = 193 const enMain int = 1 // Machine is the interface representing the FSM type Machine interface { Error() error Parse(input []byte) (*URN, error) + WithParsingMode(ParsingMode) } type machine struct { @@ -30,12 +101,24 @@ type machine struct { cs int p, pe, eof, pb int err error - tolower []int + startParsingAt int + parsingMode ParsingMode + parsingModeSet bool } // NewMachine creates a new FSM able to parse RFC 2141 strings. -func NewMachine() Machine { - m := &machine{} +func NewMachine(options ...Option) Machine { + m := &machine{ + parsingModeSet: false, + } + + for _, o := range options { + o(m) + } + // Set default parsing mode + if !m.parsingModeSet { + m.WithParsingMode(DefaultParsingMode) + } return m } @@ -51,7 +134,7 @@ func (m *machine) text() []byte { return m.data[m.pb:m.p] } -// Parse parses the input byte array as a RFC 2141 string. +// Parse parses the input byte array as a RFC 2141 or RFC7643 string. func (m *machine) Parse(input []byte) (*URN, error) { m.data = input m.p = 0 @@ -59,1619 +142,4881 @@ func (m *machine) Parse(input []byte) (*URN, error) { m.pe = len(input) m.eof = len(input) m.err = nil - m.tolower = []int{} - output := &URN{} - { - m.cs = start + m.cs = m.startParsingAt + output := &URN{ + tolower: []int{}, } { if (m.p) == (m.pe) { goto _testEof } + if m.cs == 0 { + goto _out + } + _resume: switch m.cs { case 1: - goto stCase1 + switch (m.data)[(m.p)] { + case 85: + goto tr1 + case 117: + goto tr1 + } + goto tr0 case 0: - goto stCase0 + goto _out case 2: - goto stCase2 + switch (m.data)[(m.p)] { + case 82: + goto tr2 + case 114: + goto tr2 + } + goto tr0 case 3: - goto stCase3 + switch (m.data)[(m.p)] { + case 78: + goto tr3 + case 110: + goto tr3 + } + goto tr0 case 4: - goto stCase4 + if (m.data)[(m.p)] == 58 { + goto tr4 + } + goto tr0 case 5: - goto stCase5 + switch (m.data)[(m.p)] { + case 85: + goto tr7 + case 117: + goto tr7 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr6 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr6 + } + default: + goto tr6 + } + goto tr5 case 6: - goto stCase6 + switch (m.data)[(m.p)] { + case 45: + goto tr9 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr9 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr9 + } + default: + goto tr9 + } + goto tr8 case 7: - goto stCase7 + switch (m.data)[(m.p)] { + case 45: + goto tr11 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr11 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr11 + } + default: + goto tr11 + } + goto tr8 case 8: - goto stCase8 + switch (m.data)[(m.p)] { + case 45: + goto tr12 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr12 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr12 + } + default: + goto tr12 + } + goto tr8 case 9: - goto stCase9 + switch (m.data)[(m.p)] { + case 45: + goto tr13 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr13 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr13 + } + default: + goto tr13 + } + goto tr8 case 10: - goto stCase10 + switch (m.data)[(m.p)] { + case 45: + goto tr14 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr14 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr14 + } + default: + goto tr14 + } + goto tr8 case 11: - goto stCase11 + switch (m.data)[(m.p)] { + case 45: + goto tr15 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr15 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr15 + } + default: + goto tr15 + } + goto tr8 case 12: - goto stCase12 + switch (m.data)[(m.p)] { + case 45: + goto tr16 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr16 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr16 + } + default: + goto tr16 + } + goto tr8 case 13: - goto stCase13 + switch (m.data)[(m.p)] { + case 45: + goto tr17 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr17 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr17 + } + default: + goto tr17 + } + goto tr8 case 14: - goto stCase14 + switch (m.data)[(m.p)] { + case 45: + goto tr18 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr18 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr18 + } + default: + goto tr18 + } + goto tr8 case 15: - goto stCase15 + switch (m.data)[(m.p)] { + case 45: + goto tr19 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr19 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr19 + } + default: + goto tr19 + } + goto tr8 case 16: - goto stCase16 + switch (m.data)[(m.p)] { + case 45: + goto tr20 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr20 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr20 + } + default: + goto tr20 + } + goto tr8 case 17: - goto stCase17 + switch (m.data)[(m.p)] { + case 45: + goto tr21 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr21 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr21 + } + default: + goto tr21 + } + goto tr8 case 18: - goto stCase18 + switch (m.data)[(m.p)] { + case 45: + goto tr22 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr22 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr22 + } + default: + goto tr22 + } + goto tr8 case 19: - goto stCase19 + switch (m.data)[(m.p)] { + case 45: + goto tr23 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr23 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr23 + } + default: + goto tr23 + } + goto tr8 case 20: - goto stCase20 + switch (m.data)[(m.p)] { + case 45: + goto tr24 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr24 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr24 + } + default: + goto tr24 + } + goto tr8 case 21: - goto stCase21 + switch (m.data)[(m.p)] { + case 45: + goto tr25 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr25 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr25 + } + default: + goto tr25 + } + goto tr8 case 22: - goto stCase22 + switch (m.data)[(m.p)] { + case 45: + goto tr26 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr26 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr26 + } + default: + goto tr26 + } + goto tr8 case 23: - goto stCase23 + switch (m.data)[(m.p)] { + case 45: + goto tr27 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr27 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr27 + } + default: + goto tr27 + } + goto tr8 case 24: - goto stCase24 + switch (m.data)[(m.p)] { + case 45: + goto tr28 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr28 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr28 + } + default: + goto tr28 + } + goto tr8 case 25: - goto stCase25 + switch (m.data)[(m.p)] { + case 45: + goto tr29 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr29 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr29 + } + default: + goto tr29 + } + goto tr8 case 26: - goto stCase26 + switch (m.data)[(m.p)] { + case 45: + goto tr30 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr30 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr30 + } + default: + goto tr30 + } + goto tr8 case 27: - goto stCase27 + switch (m.data)[(m.p)] { + case 45: + goto tr31 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr31 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr31 + } + default: + goto tr31 + } + goto tr8 case 28: - goto stCase28 + switch (m.data)[(m.p)] { + case 45: + goto tr32 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr32 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr32 + } + default: + goto tr32 + } + goto tr8 case 29: - goto stCase29 + switch (m.data)[(m.p)] { + case 45: + goto tr33 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr33 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr33 + } + default: + goto tr33 + } + goto tr8 case 30: - goto stCase30 + switch (m.data)[(m.p)] { + case 45: + goto tr34 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr34 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr34 + } + default: + goto tr34 + } + goto tr8 case 31: - goto stCase31 + switch (m.data)[(m.p)] { + case 45: + goto tr35 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr35 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr35 + } + default: + goto tr35 + } + goto tr8 case 32: - goto stCase32 + switch (m.data)[(m.p)] { + case 45: + goto tr36 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr36 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr36 + } + default: + goto tr36 + } + goto tr8 case 33: - goto stCase33 + switch (m.data)[(m.p)] { + case 45: + goto tr37 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr37 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr37 + } + default: + goto tr37 + } + goto tr8 case 34: - goto stCase34 + switch (m.data)[(m.p)] { + case 45: + goto tr38 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr38 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr38 + } + default: + goto tr38 + } + goto tr8 case 35: - goto stCase35 + switch (m.data)[(m.p)] { + case 45: + goto tr39 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr39 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr39 + } + default: + goto tr39 + } + goto tr8 case 36: - goto stCase36 + switch (m.data)[(m.p)] { + case 45: + goto tr40 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr40 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr40 + } + default: + goto tr40 + } + goto tr8 case 37: - goto stCase37 + if (m.data)[(m.p)] == 58 { + goto tr10 + } + goto tr8 case 38: - goto stCase38 - case 44: - goto stCase44 + switch (m.data)[(m.p)] { + case 33: + goto tr42 + case 36: + goto tr42 + case 37: + goto tr43 + case 61: + goto tr42 + case 95: + goto tr42 + } + switch { + case (m.data)[(m.p)] < 48: + if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr42 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr42 + } + case (m.data)[(m.p)] >= 64: + goto tr42 + } + default: + goto tr42 + } + goto tr41 + case 172: + switch (m.data)[(m.p)] { + case 33: + goto tr212 + case 36: + goto tr212 + case 37: + goto tr213 + case 61: + goto tr212 + case 95: + goto tr212 + } + switch { + case (m.data)[(m.p)] < 48: + if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr212 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr212 + } + case (m.data)[(m.p)] >= 64: + goto tr212 + } + default: + goto tr212 + } + goto tr41 case 39: - goto stCase39 + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr45 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr45 + } + default: + goto tr46 + } + goto tr44 case 40: - goto stCase40 - case 45: - goto stCase45 + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr47 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr47 + } + default: + goto tr48 + } + goto tr44 + case 173: + switch (m.data)[(m.p)] { + case 33: + goto tr212 + case 36: + goto tr212 + case 37: + goto tr213 + case 61: + goto tr212 + case 95: + goto tr212 + } + switch { + case (m.data)[(m.p)] < 48: + if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr212 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr212 + } + case (m.data)[(m.p)] >= 64: + goto tr212 + } + default: + goto tr212 + } + goto tr44 case 41: - goto stCase41 - case 42: - goto stCase42 - case 43: - goto stCase43 - case 46: - goto stCase46 - } - goto stOut - stCase1: - switch (m.data)[(m.p)] { - case 85: - goto tr1 - case 117: - goto tr1 - } - goto tr0 - tr0: - - m.err = fmt.Errorf(errParse, m.p) - (m.p)-- - - { - goto st46 - } - - goto st0 - tr3: - - m.err = fmt.Errorf(errPrefix, m.p) - (m.p)-- - - { - goto st46 - } - - m.err = fmt.Errorf(errParse, m.p) - (m.p)-- - - { - goto st46 - } - - goto st0 - tr6: - - m.err = fmt.Errorf(errIdentifier, m.p) - (m.p)-- - - { - goto st46 - } - - m.err = fmt.Errorf(errParse, m.p) - (m.p)-- - - { - goto st46 - } - - goto st0 - tr41: - - m.err = fmt.Errorf(errSpecificString, m.p) - (m.p)-- - - { - goto st46 - } - - m.err = fmt.Errorf(errParse, m.p) - (m.p)-- - - { - goto st46 - } - - goto st0 - tr44: - - m.err = fmt.Errorf(errHex, m.p) - (m.p)-- - - { - goto st46 - } - - m.err = fmt.Errorf(errSpecificString, m.p) - (m.p)-- - - { - goto st46 - } - - m.err = fmt.Errorf(errParse, m.p) - (m.p)-- - - { - goto st46 - } - - goto st0 - tr50: - - m.err = fmt.Errorf(errPrefix, m.p) - (m.p)-- - - { - goto st46 - } - - m.err = fmt.Errorf(errIdentifier, m.p) - (m.p)-- - - { - goto st46 - } - - m.err = fmt.Errorf(errParse, m.p) - (m.p)-- - - { - goto st46 - } - - goto st0 - tr52: - - m.err = fmt.Errorf(errNoUrnWithinID, m.p) - (m.p)-- - - { - goto st46 - } - - m.err = fmt.Errorf(errIdentifier, m.p) - (m.p)-- - - { - goto st46 - } - - m.err = fmt.Errorf(errParse, m.p) - (m.p)-- - - { - goto st46 - } - - goto st0 - stCase0: - st0: - m.cs = 0 - goto _out - tr1: - - m.pb = m.p - - goto st2 - st2: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof2 - } - stCase2: - switch (m.data)[(m.p)] { - case 82: - goto st3 - case 114: - goto st3 - } - goto tr0 - st3: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof3 - } - stCase3: - switch (m.data)[(m.p)] { - case 78: - goto st4 - case 110: - goto st4 - } - goto tr3 - st4: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof4 - } - stCase4: - if (m.data)[(m.p)] == 58 { + switch (m.data)[(m.p)] { + case 45: + goto tr9 + case 58: + goto tr10 + case 82: + goto tr49 + case 114: + goto tr49 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr9 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr9 + } + default: + goto tr9 + } goto tr5 - } - goto tr0 - tr5: - - output.prefix = string(m.text()) - - goto st5 - st5: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof5 - } - stCase5: - switch (m.data)[(m.p)] { - case 85: - goto tr8 - case 117: - goto tr8 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto tr7 + case 42: + switch (m.data)[(m.p)] { + case 45: + goto tr11 + case 58: + goto tr10 + case 78: + goto tr50 + case 110: + goto tr50 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto tr7 + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr11 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr11 + } + default: + goto tr11 } - default: - goto tr7 - } - goto tr6 - tr7: - - m.pb = m.p - - goto st6 - st6: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof6 - } - stCase6: - switch (m.data)[(m.p)] { - case 45: - goto st7 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st7 + goto tr5 + case 43: + if (m.data)[(m.p)] == 45 { + goto tr12 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr12 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr12 + } + default: + goto tr12 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st7 + goto tr51 + case 44: + switch (m.data)[(m.p)] { + case 85: + goto tr52 + case 117: + goto tr52 } - default: - goto st7 - } - goto tr6 - st7: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof7 - } - stCase7: - switch (m.data)[(m.p)] { + goto tr0 case 45: - goto st8 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st8 + switch (m.data)[(m.p)] { + case 82: + goto tr53 + case 114: + goto tr53 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st8 + goto tr0 + case 46: + switch (m.data)[(m.p)] { + case 78: + goto tr54 + case 110: + goto tr54 } - default: - goto st8 - } - goto tr6 - st8: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof8 - } - stCase8: - switch (m.data)[(m.p)] { - case 45: - goto st9 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st9 + goto tr0 + case 47: + if (m.data)[(m.p)] == 58 { + goto tr55 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st9 + goto tr0 + case 48: + if (m.data)[(m.p)] == 105 { + goto tr57 } - default: - goto st9 - } - goto tr6 - st9: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof9 - } - stCase9: - switch (m.data)[(m.p)] { - case 45: - goto st10 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st10 + goto tr56 + case 49: + if (m.data)[(m.p)] == 101 { + goto tr58 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st10 + goto tr56 + case 50: + if (m.data)[(m.p)] == 116 { + goto tr59 } - default: - goto st10 - } - goto tr6 - st10: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof10 - } - stCase10: - switch (m.data)[(m.p)] { - case 45: - goto st11 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st11 + goto tr56 + case 51: + if (m.data)[(m.p)] == 102 { + goto tr60 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st11 + goto tr56 + case 52: + if (m.data)[(m.p)] == 58 { + goto tr61 } - default: - goto st11 - } - goto tr6 - st11: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof11 - } - stCase11: - switch (m.data)[(m.p)] { - case 45: - goto st12 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st12 + goto tr56 + case 53: + if (m.data)[(m.p)] == 112 { + goto tr62 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st12 + goto tr56 + case 54: + if (m.data)[(m.p)] == 97 { + goto tr63 } - default: - goto st12 - } - goto tr6 - st12: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof12 - } - stCase12: - switch (m.data)[(m.p)] { - case 45: - goto st13 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st13 + goto tr56 + case 55: + if (m.data)[(m.p)] == 114 { + goto tr64 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st13 + goto tr56 + case 56: + if (m.data)[(m.p)] == 97 { + goto tr65 } - default: - goto st13 - } - goto tr6 - st13: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof13 - } - stCase13: - switch (m.data)[(m.p)] { - case 45: - goto st14 + goto tr56 + case 57: + if (m.data)[(m.p)] == 109 { + goto tr66 + } + goto tr56 case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st14 + if (m.data)[(m.p)] == 115 { + goto tr67 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st14 + goto tr56 + case 59: + if (m.data)[(m.p)] == 58 { + goto tr68 } - default: - goto st14 - } - goto tr6 - st14: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof14 - } - stCase14: - switch (m.data)[(m.p)] { - case 45: - goto st15 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st15 + goto tr56 + case 60: + if (m.data)[(m.p)] == 115 { + goto tr69 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st15 + goto tr56 + case 61: + if (m.data)[(m.p)] == 99 { + goto tr70 } - default: - goto st15 - } - goto tr6 - st15: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof15 - } - stCase15: - switch (m.data)[(m.p)] { - case 45: - goto st16 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st16 + goto tr56 + case 62: + if (m.data)[(m.p)] == 105 { + goto tr71 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st16 + goto tr56 + case 63: + if (m.data)[(m.p)] == 109 { + goto tr72 } - default: - goto st16 - } - goto tr6 - st16: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof16 - } - stCase16: - switch (m.data)[(m.p)] { - case 45: - goto st17 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st17 + goto tr56 + case 64: + if (m.data)[(m.p)] == 58 { + goto tr73 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st17 + goto tr56 + case 65: + switch (m.data)[(m.p)] { + case 97: + goto tr75 + case 112: + goto tr76 + case 115: + goto tr77 } - default: - goto st17 - } - goto tr6 - st17: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof17 - } - stCase17: - switch (m.data)[(m.p)] { - case 45: - goto st18 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st18 + goto tr74 + case 66: + if (m.data)[(m.p)] == 112 { + goto tr78 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st18 + goto tr74 + case 67: + if (m.data)[(m.p)] == 105 { + goto tr79 } - default: - goto st18 - } - goto tr6 - st18: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof18 - } - stCase18: - switch (m.data)[(m.p)] { - case 45: - goto st19 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st19 + goto tr74 + case 68: + if (m.data)[(m.p)] == 58 { + goto tr80 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st19 + goto tr74 + case 69: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr82 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr82 + } + default: + goto tr82 } - default: - goto st19 - } - goto tr6 - st19: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof19 - } - stCase19: - switch (m.data)[(m.p)] { - case 45: - goto st20 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st20 + goto tr81 + case 174: + if (m.data)[(m.p)] == 58 { + goto tr215 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st20 + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr214 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr214 + } + default: + goto tr214 } - default: - goto st20 - } - goto tr6 - st20: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof20 - } - stCase20: - switch (m.data)[(m.p)] { - case 45: - goto st21 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st21 + goto tr81 + case 70: + switch (m.data)[(m.p)] { + case 33: + goto tr84 + case 36: + goto tr84 + case 37: + goto tr85 + case 61: + goto tr84 + case 95: + goto tr84 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st21 + switch { + case (m.data)[(m.p)] < 48: + if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr84 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr84 + } + case (m.data)[(m.p)] >= 64: + goto tr84 + } + default: + goto tr84 } - default: - goto st21 - } - goto tr6 - st21: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof21 - } - stCase21: - switch (m.data)[(m.p)] { - case 45: - goto st22 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st22 + goto tr83 + case 175: + switch (m.data)[(m.p)] { + case 33: + goto tr216 + case 36: + goto tr216 + case 37: + goto tr217 + case 61: + goto tr216 + case 95: + goto tr216 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st22 + switch { + case (m.data)[(m.p)] < 48: + if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr216 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr216 + } + case (m.data)[(m.p)] >= 64: + goto tr216 + } + default: + goto tr216 } - default: - goto st22 - } - goto tr6 - st22: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof22 - } - stCase22: - switch (m.data)[(m.p)] { - case 45: - goto st23 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st23 + goto tr83 + case 71: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr87 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr87 + } + default: + goto tr88 + } + goto tr86 + case 72: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr89 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr89 + } + default: + goto tr90 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st23 + goto tr86 + case 176: + switch (m.data)[(m.p)] { + case 33: + goto tr216 + case 36: + goto tr216 + case 37: + goto tr217 + case 61: + goto tr216 + case 95: + goto tr216 } - default: - goto st23 - } - goto tr6 - st23: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof23 - } - stCase23: - switch (m.data)[(m.p)] { - case 45: - goto st24 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st24 + switch { + case (m.data)[(m.p)] < 48: + if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr216 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr216 + } + case (m.data)[(m.p)] >= 64: + goto tr216 + } + default: + goto tr216 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st24 + goto tr86 + case 73: + if (m.data)[(m.p)] == 97 { + goto tr91 } - default: - goto st24 - } - goto tr6 - st24: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof24 - } - stCase24: - switch (m.data)[(m.p)] { - case 45: - goto st25 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st25 + goto tr74 + case 74: + if (m.data)[(m.p)] == 114 { + goto tr92 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st25 + goto tr74 + case 75: + if (m.data)[(m.p)] == 97 { + goto tr93 } - default: - goto st25 - } - goto tr6 - st25: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof25 - } - stCase25: - switch (m.data)[(m.p)] { - case 45: - goto st26 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st26 + goto tr74 + case 76: + if (m.data)[(m.p)] == 109 { + goto tr79 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st26 + goto tr74 + case 77: + if (m.data)[(m.p)] == 99 { + goto tr94 } - default: - goto st26 - } - goto tr6 - st26: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof26 - } - stCase26: - switch (m.data)[(m.p)] { - case 45: - goto st27 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st27 + goto tr74 + case 78: + if (m.data)[(m.p)] == 104 { + goto tr95 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st27 + goto tr74 + case 79: + if (m.data)[(m.p)] == 101 { + goto tr96 } - default: - goto st27 - } - goto tr6 - st27: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof27 - } - stCase27: - switch (m.data)[(m.p)] { - case 45: - goto st28 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st28 + goto tr74 + case 80: + if (m.data)[(m.p)] == 109 { + goto tr97 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st28 + goto tr74 + case 81: + if (m.data)[(m.p)] == 97 { + goto tr98 } - default: - goto st28 - } - goto tr6 - st28: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof28 - } - stCase28: - switch (m.data)[(m.p)] { - case 45: - goto st29 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st29 + goto tr74 + case 82: + if (m.data)[(m.p)] == 115 { + goto tr79 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st29 + goto tr74 + case 83: + switch (m.data)[(m.p)] { + case 85: + goto tr99 + case 117: + goto tr99 } - default: - goto st29 - } - goto tr6 - st29: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof29 - } - stCase29: - switch (m.data)[(m.p)] { - case 45: - goto st30 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st30 + goto tr0 + case 84: + switch (m.data)[(m.p)] { + case 82: + goto tr100 + case 114: + goto tr100 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st30 + goto tr0 + case 85: + switch (m.data)[(m.p)] { + case 78: + goto tr101 + case 110: + goto tr101 } - default: - goto st30 - } - goto tr6 - st30: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof30 - } - stCase30: - switch (m.data)[(m.p)] { - case 45: - goto st31 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st31 + goto tr0 + case 86: + if (m.data)[(m.p)] == 58 { + goto tr102 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st31 + goto tr0 + case 87: + switch (m.data)[(m.p)] { + case 85: + goto tr105 + case 117: + goto tr105 } - default: - goto st31 - } - goto tr6 - st31: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof31 - } - stCase31: - switch (m.data)[(m.p)] { - case 45: - goto st32 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st32 + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr104 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr104 + } + default: + goto tr104 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st32 + goto tr103 + case 88: + if (m.data)[(m.p)] == 45 { + goto tr107 } - default: - goto st32 - } - goto tr6 - st32: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof32 - } - stCase32: - switch (m.data)[(m.p)] { - case 45: - goto st33 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st33 + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr108 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr108 + } + default: + goto tr108 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st33 + goto tr106 + case 89: + if (m.data)[(m.p)] == 45 { + goto tr109 } - default: - goto st33 - } - goto tr6 - st33: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof33 - } - stCase33: - switch (m.data)[(m.p)] { - case 45: - goto st34 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st34 + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr110 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr110 + } + default: + goto tr110 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st34 + goto tr106 + case 90: + if (m.data)[(m.p)] == 45 { + goto tr111 } - default: - goto st34 - } - goto tr6 - st34: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof34 - } - stCase34: - switch (m.data)[(m.p)] { - case 45: - goto st35 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st35 + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr112 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr112 + } + default: + goto tr112 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st35 + goto tr106 + case 91: + if (m.data)[(m.p)] == 45 { + goto tr113 } - default: - goto st35 - } - goto tr6 - st35: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof35 - } - stCase35: - switch (m.data)[(m.p)] { - case 45: - goto st36 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st36 + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr114 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr114 + } + default: + goto tr114 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st36 + goto tr106 + case 92: + if (m.data)[(m.p)] == 45 { + goto tr115 } - default: - goto st36 - } - goto tr6 - st36: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof36 - } - stCase36: - switch (m.data)[(m.p)] { - case 45: - goto st37 - case 58: - goto tr10 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st37 + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr116 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr116 + } + default: + goto tr116 } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st37 + goto tr106 + case 93: + if (m.data)[(m.p)] == 45 { + goto tr117 } - default: - goto st37 - } - goto tr6 - st37: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof37 - } - stCase37: - if (m.data)[(m.p)] == 58 { - goto tr10 - } - goto tr6 - tr10: - - output.ID = string(m.text()) - - goto st38 - st38: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof38 - } - stCase38: - switch (m.data)[(m.p)] { - case 33: - goto tr42 - case 36: - goto tr42 - case 37: - goto tr43 - case 61: - goto tr42 - case 95: - goto tr42 - } - switch { - case (m.data)[(m.p)] < 48: - if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { - goto tr42 + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr118 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr118 + } + default: + goto tr118 + } + goto tr106 + case 94: + if (m.data)[(m.p)] == 45 { + goto tr119 } - case (m.data)[(m.p)] > 59: switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr120 + } case (m.data)[(m.p)] > 90: if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto tr42 + goto tr120 } - case (m.data)[(m.p)] >= 64: - goto tr42 + default: + goto tr120 } - default: - goto tr42 - } - goto tr41 - tr42: - - m.pb = m.p - - goto st44 - st44: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof44 - } - stCase44: - switch (m.data)[(m.p)] { - case 33: - goto st44 - case 36: - goto st44 - case 37: - goto st39 - case 61: - goto st44 + goto tr106 case 95: - goto st44 - } - switch { - case (m.data)[(m.p)] < 48: - if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { - goto st44 + if (m.data)[(m.p)] == 45 { + goto tr121 } - case (m.data)[(m.p)] > 59: switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr122 + } case (m.data)[(m.p)] > 90: if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st44 + goto tr122 } - case (m.data)[(m.p)] >= 64: - goto st44 + default: + goto tr122 } - default: - goto st44 - } - goto tr41 - tr43: + goto tr106 + case 96: + if (m.data)[(m.p)] == 45 { + goto tr123 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr124 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr124 + } + default: + goto tr124 + } + goto tr106 + case 97: + if (m.data)[(m.p)] == 45 { + goto tr125 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr126 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr126 + } + default: + goto tr126 + } + goto tr106 + case 98: + if (m.data)[(m.p)] == 45 { + goto tr127 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr128 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr128 + } + default: + goto tr128 + } + goto tr106 + case 99: + if (m.data)[(m.p)] == 45 { + goto tr129 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr130 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr130 + } + default: + goto tr130 + } + goto tr106 + case 100: + if (m.data)[(m.p)] == 45 { + goto tr131 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr132 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr132 + } + default: + goto tr132 + } + goto tr106 + case 101: + if (m.data)[(m.p)] == 45 { + goto tr133 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr134 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr134 + } + default: + goto tr134 + } + goto tr106 + case 102: + if (m.data)[(m.p)] == 45 { + goto tr135 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr136 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr136 + } + default: + goto tr136 + } + goto tr106 + case 103: + if (m.data)[(m.p)] == 45 { + goto tr137 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr138 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr138 + } + default: + goto tr138 + } + goto tr106 + case 104: + if (m.data)[(m.p)] == 45 { + goto tr139 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr140 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr140 + } + default: + goto tr140 + } + goto tr106 + case 105: + if (m.data)[(m.p)] == 45 { + goto tr141 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr142 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr142 + } + default: + goto tr142 + } + goto tr106 + case 106: + if (m.data)[(m.p)] == 45 { + goto tr143 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr144 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr144 + } + default: + goto tr144 + } + goto tr106 + case 107: + if (m.data)[(m.p)] == 45 { + goto tr145 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr146 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr146 + } + default: + goto tr146 + } + goto tr106 + case 108: + if (m.data)[(m.p)] == 45 { + goto tr147 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr148 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr148 + } + default: + goto tr148 + } + goto tr106 + case 109: + if (m.data)[(m.p)] == 45 { + goto tr149 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr150 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr150 + } + default: + goto tr150 + } + goto tr106 + case 110: + if (m.data)[(m.p)] == 45 { + goto tr151 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr152 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr152 + } + default: + goto tr152 + } + goto tr106 + case 111: + if (m.data)[(m.p)] == 45 { + goto tr153 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr154 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr154 + } + default: + goto tr154 + } + goto tr106 + case 112: + if (m.data)[(m.p)] == 45 { + goto tr155 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr156 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr156 + } + default: + goto tr156 + } + goto tr106 + case 113: + if (m.data)[(m.p)] == 45 { + goto tr157 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr158 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr158 + } + default: + goto tr158 + } + goto tr106 + case 114: + if (m.data)[(m.p)] == 45 { + goto tr159 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr160 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr160 + } + default: + goto tr160 + } + goto tr106 + case 115: + if (m.data)[(m.p)] == 45 { + goto tr161 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr162 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr162 + } + default: + goto tr162 + } + goto tr106 + case 116: + if (m.data)[(m.p)] == 45 { + goto tr163 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr164 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr164 + } + default: + goto tr164 + } + goto tr106 + case 117: + if (m.data)[(m.p)] == 45 { + goto tr165 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr166 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr166 + } + default: + goto tr166 + } + goto tr106 + case 118: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr167 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr167 + } + default: + goto tr167 + } + goto tr106 + case 119: + if (m.data)[(m.p)] == 58 { + goto tr168 + } + goto tr106 + case 120: + switch (m.data)[(m.p)] { + case 33: + goto tr170 + case 37: + goto tr171 + case 61: + goto tr170 + case 95: + goto tr170 + case 126: + goto tr170 + } + switch { + case (m.data)[(m.p)] < 48: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr170 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr170 + } + case (m.data)[(m.p)] >= 64: + goto tr170 + } + default: + goto tr170 + } + goto tr169 + case 177: + switch (m.data)[(m.p)] { + case 33: + goto tr218 + case 35: + goto tr219 + case 37: + goto tr220 + case 61: + goto tr218 + case 63: + goto tr221 + case 95: + goto tr218 + case 126: + goto tr218 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr218 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr218 + } + default: + goto tr218 + } + goto tr169 + case 178: + switch (m.data)[(m.p)] { + case 33: + goto tr222 + case 37: + goto tr223 + case 61: + goto tr222 + case 95: + goto tr222 + case 126: + goto tr222 + } + switch { + case (m.data)[(m.p)] < 63: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr222 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr222 + } + default: + goto tr222 + } + goto tr183 + case 179: + switch (m.data)[(m.p)] { + case 33: + goto tr224 + case 37: + goto tr225 + case 61: + goto tr224 + case 95: + goto tr224 + case 126: + goto tr224 + } + switch { + case (m.data)[(m.p)] < 63: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr224 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr224 + } + default: + goto tr224 + } + goto tr183 + case 121: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr173 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr173 + } + default: + goto tr174 + } + goto tr172 + case 122: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr175 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr175 + } + default: + goto tr176 + } + goto tr172 + case 180: + switch (m.data)[(m.p)] { + case 33: + goto tr224 + case 37: + goto tr225 + case 61: + goto tr224 + case 95: + goto tr224 + case 126: + goto tr224 + } + switch { + case (m.data)[(m.p)] < 63: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr224 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr224 + } + default: + goto tr224 + } + goto tr172 + case 123: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr178 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr178 + } + default: + goto tr179 + } + goto tr177 + case 124: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr180 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr180 + } + default: + goto tr181 + } + goto tr177 + case 181: + switch (m.data)[(m.p)] { + case 33: + goto tr218 + case 35: + goto tr219 + case 37: + goto tr220 + case 61: + goto tr218 + case 63: + goto tr221 + case 95: + goto tr218 + case 126: + goto tr218 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr218 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr218 + } + default: + goto tr218 + } + goto tr177 + case 125: + switch (m.data)[(m.p)] { + case 43: + goto tr182 + case 61: + goto tr184 + } + goto tr183 + case 126: + switch (m.data)[(m.p)] { + case 33: + goto tr186 + case 37: + goto tr187 + case 61: + goto tr186 + case 63: + goto tr188 + case 95: + goto tr186 + case 126: + goto tr186 + } + switch { + case (m.data)[(m.p)] < 48: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr186 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr186 + } + case (m.data)[(m.p)] >= 64: + goto tr186 + } + default: + goto tr186 + } + goto tr185 + case 182: + switch (m.data)[(m.p)] { + case 33: + goto tr226 + case 35: + goto tr227 + case 37: + goto tr228 + case 61: + goto tr226 + case 63: + goto tr229 + case 95: + goto tr226 + case 126: + goto tr226 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr226 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr226 + } + default: + goto tr226 + } + goto tr185 + case 127: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr190 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr190 + } + default: + goto tr191 + } + goto tr189 + case 128: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr192 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr192 + } + default: + goto tr193 + } + goto tr189 + case 183: + switch (m.data)[(m.p)] { + case 33: + goto tr226 + case 35: + goto tr227 + case 37: + goto tr228 + case 61: + goto tr226 + case 63: + goto tr229 + case 95: + goto tr226 + case 126: + goto tr226 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr226 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr226 + } + default: + goto tr226 + } + goto tr189 + case 184: + switch (m.data)[(m.p)] { + case 33: + goto tr226 + case 35: + goto tr227 + case 37: + goto tr228 + case 43: + goto tr230 + case 61: + goto tr231 + case 63: + goto tr229 + case 95: + goto tr226 + case 126: + goto tr226 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr226 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr226 + } + default: + goto tr226 + } + goto tr185 + case 185: + switch (m.data)[(m.p)] { + case 33: + goto tr232 + case 35: + goto tr233 + case 37: + goto tr234 + case 47: + goto tr226 + case 61: + goto tr232 + case 63: + goto tr235 + case 95: + goto tr232 + case 126: + goto tr232 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr232 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr232 + } + default: + goto tr232 + } + goto tr185 + case 186: + switch (m.data)[(m.p)] { + case 33: + goto tr204 + case 35: + goto tr227 + case 37: + goto tr237 + case 47: + goto tr226 + case 61: + goto tr204 + case 63: + goto tr229 + case 95: + goto tr204 + case 126: + goto tr204 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr204 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr204 + } + default: + goto tr204 + } + goto tr236 + case 187: + switch (m.data)[(m.p)] { + case 33: + goto tr238 + case 35: + goto tr239 + case 37: + goto tr240 + case 61: + goto tr238 + case 63: + goto tr241 + case 95: + goto tr238 + case 126: + goto tr238 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr238 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr238 + } + default: + goto tr238 + } + goto tr203 + case 129: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr195 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr195 + } + default: + goto tr196 + } + goto tr194 + case 130: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr197 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr197 + } + default: + goto tr198 + } + goto tr194 + case 188: + switch (m.data)[(m.p)] { + case 33: + goto tr238 + case 35: + goto tr239 + case 37: + goto tr240 + case 61: + goto tr238 + case 63: + goto tr241 + case 95: + goto tr238 + case 126: + goto tr238 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr238 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr238 + } + default: + goto tr238 + } + goto tr194 + case 189: + switch (m.data)[(m.p)] { + case 33: + goto tr238 + case 35: + goto tr239 + case 37: + goto tr240 + case 61: + goto tr242 + case 63: + goto tr241 + case 95: + goto tr238 + case 126: + goto tr238 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr238 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr238 + } + default: + goto tr238 + } + goto tr203 + case 190: + switch (m.data)[(m.p)] { + case 33: + goto tr243 + case 35: + goto tr244 + case 37: + goto tr245 + case 47: + goto tr238 + case 61: + goto tr243 + case 63: + goto tr246 + case 95: + goto tr243 + case 126: + goto tr243 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr243 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr243 + } + default: + goto tr243 + } + goto tr203 + case 131: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr200 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr200 + } + default: + goto tr201 + } + goto tr199 + case 132: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr197 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr197 + } + default: + goto tr198 + } + goto tr199 + case 133: + if (m.data)[(m.p)] == 43 { + goto tr202 + } + goto tr185 + case 191: + switch (m.data)[(m.p)] { + case 33: + goto tr232 + case 35: + goto tr233 + case 37: + goto tr234 + case 61: + goto tr232 + case 63: + goto tr247 + case 95: + goto tr232 + case 126: + goto tr232 + } + switch { + case (m.data)[(m.p)] < 48: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr232 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr232 + } + case (m.data)[(m.p)] >= 64: + goto tr232 + } + default: + goto tr232 + } + goto tr185 + case 134: + switch (m.data)[(m.p)] { + case 43: + goto tr202 + case 61: + goto tr184 + } + goto tr185 + case 135: + switch (m.data)[(m.p)] { + case 33: + goto tr204 + case 37: + goto tr205 + case 61: + goto tr204 + case 63: + goto tr206 + case 95: + goto tr204 + case 126: + goto tr204 + } + switch { + case (m.data)[(m.p)] < 48: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr204 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr204 + } + case (m.data)[(m.p)] >= 64: + goto tr204 + } + default: + goto tr204 + } + goto tr203 + case 136: + if (m.data)[(m.p)] == 61 { + goto tr207 + } + goto tr203 + case 192: + switch (m.data)[(m.p)] { + case 33: + goto tr243 + case 35: + goto tr244 + case 37: + goto tr245 + case 61: + goto tr243 + case 63: + goto tr248 + case 95: + goto tr243 + case 126: + goto tr243 + } + switch { + case (m.data)[(m.p)] < 48: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr243 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr243 + } + case (m.data)[(m.p)] >= 64: + goto tr243 + } + default: + goto tr243 + } + goto tr203 + case 137: + if (m.data)[(m.p)] == 58 { + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr167 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr167 + } + default: + goto tr167 + } + goto tr106 + case 138: + switch (m.data)[(m.p)] { + case 45: + goto tr165 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr166 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr166 + } + default: + goto tr166 + } + goto tr106 + case 139: + switch (m.data)[(m.p)] { + case 45: + goto tr163 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr164 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr164 + } + default: + goto tr164 + } + goto tr106 + case 140: + switch (m.data)[(m.p)] { + case 45: + goto tr161 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr162 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr162 + } + default: + goto tr162 + } + goto tr106 + case 141: + switch (m.data)[(m.p)] { + case 45: + goto tr159 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr160 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr160 + } + default: + goto tr160 + } + goto tr106 + case 142: + switch (m.data)[(m.p)] { + case 45: + goto tr157 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr158 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr158 + } + default: + goto tr158 + } + goto tr106 + case 143: + switch (m.data)[(m.p)] { + case 45: + goto tr155 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr156 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr156 + } + default: + goto tr156 + } + goto tr106 + case 144: + switch (m.data)[(m.p)] { + case 45: + goto tr153 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr154 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr154 + } + default: + goto tr154 + } + goto tr106 + case 145: + switch (m.data)[(m.p)] { + case 45: + goto tr151 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr152 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr152 + } + default: + goto tr152 + } + goto tr106 + case 146: + switch (m.data)[(m.p)] { + case 45: + goto tr149 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr150 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr150 + } + default: + goto tr150 + } + goto tr106 + case 147: + switch (m.data)[(m.p)] { + case 45: + goto tr147 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr148 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr148 + } + default: + goto tr148 + } + goto tr106 + case 148: + switch (m.data)[(m.p)] { + case 45: + goto tr145 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr146 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr146 + } + default: + goto tr146 + } + goto tr106 + case 149: + switch (m.data)[(m.p)] { + case 45: + goto tr143 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr144 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr144 + } + default: + goto tr144 + } + goto tr106 + case 150: + switch (m.data)[(m.p)] { + case 45: + goto tr141 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr142 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr142 + } + default: + goto tr142 + } + goto tr106 + case 151: + switch (m.data)[(m.p)] { + case 45: + goto tr139 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr140 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr140 + } + default: + goto tr140 + } + goto tr106 + case 152: + switch (m.data)[(m.p)] { + case 45: + goto tr137 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr138 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr138 + } + default: + goto tr138 + } + goto tr106 + case 153: + switch (m.data)[(m.p)] { + case 45: + goto tr135 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr136 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr136 + } + default: + goto tr136 + } + goto tr106 + case 154: + switch (m.data)[(m.p)] { + case 45: + goto tr133 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr134 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr134 + } + default: + goto tr134 + } + goto tr106 + case 155: + switch (m.data)[(m.p)] { + case 45: + goto tr131 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr132 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr132 + } + default: + goto tr132 + } + goto tr106 + case 156: + switch (m.data)[(m.p)] { + case 45: + goto tr129 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr130 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr130 + } + default: + goto tr130 + } + goto tr106 + case 157: + switch (m.data)[(m.p)] { + case 45: + goto tr127 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr128 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr128 + } + default: + goto tr128 + } + goto tr106 + case 158: + switch (m.data)[(m.p)] { + case 45: + goto tr125 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr126 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr126 + } + default: + goto tr126 + } + goto tr106 + case 159: + switch (m.data)[(m.p)] { + case 45: + goto tr123 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr124 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr124 + } + default: + goto tr124 + } + goto tr106 + case 160: + switch (m.data)[(m.p)] { + case 45: + goto tr121 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr122 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr122 + } + default: + goto tr122 + } + goto tr106 + case 161: + switch (m.data)[(m.p)] { + case 45: + goto tr119 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr120 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr120 + } + default: + goto tr120 + } + goto tr106 + case 162: + switch (m.data)[(m.p)] { + case 45: + goto tr117 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr118 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr118 + } + default: + goto tr118 + } + goto tr106 + case 163: + switch (m.data)[(m.p)] { + case 45: + goto tr115 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr116 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr116 + } + default: + goto tr116 + } + goto tr106 + case 164: + switch (m.data)[(m.p)] { + case 45: + goto tr113 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr114 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr114 + } + default: + goto tr114 + } + goto tr106 + case 165: + switch (m.data)[(m.p)] { + case 45: + goto tr111 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr112 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr112 + } + default: + goto tr112 + } + goto tr106 + case 166: + switch (m.data)[(m.p)] { + case 45: + goto tr109 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr110 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr110 + } + default: + goto tr110 + } + goto tr106 + case 167: + switch (m.data)[(m.p)] { + case 45: + goto tr107 + case 82: + goto tr208 + case 114: + goto tr208 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr108 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr108 + } + default: + goto tr108 + } + goto tr103 + case 168: + switch (m.data)[(m.p)] { + case 45: + goto tr109 + case 58: + goto tr168 + case 78: + goto tr209 + case 110: + goto tr209 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr110 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr110 + } + default: + goto tr110 + } + goto tr103 + case 169: + switch (m.data)[(m.p)] { + case 45: + goto tr210 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr112 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr112 + } + default: + goto tr112 + } + goto tr106 + case 170: + switch (m.data)[(m.p)] { + case 45: + goto tr113 + case 48: + goto tr211 + } + switch { + case (m.data)[(m.p)] < 65: + if 49 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr114 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr211 + } + default: + goto tr211 + } + goto tr106 + case 171: + if (m.data)[(m.p)] == 45 { + goto tr115 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr116 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr116 + } + default: + goto tr116 + } + goto tr106 + case 193: + switch (m.data)[(m.p)] { + case 10: + goto tr183 + case 13: + goto tr183 + } + goto tr249 + } + + tr183: + m.cs = 0 + goto _again + tr0: + m.cs = 0 + goto f0 + tr5: + m.cs = 0 + goto f3 + tr8: + m.cs = 0 + goto f5 + tr41: + m.cs = 0 + goto f7 + tr44: + m.cs = 0 + goto f8 + tr51: + m.cs = 0 + goto f10 + tr56: + m.cs = 0 + goto f11 + tr74: + m.cs = 0 + goto f13 + tr81: + m.cs = 0 + goto f15 + tr83: + m.cs = 0 + goto f17 + tr86: + m.cs = 0 + goto f19 + tr103: + m.cs = 0 + goto f20 + tr106: + m.cs = 0 + goto f21 + tr169: + m.cs = 0 + goto f22 + tr172: + m.cs = 0 + goto f23 + tr177: + m.cs = 0 + goto f24 + tr185: + m.cs = 0 + goto f25 + tr189: + m.cs = 0 + goto f27 + tr194: + m.cs = 0 + goto f28 + tr199: + m.cs = 0 + goto f29 + tr203: + m.cs = 0 + goto f30 + tr236: + m.cs = 0 + goto f46 + tr1: + m.cs = 2 + goto f1 + tr2: + m.cs = 3 + goto _again + tr3: + m.cs = 4 + goto _again + tr4: + m.cs = 5 + goto f2 + tr6: + m.cs = 6 + goto f4 + tr9: + m.cs = 7 + goto _again + tr11: + m.cs = 8 + goto _again + tr12: + m.cs = 9 + goto _again + tr13: + m.cs = 10 + goto _again + tr14: + m.cs = 11 + goto _again + tr15: + m.cs = 12 + goto _again + tr16: + m.cs = 13 + goto _again + tr17: + m.cs = 14 + goto _again + tr18: + m.cs = 15 + goto _again + tr19: + m.cs = 16 + goto _again + tr20: + m.cs = 17 + goto _again + tr21: + m.cs = 18 + goto _again + tr22: + m.cs = 19 + goto _again + tr23: + m.cs = 20 + goto _again + tr24: + m.cs = 21 + goto _again + tr25: + m.cs = 22 + goto _again + tr26: + m.cs = 23 + goto _again + tr27: + m.cs = 24 + goto _again + tr28: + m.cs = 25 + goto _again + tr29: + m.cs = 26 + goto _again + tr30: + m.cs = 27 + goto _again + tr31: + m.cs = 28 + goto _again + tr32: + m.cs = 29 + goto _again + tr33: + m.cs = 30 + goto _again + tr34: + m.cs = 31 + goto _again + tr35: + m.cs = 32 + goto _again + tr36: + m.cs = 33 + goto _again + tr37: + m.cs = 34 + goto _again + tr38: + m.cs = 35 + goto _again + tr39: + m.cs = 36 + goto _again + tr40: + m.cs = 37 + goto _again + tr10: + m.cs = 38 + goto f6 + tr213: + m.cs = 39 + goto _again + tr43: + m.cs = 39 + goto f4 + tr45: + m.cs = 40 + goto _again + tr46: + m.cs = 40 + goto f9 + tr7: + m.cs = 41 + goto f1 + tr49: + m.cs = 42 + goto _again + tr50: + m.cs = 43 + goto _again + tr52: + m.cs = 45 + goto f1 + tr53: + m.cs = 46 + goto _again + tr54: + m.cs = 47 + goto _again + tr55: + m.cs = 48 + goto f2 + tr57: + m.cs = 49 + goto f4 + tr58: + m.cs = 50 + goto _again + tr59: + m.cs = 51 + goto _again + tr60: + m.cs = 52 + goto _again + tr61: + m.cs = 53 + goto _again + tr62: + m.cs = 54 + goto _again + tr63: + m.cs = 55 + goto _again + tr64: + m.cs = 56 + goto _again + tr65: + m.cs = 57 + goto _again + tr66: + m.cs = 58 + goto _again + tr67: + m.cs = 59 + goto _again + tr68: + m.cs = 60 + goto _again + tr69: + m.cs = 61 + goto _again + tr70: + m.cs = 62 + goto _again + tr71: + m.cs = 63 + goto _again + tr72: + m.cs = 64 + goto _again + tr73: + m.cs = 65 + goto f12 + tr75: + m.cs = 66 + goto f4 + tr78: + m.cs = 67 + goto _again + tr79: + m.cs = 68 + goto _again + tr80: + m.cs = 69 + goto f14 + tr215: + m.cs = 70 + goto f35 + tr217: + m.cs = 71 + goto _again + tr85: + m.cs = 71 + goto f18 + tr87: + m.cs = 72 + goto _again + tr88: + m.cs = 72 + goto f9 + tr76: + m.cs = 73 + goto f4 + tr91: + m.cs = 74 + goto _again + tr92: + m.cs = 75 + goto _again + tr93: + m.cs = 76 + goto _again + tr77: + m.cs = 77 + goto f4 + tr94: + m.cs = 78 + goto _again + tr95: + m.cs = 79 + goto _again + tr96: + m.cs = 80 + goto _again + tr97: + m.cs = 81 + goto _again + tr98: + m.cs = 82 + goto _again + tr99: + m.cs = 84 + goto f1 + tr100: + m.cs = 85 + goto _again + tr101: + m.cs = 86 + goto _again + tr102: + m.cs = 87 + goto f2 + tr104: + m.cs = 88 + goto f4 + tr107: + m.cs = 89 + goto _again + tr109: + m.cs = 90 + goto _again + tr111: + m.cs = 91 + goto _again + tr113: + m.cs = 92 + goto _again + tr115: + m.cs = 93 + goto _again + tr117: + m.cs = 94 + goto _again + tr119: + m.cs = 95 + goto _again + tr121: + m.cs = 96 + goto _again + tr123: + m.cs = 97 + goto _again + tr125: + m.cs = 98 + goto _again + tr127: + m.cs = 99 + goto _again + tr129: + m.cs = 100 + goto _again + tr131: + m.cs = 101 + goto _again + tr133: + m.cs = 102 + goto _again + tr135: + m.cs = 103 + goto _again + tr137: + m.cs = 104 + goto _again + tr139: + m.cs = 105 + goto _again + tr141: + m.cs = 106 + goto _again + tr143: + m.cs = 107 + goto _again + tr145: + m.cs = 108 + goto _again + tr147: + m.cs = 109 + goto _again + tr149: + m.cs = 110 + goto _again + tr151: + m.cs = 111 + goto _again + tr153: + m.cs = 112 + goto _again + tr155: + m.cs = 113 + goto _again + tr157: + m.cs = 114 + goto _again + tr159: + m.cs = 115 + goto _again + tr161: + m.cs = 116 + goto _again + tr163: + m.cs = 117 + goto _again + tr165: + m.cs = 118 + goto _again + tr167: + m.cs = 119 + goto _again + tr168: + m.cs = 120 + goto f6 + tr225: + m.cs = 121 + goto _again + tr223: + m.cs = 121 + goto f4 + tr173: + m.cs = 122 + goto _again + tr174: + m.cs = 122 + goto f9 + tr220: + m.cs = 123 + goto _again + tr171: + m.cs = 123 + goto f4 + tr178: + m.cs = 124 + goto _again + tr179: + m.cs = 124 + goto f9 + tr221: + m.cs = 125 + goto f38 + tr182: + m.cs = 126 + goto _again + tr228: + m.cs = 127 + goto _again + tr187: + m.cs = 127 + goto f26 + tr234: + m.cs = 127 + goto f44 + tr190: + m.cs = 128 + goto _again + tr191: + m.cs = 128 + goto f9 + tr240: + m.cs = 129 + goto _again + tr205: + m.cs = 129 + goto f31 + tr245: + m.cs = 129 + goto f50 + tr195: + m.cs = 130 + goto _again + tr196: + m.cs = 130 + goto f9 + tr237: + m.cs = 131 + goto f31 + tr200: + m.cs = 132 + goto _again + tr201: + m.cs = 132 + goto f9 + tr188: + m.cs = 133 + goto f26 + tr247: + m.cs = 134 + goto f45 + tr184: + m.cs = 135 + goto _again + tr206: + m.cs = 136 + goto f31 + tr248: + m.cs = 136 + goto f50 + tr166: + m.cs = 137 + goto _again + tr164: + m.cs = 138 + goto _again + tr162: + m.cs = 139 + goto _again + tr160: + m.cs = 140 + goto _again + tr158: + m.cs = 141 + goto _again + tr156: + m.cs = 142 + goto _again + tr154: + m.cs = 143 + goto _again + tr152: + m.cs = 144 + goto _again + tr150: + m.cs = 145 + goto _again + tr148: + m.cs = 146 + goto _again + tr146: + m.cs = 147 + goto _again + tr144: + m.cs = 148 + goto _again + tr142: + m.cs = 149 + goto _again + tr140: + m.cs = 150 + goto _again + tr138: + m.cs = 151 + goto _again + tr136: + m.cs = 152 + goto _again + tr134: + m.cs = 153 + goto _again + tr132: + m.cs = 154 + goto _again + tr130: + m.cs = 155 + goto _again + tr128: + m.cs = 156 + goto _again + tr126: + m.cs = 157 + goto _again + tr124: + m.cs = 158 + goto _again + tr122: + m.cs = 159 + goto _again + tr120: + m.cs = 160 + goto _again + tr118: + m.cs = 161 + goto _again + tr116: + m.cs = 162 + goto _again + tr114: + m.cs = 163 + goto _again + tr112: + m.cs = 164 + goto _again + tr110: + m.cs = 165 + goto _again + tr108: + m.cs = 166 + goto _again + tr105: + m.cs = 167 + goto f1 + tr208: + m.cs = 168 + goto _again + tr209: + m.cs = 169 + goto _again + tr210: + m.cs = 170 + goto f2 + tr211: + m.cs = 171 + goto _again + tr212: + m.cs = 172 + goto _again + tr42: + m.cs = 172 + goto f4 + tr47: + m.cs = 173 + goto _again + tr48: + m.cs = 173 + goto f9 + tr214: + m.cs = 174 + goto _again + tr82: + m.cs = 174 + goto f16 + tr216: + m.cs = 175 + goto _again + tr84: + m.cs = 175 + goto f18 + tr89: + m.cs = 176 + goto _again + tr90: + m.cs = 176 + goto f9 + tr218: + m.cs = 177 + goto _again + tr170: + m.cs = 177 + goto f4 + tr219: + m.cs = 178 + goto f38 + tr227: + m.cs = 178 + goto f42 + tr233: + m.cs = 178 + goto f45 + tr239: + m.cs = 178 + goto f48 + tr244: + m.cs = 178 + goto f51 + tr224: + m.cs = 179 + goto _again + tr222: + m.cs = 179 + goto f4 + tr175: + m.cs = 180 + goto _again + tr176: + m.cs = 180 + goto f9 + tr180: + m.cs = 181 + goto _again + tr181: + m.cs = 181 + goto f9 + tr226: + m.cs = 182 + goto _again + tr186: + m.cs = 182 + goto f26 + tr232: + m.cs = 182 + goto f44 + tr192: + m.cs = 183 + goto _again + tr193: + m.cs = 183 + goto f9 + tr229: + m.cs = 184 + goto f42 + tr235: + m.cs = 184 + goto f45 + tr230: + m.cs = 185 + goto _again + tr231: + m.cs = 186 + goto _again + tr238: + m.cs = 187 + goto _again + tr204: + m.cs = 187 + goto f31 + tr243: + m.cs = 187 + goto f50 + tr197: + m.cs = 188 + goto _again + tr198: + m.cs = 188 + goto f9 + tr241: + m.cs = 189 + goto _again + tr246: + m.cs = 189 + goto f50 + tr242: + m.cs = 190 + goto _again + tr202: + m.cs = 191 + goto _again + tr207: + m.cs = 192 + goto _again + tr249: + m.cs = 193 + goto _again + + f4: + + m.pb = m.p + + goto _again + f9: + + // List of positions in the buffer to later lowercase + output.tolower = append(output.tolower, m.p-m.pb) + + goto _again + f2: + + output.prefix = string(m.text()) + + goto _again + f6: + + output.ID = string(m.text()) + + goto _again + f38: + + output.SS = string(m.text()) + // Iterate upper letters lowering them + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] + 32 + } + output.norm = string(m.text()) + // Revert the buffer to the original + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] - 32 + } + + goto _again + f0: + + m.err = fmt.Errorf(errPrefix, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f5: + + m.err = fmt.Errorf(errIdentifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f7: + + m.err = fmt.Errorf(errSpecificString, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f23: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + goto _again + f11: + + m.err = fmt.Errorf(errSCIMNamespace, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f13: + + m.err = fmt.Errorf(errSCIMType, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f15: + + m.err = fmt.Errorf(errSCIMName, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f17: + + if m.p == m.pe { + m.err = fmt.Errorf(errSCIMOtherIncomplete, m.p-1) + } else { + m.err = fmt.Errorf(errSCIMOther, m.p) + } + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f14: + + output.scim.Type = scimschema.TypeFromString(string(m.text())) + + goto _again + f16: + + output.scim.pos = m.p + + goto _again + f35: + + output.scim.Name = string(m.data[output.scim.pos:m.p]) + + goto _again + f18: + + output.scim.pos = m.p + + goto _again + f22: + + m.err = fmt.Errorf(err8141SpecificString, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f21: + + m.err = fmt.Errorf(err8141Identifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f42: + + output.rComponent = string(m.text()) + + goto _again + f48: + + output.qComponent = string(m.text()) + + goto _again + f44: + + if output.rStart { + m.err = fmt.Errorf(err8141RComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + output.rStart = true + + goto _again + f50: + + if output.qStart { + m.err = fmt.Errorf(err8141QComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + output.qStart = true + + goto _again + f25: + + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f30: + + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f1: + + m.pb = m.p + + if m.parsingMode != RFC8141Only { + // Throw an error when: + // - we are entering here matching the the prefix in the namespace identifier part + // - looking ahead (3 chars) we find a colon + if pos := m.p + 3; pos < m.pe && m.data[pos] == 58 && output.prefix != "" { + m.err = fmt.Errorf(errNoUrnWithinID, pos) + (m.p)-- + + m.cs = 193 + goto _again + + } + } + + goto _again + f12: + + output.ID = string(m.text()) + + output.scim = &SCIM{} + + goto _again + f3: + + m.err = fmt.Errorf(errIdentifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(errPrefix, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f10: + + m.err = fmt.Errorf(errIdentifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(errNoUrnWithinID, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f8: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + m.err = fmt.Errorf(errSpecificString, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f19: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + if m.p == m.pe { + m.err = fmt.Errorf(errSCIMOtherIncomplete, m.p-1) + } else { + m.err = fmt.Errorf(errSCIMOther, m.p) + } + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f24: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + m.err = fmt.Errorf(err8141SpecificString, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f27: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f28: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f20: + + m.err = fmt.Errorf(err8141Identifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(errPrefix, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f26: + + if output.rStart { + m.err = fmt.Errorf(err8141RComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + output.rStart = true + + m.pb = m.p + + goto _again + f45: - m.pb = m.p + if output.rStart { + m.err = fmt.Errorf(err8141RComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again - goto st39 - st39: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof39 - } - stCase39: - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st40 - } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st40 - } - default: - goto tr46 } - goto tr44 - tr46: + output.rStart = true - m.tolower = append(m.tolower, m.p-m.pb) + output.rComponent = string(m.text()) - goto st40 - st40: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof40 - } - stCase40: - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st45 - } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st45 - } - default: - goto tr48 - } - goto tr44 - tr48: + goto _again + f31: - m.tolower = append(m.tolower, m.p-m.pb) + if output.qStart { + m.err = fmt.Errorf(err8141QComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again - goto st45 - st45: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof45 - } - stCase45: - switch (m.data)[(m.p)] { - case 33: - goto st44 - case 36: - goto st44 - case 37: - goto st39 - case 61: - goto st44 - case 95: - goto st44 - } - switch { - case (m.data)[(m.p)] < 48: - if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { - goto st44 - } - case (m.data)[(m.p)] > 59: - switch { - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st44 - } - case (m.data)[(m.p)] >= 64: - goto st44 - } - default: - goto st44 } - goto tr44 - tr8: + output.qStart = true m.pb = m.p - goto st41 - st41: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof41 - } - stCase41: - switch (m.data)[(m.p)] { - case 45: - goto st7 - case 58: - goto tr10 - case 82: - goto st42 - case 114: - goto st42 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st7 - } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st7 - } - default: - goto st7 - } - goto tr6 - st42: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof42 - } - stCase42: - switch (m.data)[(m.p)] { - case 45: - goto st8 - case 58: - goto tr10 - case 78: - goto st43 - case 110: - goto st43 - } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st8 - } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st8 - } - default: - goto st8 - } - goto tr50 - st43: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof43 + goto _again + f51: + + if output.qStart { + m.err = fmt.Errorf(err8141QComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + } - stCase43: - if (m.data)[(m.p)] == 45 { - goto st9 + output.qStart = true + + output.qComponent = string(m.text()) + + goto _again + f46: + + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f29: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + } - switch { - case (m.data)[(m.p)] < 65: - if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { - goto st9 - } - case (m.data)[(m.p)] > 90: - if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { - goto st9 - } - default: - goto st9 + + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + + _again: + switch _toStateActions[m.cs] { + case 33: + + (m.p)-- + + m.err = fmt.Errorf(err8141InformalID, m.p) + m.cs = 193 + goto _again } - goto tr52 - st46: - if (m.p)++; (m.p) == (m.pe) { - goto _testEof46 + + if m.cs == 0 { + goto _out } - stCase46: - switch (m.data)[(m.p)] { - case 10: - goto st0 - case 13: - goto st0 + if (m.p)++; (m.p) != (m.pe) { + goto _resume } - goto st46 - stOut: - _testEof2: - m.cs = 2 - goto _testEof - _testEof3: - m.cs = 3 - goto _testEof - _testEof4: - m.cs = 4 - goto _testEof - _testEof5: - m.cs = 5 - goto _testEof - _testEof6: - m.cs = 6 - goto _testEof - _testEof7: - m.cs = 7 - goto _testEof - _testEof8: - m.cs = 8 - goto _testEof - _testEof9: - m.cs = 9 - goto _testEof - _testEof10: - m.cs = 10 - goto _testEof - _testEof11: - m.cs = 11 - goto _testEof - _testEof12: - m.cs = 12 - goto _testEof - _testEof13: - m.cs = 13 - goto _testEof - _testEof14: - m.cs = 14 - goto _testEof - _testEof15: - m.cs = 15 - goto _testEof - _testEof16: - m.cs = 16 - goto _testEof - _testEof17: - m.cs = 17 - goto _testEof - _testEof18: - m.cs = 18 - goto _testEof - _testEof19: - m.cs = 19 - goto _testEof - _testEof20: - m.cs = 20 - goto _testEof - _testEof21: - m.cs = 21 - goto _testEof - _testEof22: - m.cs = 22 - goto _testEof - _testEof23: - m.cs = 23 - goto _testEof - _testEof24: - m.cs = 24 - goto _testEof - _testEof25: - m.cs = 25 - goto _testEof - _testEof26: - m.cs = 26 - goto _testEof - _testEof27: - m.cs = 27 - goto _testEof - _testEof28: - m.cs = 28 - goto _testEof - _testEof29: - m.cs = 29 - goto _testEof - _testEof30: - m.cs = 30 - goto _testEof - _testEof31: - m.cs = 31 - goto _testEof - _testEof32: - m.cs = 32 - goto _testEof - _testEof33: - m.cs = 33 - goto _testEof - _testEof34: - m.cs = 34 - goto _testEof - _testEof35: - m.cs = 35 - goto _testEof - _testEof36: - m.cs = 36 - goto _testEof - _testEof37: - m.cs = 37 - goto _testEof - _testEof38: - m.cs = 38 - goto _testEof - _testEof44: - m.cs = 44 - goto _testEof - _testEof39: - m.cs = 39 - goto _testEof - _testEof40: - m.cs = 40 - goto _testEof - _testEof45: - m.cs = 45 - goto _testEof - _testEof41: - m.cs = 41 - goto _testEof - _testEof42: - m.cs = 42 - goto _testEof - _testEof43: - m.cs = 43 - goto _testEof - _testEof46: - m.cs = 46 - goto _testEof - _testEof: { } if (m.p) == (m.eof) { - switch m.cs { - case 44, 45: + switch _eofActions[m.cs] { + case 1: - raw := m.text() - output.SS = string(raw) - // Iterate upper letters lowering them - for _, i := range m.tolower { - raw[i] = raw[i] + 32 - } - output.norm = string(raw) + m.err = fmt.Errorf(errPrefix, m.p) + (m.p)-- - case 1, 2, 4: + m.cs = 193 + goto _again - m.err = fmt.Errorf(errParse, m.p) + case 6: + + m.err = fmt.Errorf(errIdentifier, m.p) (m.p)-- - { - goto st46 - } + m.cs = 193 + goto _again - case 3: + case 8: - m.err = fmt.Errorf(errPrefix, m.p) + m.err = fmt.Errorf(errSpecificString, m.p) (m.p)-- - { - goto st46 + m.cs = 193 + goto _again + + case 24: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + } - m.err = fmt.Errorf(errParse, m.p) + case 12: + + m.err = fmt.Errorf(errSCIMNamespace, m.p) (m.p)-- - { - goto st46 - } + m.cs = 193 + goto _again - case 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 41: + case 14: - m.err = fmt.Errorf(errIdentifier, m.p) + m.err = fmt.Errorf(errSCIMType, m.p) (m.p)-- - { - goto st46 - } + m.cs = 193 + goto _again + + case 16: - m.err = fmt.Errorf(errParse, m.p) + m.err = fmt.Errorf(errSCIMName, m.p) (m.p)-- - { - goto st46 + m.cs = 193 + goto _again + + case 18: + + if m.p == m.pe { + m.err = fmt.Errorf(errSCIMOtherIncomplete, m.p-1) + } else { + m.err = fmt.Errorf(errSCIMOther, m.p) } + (m.p)-- - case 38: + m.cs = 193 + goto _again - m.err = fmt.Errorf(errSpecificString, m.p) + case 23: + + m.err = fmt.Errorf(err8141SpecificString, m.p) (m.p)-- - { - goto st46 - } + m.cs = 193 + goto _again + + case 22: - m.err = fmt.Errorf(errParse, m.p) + m.err = fmt.Errorf(err8141Identifier, m.p) (m.p)-- - { - goto st46 - } + m.cs = 193 + goto _again - case 42: + case 26: - m.err = fmt.Errorf(errPrefix, m.p) + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 31: + + m.err = fmt.Errorf(err8141MalformedQComp, m.p) (m.p)-- - { - goto st46 + m.cs = 193 + goto _again + + case 34: + + output.SS = string(m.text()) + // Iterate upper letters lowering them + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] + 32 + } + output.norm = string(m.text()) + // Revert the buffer to the original + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] - 32 + } + + output.kind = RFC2141 + + case 38: + + output.SS = string(m.text()) + // Iterate upper letters lowering them + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] + 32 + } + output.norm = string(m.text()) + // Revert the buffer to the original + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] - 32 } + output.kind = RFC8141 + + case 4: + m.err = fmt.Errorf(errIdentifier, m.p) (m.p)-- - { - goto st46 - } + m.cs = 193 + goto _again - m.err = fmt.Errorf(errParse, m.p) + m.err = fmt.Errorf(errPrefix, m.p) (m.p)-- - { - goto st46 - } + m.cs = 193 + goto _again - case 43: + case 11: + + m.err = fmt.Errorf(errIdentifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again m.err = fmt.Errorf(errNoUrnWithinID, m.p) (m.p)-- - { - goto st46 + m.cs = 193 + goto _again + + case 9: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + } - m.err = fmt.Errorf(errIdentifier, m.p) + m.err = fmt.Errorf(errSpecificString, m.p) (m.p)-- - { - goto st46 + m.cs = 193 + goto _again + + case 20: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + } - m.err = fmt.Errorf(errParse, m.p) + if m.p == m.pe { + m.err = fmt.Errorf(errSCIMOtherIncomplete, m.p-1) + } else { + m.err = fmt.Errorf(errSCIMOther, m.p) + } (m.p)-- - { - goto st46 + m.cs = 193 + goto _again + + case 25: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + } - case 39, 40: + m.err = fmt.Errorf(err8141SpecificString, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 28: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } - m.err = fmt.Errorf(errHex, m.p) + m.err = fmt.Errorf(err8141MalformedRComp, m.p) (m.p)-- - { - goto st46 + m.cs = 193 + goto _again + + case 29: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + } - m.err = fmt.Errorf(errSpecificString, m.p) + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 21: + + m.err = fmt.Errorf(err8141Identifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(errPrefix, m.p) (m.p)-- - { - goto st46 + m.cs = 193 + goto _again + + case 42: + + output.rComponent = string(m.text()) + + output.kind = RFC8141 + + case 48: + + output.qComponent = string(m.text()) + + output.kind = RFC8141 + + case 41: + + output.fComponent = string(m.text()) + + output.kind = RFC8141 + + case 40: + + m.pb = m.p + + output.fComponent = string(m.text()) + + output.kind = RFC8141 + + case 30: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + } - m.err = fmt.Errorf(errParse, m.p) + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(err8141MalformedQComp, m.p) (m.p)-- - { - goto st46 + m.cs = 193 + goto _again + + case 35: + + output.scim.Name = string(m.data[output.scim.pos:m.p]) + + output.SS = string(m.text()) + // Iterate upper letters lowering them + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] + 32 + } + output.norm = string(m.text()) + // Revert the buffer to the original + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] - 32 + } + + output.kind = RFC7643 + + case 37: + + output.scim.Other = string(m.data[output.scim.pos:m.p]) + + output.SS = string(m.text()) + // Iterate upper letters lowering them + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] + 32 + } + output.norm = string(m.text()) + // Revert the buffer to the original + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] - 32 + } + + output.kind = RFC7643 + + case 44: + + if output.rStart { + m.err = fmt.Errorf(err8141RComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + output.rStart = true + + output.rComponent = string(m.text()) + + output.kind = RFC8141 + + case 50: + + if output.qStart { + m.err = fmt.Errorf(err8141QComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + } + output.qStart = true + + output.qComponent = string(m.text()) + + output.kind = RFC8141 } } @@ -1686,3 +5031,16 @@ func (m *machine) Parse(input []byte) (*URN, error) { return output, nil } + +func (m *machine) WithParsingMode(x ParsingMode) { + m.parsingMode = x + switch m.parsingMode { + case RFC2141Only: + m.startParsingAt = enMain + case RFC8141Only: + m.startParsingAt = enRfc8141Only + case RFC7643Only: + m.startParsingAt = enScimOnly + } + m.parsingModeSet = true +} diff --git a/vendor/github.com/leodido/go-urn/machine.go.rl b/vendor/github.com/leodido/go-urn/machine.go.rl index 3bc05a651..0a1742199 100644 --- a/vendor/github.com/leodido/go-urn/machine.go.rl +++ b/vendor/github.com/leodido/go-urn/machine.go.rl @@ -2,15 +2,28 @@ package urn import ( "fmt" + + scimschema "github.com/leodido/go-urn/scim/schema" ) var ( - errPrefix = "expecting the prefix to be the \"urn\" string (whatever case) [col %d]" - errIdentifier = "expecting the identifier to be string (1..31 alnum chars, also containing dashes but not at its start) [col %d]" - errSpecificString = "expecting the specific string to be a string containing alnum, hex, or others ([()+,-.:=@;$_!*']) chars [col %d]" - errNoUrnWithinID = "expecting the identifier to not contain the \"urn\" reserved string [col %d]" - errHex = "expecting the specific string hex chars to be well-formed (%%alnum{2}) [col %d]" - errParse = "parsing error [col %d]" + errPrefix = "expecting the prefix to be the \"urn\" string (whatever case) [col %d]" + errIdentifier = "expecting the identifier to be string (1..31 alnum chars, also containing dashes but not at its beginning) [col %d]" + errSpecificString = "expecting the specific string to be a string containing alnum, hex, or others ([()+,-.:=@;$_!*']) chars [col %d]" + errNoUrnWithinID = "expecting the identifier to not contain the \"urn\" reserved string [col %d]" + errHex = "expecting the percent encoded chars to be well-formed (%%alnum{2}) [col %d]" + errSCIMNamespace = "expecing the SCIM namespace identifier (ietf:params:scim) [col %d]" + errSCIMType = "expecting a correct SCIM type (schemas, api, param) [col %d]" + errSCIMName = "expecting one or more alnum char in the SCIM name part [col %d]" + errSCIMOther = "expecting a well-formed other SCIM part [col %d]" + errSCIMOtherIncomplete = "expecting a not empty SCIM other part after colon [col %d]" + err8141InformalID = "informal URN namespace must be in the form urn-[1-9][0-9] [col %d]" + err8141SpecificString = "expecting the specific string to contain alnum, hex, or others ([~&()+,-.:=@;$_!*'] or [/?] not in first position) chars [col %d]" + err8141Identifier = "expecting the indentifier to be a string with (length 2 to 32 chars) containing alnum (or dashes) not starting or ending with a dash [col %d]" + err8141RComponentStart = "expecting only one r-component (starting with the ?+ sequence) [col %d]" + err8141QComponentStart = "expecting only one q-component (starting with the ?= sequence) [col %d]" + err8141MalformedRComp = "expecting a non-empty r-component containing alnum, hex, or others ([~&()+,-.:=@;$_!*'] or [/?] but not at its beginning) [col %d]" + err8141MalformedQComp = "expecting a non-empty q-component containing alnum, hex, or others ([~&()+,-.:=@;$_!*'] or [/?] but not at its beginning) [col %d]" ) %%{ @@ -24,25 +37,42 @@ action mark { } action tolower { - m.tolower = append(m.tolower, m.p - m.pb) + // List of positions in the buffer to later lowercase + output.tolower = append(output.tolower, m.p - m.pb) } action set_pre { output.prefix = string(m.text()) } +action throw_pre_urn_err { + if m.parsingMode != RFC8141Only { + // Throw an error when: + // - we are entering here matching the the prefix in the namespace identifier part + // - looking ahead (3 chars) we find a colon + if pos := m.p + 3; pos < m.pe && m.data[pos] == 58 && output.prefix != "" { + m.err = fmt.Errorf(errNoUrnWithinID, pos) + fhold; + fgoto fail; + } + } +} + action set_nid { output.ID = string(m.text()) } action set_nss { - raw := m.text() - output.SS = string(raw) + output.SS = string(m.text()) // Iterate upper letters lowering them - for _, i := range m.tolower { - raw[i] = raw[i] + 32 + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] + 32 + } + output.norm = string(m.text()) + // Revert the buffer to the original + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] - 32 } - output.norm = string(raw) } action err_pre { @@ -70,30 +100,200 @@ action err_urn { } action err_hex { - m.err = fmt.Errorf(errHex, m.p) + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + fhold; + fgoto fail; + } +} + +action base_type { + output.kind = RFC2141; +} + +pre = ([uU] @err(err_pre) [rR] @err(err_pre) [nN] @err(err_pre)) >mark >throw_pre_urn_err %set_pre; + +nid = (alnum >mark (alnum | '-'){0,31}) $err(err_nid) %set_nid; + +hex = '%' (digit | lower | upper >tolower){2} $err(err_hex); + +sss = (alnum | [()+,\-.:=@;$_!*']); + +nss = (sss | hex)+ $err(err_nss); + +nid_not_urn = (nid - pre %err(err_urn)); + +urn = pre ':' @err(err_pre) (nid_not_urn ':' nss >mark %set_nss) %eof(base_type); + +### SCIM BEG + +action err_scim_nid { + m.err = fmt.Errorf(errSCIMNamespace, m.p) fhold; fgoto fail; } -action err_parse { - m.err = fmt.Errorf(errParse, m.p) +action err_scim_type { + m.err = fmt.Errorf(errSCIMType, m.p) fhold; fgoto fail; } -pre = ([uU][rR][nN] @err(err_pre)) >mark %set_pre; +action err_scim_name { + m.err = fmt.Errorf(errSCIMName, m.p) + fhold; + fgoto fail; +} -nid = (alnum >mark (alnum | '-'){0,31}) %set_nid; +action err_scim_other { + if m.p == m.pe { + m.err = fmt.Errorf(errSCIMOtherIncomplete, m.p-1) + } else { + m.err = fmt.Errorf(errSCIMOther, m.p) + } + fhold; + fgoto fail; +} -hex = '%' (digit | lower | upper >tolower){2} $err(err_hex); +action scim_type { + output.kind = RFC7643; +} -sss = (alnum | [()+,\-.:=@;$_!*']); +action create_scim { + output.scim = &SCIM{}; +} -nss = (sss | hex)+ $err(err_nss); +action set_scim_type { + output.scim.Type = scimschema.TypeFromString(string(m.text())) +} + +action mark_scim_name { + output.scim.pos = m.p +} + +action set_scim_name { + output.scim.Name = string(m.data[output.scim.pos:m.p]) +} + +action mark_scim_other { + output.scim.pos = m.p +} + +action set_scim_other { + output.scim.Other = string(m.data[output.scim.pos:m.p]) +} + +scim_nid = 'ietf:params:scim' >mark %set_nid %create_scim $err(err_scim_nid); + +scim_other = ':' (sss | hex)+ >mark_scim_other %set_scim_other $err(err_scim_other); + +scim_name = (alnum)+ >mark_scim_name %set_scim_name $err(err_scim_name); + +scim_type = ('schemas' | 'api' | 'param') >mark %set_scim_type $err(err_scim_type); + +scim_only := pre ':' @err(err_pre) (scim_nid ':' scim_type ':' scim_name scim_other? %set_nss) %eof(scim_type); + +### SCIM END + +### 8141 BEG + +action err_nss_8141 { + m.err = fmt.Errorf(err8141SpecificString, m.p) + fhold; + fgoto fail; +} + +action err_nid_8141 { + m.err = fmt.Errorf(err8141Identifier, m.p) + fhold; + fgoto fail; +} + +action rfc8141_type { + output.kind = RFC8141; +} + +action set_r_component { + output.rComponent = string(m.text()) +} + +action set_q_component { + output.qComponent = string(m.text()) +} + +action set_f_component { + output.fComponent = string(m.text()) +} + +action informal_nid_match { + fhold; + m.err = fmt.Errorf(err8141InformalID, m.p); + fgoto fail; +} + +action mark_r_start { + if output.rStart { + m.err = fmt.Errorf(err8141RComponentStart, m.p) + fhold; + fgoto fail; + } + output.rStart = true +} + +action mark_q_start { + if output.qStart { + m.err = fmt.Errorf(err8141QComponentStart, m.p) + fhold; + fgoto fail; + } + output.qStart = true +} + +action err_malformed_r_component { + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + fhold; + fgoto fail; +} + +action err_malformed_q_component { + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + fhold; + fgoto fail; +} + +pchar = (sss | '~' | '&' | hex); + +component = pchar (pchar | '/' | '?')*; + +r_start = ('?+') %mark_r_start; + +r_component = r_start <: (r_start | component)+ $err(err_malformed_r_component) >mark %set_r_component; + +q_start = ('?=') %mark_q_start; + +q_component = q_start <: (q_start | component)+ $err(err_malformed_q_component) >mark %set_q_component; + +rq_components = (r_component :>> q_component? | q_component); + +fragment = (pchar | '/' | '?')*; + +f_component = '#' fragment >mark %set_f_component; + +nss_rfc8141 = (pchar >mark (pchar | '/')*) $err(err_nss_8141) %set_nss; + +nid_rfc8141 = (alnum >mark (alnum | '-'){0,30} alnum) $err(err_nid_8141) %set_nid; + +informal_id = pre ('-' [a-zA-z0] %to(informal_nid_match)); + +nid_rfc8141_not_urn = (nid_rfc8141 - informal_id?); + +rfc8141_only := pre ':' @err(err_pre) nid_rfc8141_not_urn ':' nss_rfc8141 rq_components? f_component? %eof(rfc8141_type); + +### 8141 END fail := (any - [\n\r])* @err{ fgoto main; }; -main := (pre ':' (nid - pre %err(err_urn)) $err(err_nid) ':' nss >mark %set_nss) $err(err_parse); +main := urn; }%% @@ -103,6 +303,7 @@ main := (pre ':' (nid - pre %err(err_urn)) $err(err_nid) ':' nss >mark %set_nss) type Machine interface { Error() error Parse(input []byte) (*URN, error) + WithParsingMode(ParsingMode) } type machine struct { @@ -110,12 +311,24 @@ type machine struct { cs int p, pe, eof, pb int err error - tolower []int + startParsingAt int + parsingMode ParsingMode + parsingModeSet bool } // NewMachine creates a new FSM able to parse RFC 2141 strings. -func NewMachine() Machine { - m := &machine{} +func NewMachine(options ...Option) Machine { + m := &machine{ + parsingModeSet: false, + } + + for _, o := range options { + o(m) + } + // Set default parsing mode + if !m.parsingModeSet { + m.WithParsingMode(DefaultParsingMode) + } %% access m.; %% variable p m.p; @@ -137,7 +350,7 @@ func (m *machine) text() []byte { return m.data[m.pb:m.p] } -// Parse parses the input byte array as a RFC 2141 string. +// Parse parses the input byte array as a RFC 2141 or RFC7643 string. func (m *machine) Parse(input []byte) (*URN, error) { m.data = input m.p = 0 @@ -145,10 +358,11 @@ func (m *machine) Parse(input []byte) (*URN, error) { m.pe = len(input) m.eof = len(input) m.err = nil - m.tolower = []int{} - output := &URN{} + m.cs = m.startParsingAt + output := &URN{ + tolower: []int{}, + } - %% write init; %% write exec; if m.cs < first_final || m.cs == en_fail { @@ -157,3 +371,16 @@ func (m *machine) Parse(input []byte) (*URN, error) { return output, nil } + +func (m *machine) WithParsingMode(x ParsingMode) { + m.parsingMode = x + switch m.parsingMode { + case RFC2141Only: + m.startParsingAt = en_main + case RFC8141Only: + m.startParsingAt = en_rfc8141_only + case RFC7643Only: + m.startParsingAt = en_scim_only + } + m.parsingModeSet = true +} \ No newline at end of file diff --git a/vendor/github.com/leodido/go-urn/makefile b/vendor/github.com/leodido/go-urn/makefile index df87cdc6d..68d5dd0f1 100644 --- a/vendor/github.com/leodido/go-urn/makefile +++ b/vendor/github.com/leodido/go-urn/makefile @@ -15,18 +15,24 @@ clean: .PHONY: images images: docs/urn.png +.PHONY: snake2camel +snake2camel: + @cd ./tools/snake2camel; go build -o ../../snake2camel . + .PHONY: removecomments removecomments: @cd ./tools/removecomments; go build -o ../../removecomments . machine.go: machine.go.rl +machine.go: snake2camel + machine.go: removecomments machine.go: - $(RAGEL) -Z -G2 -e -o $@ $< + $(RAGEL) -Z -G1 -e -o $@ $< @./removecomments $@ - $(MAKE) -s file=$@ snake2camel + @./snake2camel $@ $(GOFMT) $@ docs/urn.dot: machine.go.rl @@ -41,13 +47,5 @@ bench: *_test.go machine.go go test -bench=. -benchmem -benchtime=5s ./... .PHONY: tests -tests: *_test.go +tests: *_test.go $(GO_TEST) ./... - -.PHONY: snake2camel -snake2camel: - @awk -i inplace '{ \ - while ( match($$0, /(.*)([a-z]+[0-9]*)_([a-zA-Z0-9])(.*)/, cap) ) \ - $$0 = cap[1] cap[2] toupper(cap[3]) cap[4]; \ - print \ - }' $(file) diff --git a/vendor/github.com/leodido/go-urn/options.go b/vendor/github.com/leodido/go-urn/options.go new file mode 100644 index 000000000..c543835a2 --- /dev/null +++ b/vendor/github.com/leodido/go-urn/options.go @@ -0,0 +1,9 @@ +package urn + +type Option func(Machine) + +func WithParsingMode(mode ParsingMode) Option { + return func(m Machine) { + m.WithParsingMode(mode) + } +} diff --git a/vendor/github.com/leodido/go-urn/parsing_mode.go b/vendor/github.com/leodido/go-urn/parsing_mode.go new file mode 100644 index 000000000..fce5aadc3 --- /dev/null +++ b/vendor/github.com/leodido/go-urn/parsing_mode.go @@ -0,0 +1,12 @@ +package urn + +type ParsingMode int + +const ( + Default ParsingMode = iota + RFC2141Only + RFC7643Only + RFC8141Only +) + +const DefaultParsingMode = RFC2141Only diff --git a/vendor/github.com/leodido/go-urn/scim.go b/vendor/github.com/leodido/go-urn/scim.go new file mode 100644 index 000000000..f6b7aefba --- /dev/null +++ b/vendor/github.com/leodido/go-urn/scim.go @@ -0,0 +1,48 @@ +package urn + +import ( + "encoding/json" + "fmt" + + scimschema "github.com/leodido/go-urn/scim/schema" +) + +const errInvalidSCIMURN = "invalid SCIM URN: %s" + +type SCIM struct { + Type scimschema.Type + Name string + Other string + pos int +} + +func (s SCIM) MarshalJSON() ([]byte, error) { + return json.Marshal(s.String()) +} + +func (s *SCIM) UnmarshalJSON(bytes []byte) error { + var str string + if err := json.Unmarshal(bytes, &str); err != nil { + return err + } + // Parse as SCIM + value, ok := Parse([]byte(str), WithParsingMode(RFC7643Only)) + if !ok { + return fmt.Errorf(errInvalidSCIMURN, str) + } + if value.RFC() != RFC7643 { + return fmt.Errorf(errInvalidSCIMURN, str) + } + *s = *value.SCIM() + + return nil +} + +func (s *SCIM) String() string { + ret := fmt.Sprintf("urn:ietf:params:scim:%s:%s", s.Type.String(), s.Name) + if s.Other != "" { + ret += fmt.Sprintf(":%s", s.Other) + } + + return ret +} diff --git a/vendor/github.com/leodido/go-urn/scim/schema/type.go b/vendor/github.com/leodido/go-urn/scim/schema/type.go new file mode 100644 index 000000000..134918230 --- /dev/null +++ b/vendor/github.com/leodido/go-urn/scim/schema/type.go @@ -0,0 +1,36 @@ +package scimschema + +type Type int + +const ( + Unsupported Type = iota + Schemas + API + Param +) + +func (t Type) String() string { + switch t { + case Schemas: + return "schemas" + case API: + return "api" + case Param: + return "param" + } + + return "" +} + +func TypeFromString(input string) Type { + switch input { + case "schemas": + return Schemas + case "api": + return API + case "param": + return Param + } + + return Unsupported +} diff --git a/vendor/github.com/leodido/go-urn/urn.go b/vendor/github.com/leodido/go-urn/urn.go index d51a6c915..894d6258d 100644 --- a/vendor/github.com/leodido/go-urn/urn.go +++ b/vendor/github.com/leodido/go-urn/urn.go @@ -16,10 +16,18 @@ const errInvalidURN = "invalid URN: %s" // // Details at https://tools.ietf.org/html/rfc2141. type URN struct { - prefix string // Static prefix. Equal to "urn" when empty. - ID string // Namespace identifier - SS string // Namespace specific string - norm string // Normalized namespace specific string + prefix string // Static prefix. Equal to "urn" when empty. + ID string // Namespace identifier (NID) + SS string // Namespace specific string (NSS) + norm string // Normalized namespace specific string + kind Kind + scim *SCIM + rComponent string // RFC8141 + qComponent string // RFC8141 + fComponent string // RFC8141 + rStart bool // RFC8141 + qStart bool // RFC8141 + tolower []int } // Normalize turns the receiving URN into its norm version. @@ -30,12 +38,21 @@ func (u *URN) Normalize() *URN { prefix: "urn", ID: strings.ToLower(u.ID), SS: u.norm, + // rComponent: u.rComponent, + // qComponent: u.qComponent, + // fComponent: u.fComponent, } } // Equal checks the lexical equivalence of the current URN with another one. func (u *URN) Equal(x *URN) bool { - return *u.Normalize() == *x.Normalize() + if x == nil { + return false + } + nu := u.Normalize() + nx := x.Normalize() + + return nu.prefix == nx.prefix && nu.ID == nx.ID && nu.SS == nx.SS } // String reassembles the URN into a valid URN string. @@ -51,14 +68,23 @@ func (u *URN) String() string { res += "urn" } res += u.prefix + ":" + u.ID + ":" + u.SS + if u.rComponent != "" { + res += "?+" + u.rComponent + } + if u.qComponent != "" { + res += "?=" + u.qComponent + } + if u.fComponent != "" { + res += "#" + u.fComponent + } } return res } -// Parse is responsible to create an URN instance from a byte array matching the correct URN syntax. -func Parse(u []byte) (*URN, bool) { - urn, err := NewMachine().Parse(u) +// Parse is responsible to create an URN instance from a byte array matching the correct URN syntax (RFC 2141). +func Parse(u []byte, options ...Option) (*URN, bool) { + urn, err := NewMachine(options...).Parse(u) if err != nil { return nil, false } @@ -71,7 +97,7 @@ func (u URN) MarshalJSON() ([]byte, error) { return json.Marshal(u.String()) } -// MarshalJSON unmarshals a URN from JSON string form (e.g. `"urn:oid:1.2.3.4"`). +// UnmarshalJSON unmarshals a URN from JSON string form (e.g. `"urn:oid:1.2.3.4"`). func (u *URN) UnmarshalJSON(bytes []byte) error { var str string if err := json.Unmarshal(bytes, &str); err != nil { @@ -82,5 +108,34 @@ func (u *URN) UnmarshalJSON(bytes []byte) error { } else { *u = *value } + return nil -} \ No newline at end of file +} + +func (u *URN) IsSCIM() bool { + return u.kind == RFC7643 +} + +func (u *URN) SCIM() *SCIM { + if u.kind != RFC7643 { + return nil + } + + return u.scim +} + +func (u *URN) RFC() Kind { + return u.kind +} + +func (u *URN) FComponent() string { + return u.fComponent +} + +func (u *URN) QComponent() string { + return u.qComponent +} + +func (u *URN) RComponent() string { + return u.rComponent +} diff --git a/vendor/github.com/leodido/go-urn/urn8141.go b/vendor/github.com/leodido/go-urn/urn8141.go new file mode 100644 index 000000000..da4dd062e --- /dev/null +++ b/vendor/github.com/leodido/go-urn/urn8141.go @@ -0,0 +1,30 @@ +package urn + +import ( + "encoding/json" + "fmt" +) + +const errInvalidURN8141 = "invalid URN per RFC 8141: %s" + +type URN8141 struct { + *URN +} + +func (u URN8141) MarshalJSON() ([]byte, error) { + return json.Marshal(u.String()) +} + +func (u *URN8141) UnmarshalJSON(bytes []byte) error { + var str string + if err := json.Unmarshal(bytes, &str); err != nil { + return err + } + if value, ok := Parse([]byte(str), WithParsingMode(RFC8141Only)); !ok { + return fmt.Errorf(errInvalidURN8141, str) + } else { + *u = URN8141{value} + } + + return nil +} diff --git a/vendor/github.com/ugorji/go/codec/cbor.go b/vendor/github.com/ugorji/go/codec/cbor.go index 10944487e..802b1fc1d 100644 --- a/vendor/github.com/ugorji/go/codec/cbor.go +++ b/vendor/github.com/ugorji/go/codec/cbor.go @@ -123,6 +123,11 @@ type cborEncDriver struct { encDriverNoopContainerWriter h *CborHandle + // scratch buffer for: encode time, numbers, etc + // + // RFC3339Nano uses 35 chars: 2006-01-02T15:04:05.999999999Z07:00 + b [40]byte + e Encoder } @@ -204,7 +209,7 @@ func (e *cborEncDriver) EncodeTime(t time.Time) { e.EncodeNil() } else if e.h.TimeRFC3339 { e.encUint(0, cborBaseTag) - e.encStringBytesS(cborBaseString, t.Format(time.RFC3339Nano)) + e.encStringBytesS(cborBaseString, stringView(fmtTime(t, time.RFC3339Nano, e.b[:0]))) } else { e.encUint(1, cborBaseTag) t = t.UTC().Round(time.Microsecond) @@ -427,12 +432,13 @@ func (d *cborDecDriver) decLen() int { return int(d.decUint()) } -func (d *cborDecDriver) decAppendIndefiniteBytes(bs []byte) []byte { +func (d *cborDecDriver) decAppendIndefiniteBytes(bs []byte, major byte) []byte { d.bdRead = false for !d.CheckBreak() { - if major := d.bd >> 5; major != cborMajorBytes && major != cborMajorString { - d.d.errorf("invalid indefinite string/bytes %x (%s); got major %v, expected %v or %v", - d.bd, cbordesc(d.bd), major, cborMajorBytes, cborMajorString) + chunkMajor := d.bd >> 5 + if chunkMajor != major { + d.d.errorf("malformed indefinite string/bytes %x (%s); contains chunk with major type %v, expected %v", + d.bd, cbordesc(d.bd), chunkMajor, major) } n := uint(d.decLen()) oldLen := uint(len(bs)) @@ -445,6 +451,9 @@ func (d *cborDecDriver) decAppendIndefiniteBytes(bs []byte) []byte { bs = bs[:newLen] } d.d.decRd.readb(bs[oldLen:newLen]) + if d.h.ValidateUnicode && major == cborMajorString && !utf8.Valid(bs[oldLen:newLen]) { + d.d.errorf("indefinite-length text string contains chunk that is not a valid utf-8 sequence: 0x%x", bs[oldLen:newLen]) + } d.bdRead = false } d.bdRead = false @@ -580,9 +589,9 @@ func (d *cborDecDriver) DecodeBytes(bs []byte) (bsOut []byte) { d.bdRead = false if bs == nil { d.d.decByteState = decByteStateReuseBuf - return d.decAppendIndefiniteBytes(d.d.b[:0]) + return d.decAppendIndefiniteBytes(d.d.b[:0], d.bd>>5) } - return d.decAppendIndefiniteBytes(bs[:0]) + return d.decAppendIndefiniteBytes(bs[:0], d.bd>>5) } if d.bd == cborBdIndefiniteArray { d.bdRead = false diff --git a/vendor/github.com/ugorji/go/codec/decode.go b/vendor/github.com/ugorji/go/codec/decode.go index d549188de..f98c8ff2d 100644 --- a/vendor/github.com/ugorji/go/codec/decode.go +++ b/vendor/github.com/ugorji/go/codec/decode.go @@ -1399,6 +1399,10 @@ func NewDecoderString(s string, h Handle) *Decoder { return NewDecoderBytes(bytesView(s), h) } +func (d *Decoder) HandleName() string { + return d.hh.Name() +} + func (d *Decoder) r() *decRd { return &d.decRd } @@ -1580,14 +1584,9 @@ func (d *Decoder) MustDecode(v interface{}) { d.calls-- } -// Release releases shared (pooled) resources. -// -// It is important to call Release() when done with a Decoder, so those resources -// are released instantly for use by subsequently created Decoders. -// -// By default, Release() is automatically called unless the option ExplicitRelease is set. +// Release is a no-op. // -// Deprecated: Release is a no-op as pooled resources are not used with an Decoder. +// Deprecated: Pooled resources are not used with a Decoder. // This method is kept for compatibility reasons only. func (d *Decoder) Release() { } diff --git a/vendor/github.com/ugorji/go/codec/encode.go b/vendor/github.com/ugorji/go/codec/encode.go index 70361b5cc..0e9f0cc05 100644 --- a/vendor/github.com/ugorji/go/codec/encode.go +++ b/vendor/github.com/ugorji/go/codec/encode.go @@ -984,6 +984,10 @@ func NewEncoderBytes(out *[]byte, h Handle) *Encoder { return e } +func (e *Encoder) HandleName() string { + return e.hh.Name() +} + func (e *Encoder) init(h Handle) { initHandle(h) e.err = errEncoderNotInitialized @@ -1150,12 +1154,9 @@ func (e *Encoder) MustEncode(v interface{}) { } } -// Release releases shared (pooled) resources. -// -// It is important to call Release() when done with an Encoder, so those resources -// are released instantly for use by subsequently created Encoders. +// Release is a no-op. // -// Deprecated: Release is a no-op as pooled resources are not used with an Encoder. +// Deprecated: Pooled resources are not used with an Encoder. // This method is kept for compatibility reasons only. func (e *Encoder) Release() { } diff --git a/vendor/github.com/ugorji/go/codec/gen.go b/vendor/github.com/ugorji/go/codec/gen.go index de7ee72f1..0026e3e1c 100644 --- a/vendor/github.com/ugorji/go/codec/gen.go +++ b/vendor/github.com/ugorji/go/codec/gen.go @@ -8,7 +8,7 @@ package codec import ( "bytes" - "encoding/base64" + "encoding/base32" "errors" "fmt" "go/format" @@ -190,7 +190,11 @@ var ( errGenExpectArrayOrMap = errors.New("unexpected type - expecting array/map/slice") errGenUnexpectedTypeFastpath = errors.New("fast-path: unexpected type - requires map or slice") - genBase64enc = base64.NewEncoding("ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789__") + // don't use base64, only 63 characters allowed in valid go identifiers + // ie ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789_ + // + // don't use numbers, as a valid go identifer must start with a letter. + genTypenameEnc = base32.NewEncoding("ABCDEFGHIJKLMNOPQRSTUVWXYZabcdef") genQNameRegex = regexp.MustCompile(`[A-Za-z_.]+`) ) @@ -2303,8 +2307,6 @@ func genMethodNameT(t reflect.Type, tRef reflect.Type) (n string) { } } else { // best way to get the package name inclusive - // return ptrPfx + strings.Replace(tstr, ".", "_", 1000) - // return ptrPfx + genBase64enc.EncodeToString([]byte(tstr)) if t.Name() != "" && genQNameRegex.MatchString(tstr) { return ptrPfx + strings.Replace(tstr, ".", "_", 1000) } else { @@ -2315,12 +2317,12 @@ func genMethodNameT(t reflect.Type, tRef reflect.Type) (n string) { } } -// genCustomNameForType base64encodes the t.String() value in such a way +// genCustomNameForType base32 encodes the t.String() value in such a way // that it can be used within a function name. func genCustomTypeName(tstr string) string { - len2 := genBase64enc.EncodedLen(len(tstr)) + len2 := genTypenameEnc.EncodedLen(len(tstr)) bufx := make([]byte, len2) - genBase64enc.Encode(bufx, []byte(tstr)) + genTypenameEnc.Encode(bufx, []byte(tstr)) for i := len2 - 1; i >= 0; i-- { if bufx[i] == '=' { len2-- diff --git a/vendor/github.com/ugorji/go/codec/helper.go b/vendor/github.com/ugorji/go/codec/helper.go index 19df27b60..ecd87ba53 100644 --- a/vendor/github.com/ugorji/go/codec/helper.go +++ b/vendor/github.com/ugorji/go/codec/helper.go @@ -110,8 +110,7 @@ package codec // // ------------------------------------------ // Bounds Checking -// - Allow bytesDecReader to incur "bounds check error", and -// recover that as an io.EOF. +// - Allow bytesDecReader to incur "bounds check error", and recover that as an io error. // This allows the bounds check branch to always be taken by the branch predictor, // giving better performance (in theory), while ensuring that the code is shorter. // @@ -857,26 +856,10 @@ type BasicHandle struct { // Once a Handle has been initialized (used), do not modify this option. It will be ignored. TimeNotBuiltin bool - // ExplicitRelease configures whether Release() is implicitly called after an encode or - // decode call. + // ExplicitRelease is ignored and has no effect. // - // If you will hold onto an Encoder or Decoder for re-use, by calling Reset(...) - // on it or calling (Must)Encode repeatedly into a given []byte or io.Writer, - // then you do not want it to be implicitly closed after each Encode/Decode call. - // Doing so will unnecessarily return resources to the shared pool, only for you to - // grab them right after again to do another Encode/Decode call. - // - // Instead, you configure ExplicitRelease=true, and you explicitly call Release() when - // you are truly done. - // - // As an alternative, you can explicitly set a finalizer - so its resources - // are returned to the shared pool before it is garbage-collected. Do it as below: - // runtime.SetFinalizer(e, (*Encoder).Release) - // runtime.SetFinalizer(d, (*Decoder).Release) - // - // Deprecated: This is not longer used as pools are only used for long-lived objects - // which are shared across goroutines. - // Setting this value has no effect. It is maintained for backward compatibility. + // Deprecated: Pools are only used for long-lived objects shared across goroutines. + // It is maintained for backward compatibility. ExplicitRelease bool // ---- cache line @@ -2489,7 +2472,7 @@ func panicValToErr(h errDecorator, v interface{}, err *error) { case runtime.Error: d, dok := h.(*Decoder) if dok && d.bytes && isSliceBoundsError(xerr.Error()) { - *err = io.EOF + *err = io.ErrUnexpectedEOF } else { h.wrapErr(xerr, err) } @@ -2803,7 +2786,7 @@ func freelistCapacity(length int) (capacity int) { // bytesFreelist is a list of byte buffers, sorted by cap. // // In anecdotal testing (running go test -tsd 1..6), we couldn't get -// the length ofthe list > 4 at any time. So we believe a linear search +// the length of the list > 4 at any time. So we believe a linear search // without bounds checking is sufficient. // // Typical usage model: @@ -2821,7 +2804,7 @@ func freelistCapacity(length int) (capacity int) { // v1 := v0 // ... use v1 ... // blist.put(v1) -// if byteSliceAddr(v0) != byteSliceAddr(v1) { +// if !byteSliceSameData(v0, v1) { // blist.put(v0) // } type bytesFreelist [][]byte diff --git a/vendor/github.com/ugorji/go/codec/json.go b/vendor/github.com/ugorji/go/codec/json.go index f7d2343e5..569b0cc9e 100644 --- a/vendor/github.com/ugorji/go/codec/json.go +++ b/vendor/github.com/ugorji/go/codec/json.go @@ -1301,6 +1301,9 @@ func (d *jsonDecDriver) DecodeNaked() { // Note also that the float values for NaN, +Inf or -Inf are encoded as null, // as suggested by NOTE 4 of the ECMA-262 ECMAScript Language Specification 5.1 edition. // see http://www.ecma-international.org/publications/files/ECMA-ST/Ecma-262.pdf . +// +// Note the following behaviour differences vs std-library encoding/json package: +// - struct field names matched in case-sensitive manner type JsonHandle struct { textEncodingType BasicHandle diff --git a/vendor/github.com/ugorji/go/codec/msgpack.go b/vendor/github.com/ugorji/go/codec/msgpack.go index c8b539d4e..c0861df5e 100644 --- a/vendor/github.com/ugorji/go/codec/msgpack.go +++ b/vendor/github.com/ugorji/go/codec/msgpack.go @@ -1174,7 +1174,7 @@ func (c *msgpackSpecRpcCodec) ReadRequestBody(body interface{}) error { func (c *msgpackSpecRpcCodec) parseCustomHeader(expectTypeByte byte, msgid *uint64, methodOrError *string) (err error) { if cls := c.cls.load(); cls.closed { - return io.EOF + return io.ErrUnexpectedEOF } // We read the response header by hand diff --git a/vendor/github.com/ugorji/go/codec/reader.go b/vendor/github.com/ugorji/go/codec/reader.go index 3fea9f4c7..ec5dac0e9 100644 --- a/vendor/github.com/ugorji/go/codec/reader.go +++ b/vendor/github.com/ugorji/go/codec/reader.go @@ -350,9 +350,9 @@ func (z *ioDecReader) unreadn1() { // bytesDecReader is a decReader that reads off a byte slice with zero copying // -// Note: we do not try to convert index'ing out of bounds to an io.EOF. +// Note: we do not try to convert index'ing out of bounds to an io error. // instead, we let it bubble up to the exported Encode/Decode method -// and recover it as an io.EOF. +// and recover it as an io error. // // Every function here MUST defensively check bounds either explicitly // or via a bounds check. diff --git a/vendor/golang.org/x/net/http2/transport.go b/vendor/golang.org/x/net/http2/transport.go index df578b86c..c2a5b44b3 100644 --- a/vendor/golang.org/x/net/http2/transport.go +++ b/vendor/golang.org/x/net/http2/transport.go @@ -2911,6 +2911,15 @@ func (rl *clientConnReadLoop) processWindowUpdate(f *WindowUpdateFrame) error { fl = &cs.flow } if !fl.add(int32(f.Increment)) { + // For stream, the sender sends RST_STREAM with an error code of FLOW_CONTROL_ERROR + if cs != nil { + rl.endStreamError(cs, StreamError{ + StreamID: f.StreamID, + Code: ErrCodeFlowControl, + }) + return nil + } + return ConnectionError(ErrCodeFlowControl) } cc.cond.Broadcast() diff --git a/vendor/golang.org/x/sys/unix/aliases.go b/vendor/golang.org/x/sys/unix/aliases.go index e7d3df4bd..b0e419857 100644 --- a/vendor/golang.org/x/sys/unix/aliases.go +++ b/vendor/golang.org/x/sys/unix/aliases.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build (aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos) && go1.9 +//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go b/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go index 16dc69937..2f0fa76e4 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build darwin && go1.12 +//go:build darwin package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd.go b/vendor/golang.org/x/sys/unix/syscall_freebsd.go index 64d1bb4db..2b57e0f73 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd.go @@ -13,6 +13,7 @@ package unix import ( + "errors" "sync" "unsafe" ) @@ -169,25 +170,26 @@ func Getfsstat(buf []Statfs_t, flags int) (n int, err error) { func Uname(uname *Utsname) error { mib := []_C_int{CTL_KERN, KERN_OSTYPE} n := unsafe.Sizeof(uname.Sysname) - if err := sysctl(mib, &uname.Sysname[0], &n, nil, 0); err != nil { + // Suppress ENOMEM errors to be compatible with the C library __xuname() implementation. + if err := sysctl(mib, &uname.Sysname[0], &n, nil, 0); err != nil && !errors.Is(err, ENOMEM) { return err } mib = []_C_int{CTL_KERN, KERN_HOSTNAME} n = unsafe.Sizeof(uname.Nodename) - if err := sysctl(mib, &uname.Nodename[0], &n, nil, 0); err != nil { + if err := sysctl(mib, &uname.Nodename[0], &n, nil, 0); err != nil && !errors.Is(err, ENOMEM) { return err } mib = []_C_int{CTL_KERN, KERN_OSRELEASE} n = unsafe.Sizeof(uname.Release) - if err := sysctl(mib, &uname.Release[0], &n, nil, 0); err != nil { + if err := sysctl(mib, &uname.Release[0], &n, nil, 0); err != nil && !errors.Is(err, ENOMEM) { return err } mib = []_C_int{CTL_KERN, KERN_VERSION} n = unsafe.Sizeof(uname.Version) - if err := sysctl(mib, &uname.Version[0], &n, nil, 0); err != nil { + if err := sysctl(mib, &uname.Version[0], &n, nil, 0); err != nil && !errors.Is(err, ENOMEM) { return err } @@ -205,7 +207,7 @@ func Uname(uname *Utsname) error { mib = []_C_int{CTL_HW, HW_MACHINE} n = unsafe.Sizeof(uname.Machine) - if err := sysctl(mib, &uname.Machine[0], &n, nil, 0); err != nil { + if err := sysctl(mib, &uname.Machine[0], &n, nil, 0); err != nil && !errors.Is(err, ENOMEM) { return err } diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go index 0f85e29e6..5682e2628 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux.go @@ -1849,6 +1849,105 @@ func Dup2(oldfd, newfd int) error { //sys Fsmount(fd int, flags int, mountAttrs int) (fsfd int, err error) //sys Fsopen(fsName string, flags int) (fd int, err error) //sys Fspick(dirfd int, pathName string, flags int) (fd int, err error) + +//sys fsconfig(fd int, cmd uint, key *byte, value *byte, aux int) (err error) + +func fsconfigCommon(fd int, cmd uint, key string, value *byte, aux int) (err error) { + var keyp *byte + if keyp, err = BytePtrFromString(key); err != nil { + return + } + return fsconfig(fd, cmd, keyp, value, aux) +} + +// FsconfigSetFlag is equivalent to fsconfig(2) called +// with cmd == FSCONFIG_SET_FLAG. +// +// fd is the filesystem context to act upon. +// key the parameter key to set. +func FsconfigSetFlag(fd int, key string) (err error) { + return fsconfigCommon(fd, FSCONFIG_SET_FLAG, key, nil, 0) +} + +// FsconfigSetString is equivalent to fsconfig(2) called +// with cmd == FSCONFIG_SET_STRING. +// +// fd is the filesystem context to act upon. +// key the parameter key to set. +// value is the parameter value to set. +func FsconfigSetString(fd int, key string, value string) (err error) { + var valuep *byte + if valuep, err = BytePtrFromString(value); err != nil { + return + } + return fsconfigCommon(fd, FSCONFIG_SET_STRING, key, valuep, 0) +} + +// FsconfigSetBinary is equivalent to fsconfig(2) called +// with cmd == FSCONFIG_SET_BINARY. +// +// fd is the filesystem context to act upon. +// key the parameter key to set. +// value is the parameter value to set. +func FsconfigSetBinary(fd int, key string, value []byte) (err error) { + if len(value) == 0 { + return EINVAL + } + return fsconfigCommon(fd, FSCONFIG_SET_BINARY, key, &value[0], len(value)) +} + +// FsconfigSetPath is equivalent to fsconfig(2) called +// with cmd == FSCONFIG_SET_PATH. +// +// fd is the filesystem context to act upon. +// key the parameter key to set. +// path is a non-empty path for specified key. +// atfd is a file descriptor at which to start lookup from or AT_FDCWD. +func FsconfigSetPath(fd int, key string, path string, atfd int) (err error) { + var valuep *byte + if valuep, err = BytePtrFromString(path); err != nil { + return + } + return fsconfigCommon(fd, FSCONFIG_SET_PATH, key, valuep, atfd) +} + +// FsconfigSetPathEmpty is equivalent to fsconfig(2) called +// with cmd == FSCONFIG_SET_PATH_EMPTY. The same as +// FconfigSetPath but with AT_PATH_EMPTY implied. +func FsconfigSetPathEmpty(fd int, key string, path string, atfd int) (err error) { + var valuep *byte + if valuep, err = BytePtrFromString(path); err != nil { + return + } + return fsconfigCommon(fd, FSCONFIG_SET_PATH_EMPTY, key, valuep, atfd) +} + +// FsconfigSetFd is equivalent to fsconfig(2) called +// with cmd == FSCONFIG_SET_FD. +// +// fd is the filesystem context to act upon. +// key the parameter key to set. +// value is a file descriptor to be assigned to specified key. +func FsconfigSetFd(fd int, key string, value int) (err error) { + return fsconfigCommon(fd, FSCONFIG_SET_FD, key, nil, value) +} + +// FsconfigCreate is equivalent to fsconfig(2) called +// with cmd == FSCONFIG_CMD_CREATE. +// +// fd is the filesystem context to act upon. +func FsconfigCreate(fd int) (err error) { + return fsconfig(fd, FSCONFIG_CMD_CREATE, nil, nil, 0) +} + +// FsconfigReconfigure is equivalent to fsconfig(2) called +// with cmd == FSCONFIG_CMD_RECONFIGURE. +// +// fd is the filesystem context to act upon. +func FsconfigReconfigure(fd int) (err error) { + return fsconfig(fd, FSCONFIG_CMD_RECONFIGURE, nil, nil, 0) +} + //sys Getdents(fd int, buf []byte) (n int, err error) = SYS_GETDENTS64 //sysnb Getpgid(pid int) (pgid int, err error) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux.go b/vendor/golang.org/x/sys/unix/zsyscall_linux.go index 1488d2712..87d8612a1 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux.go @@ -906,6 +906,16 @@ func Fspick(dirfd int, pathName string, flags int) (fd int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fsconfig(fd int, cmd uint, key *byte, value *byte, aux int) (err error) { + _, _, e1 := Syscall6(SYS_FSCONFIG, uintptr(fd), uintptr(cmd), uintptr(unsafe.Pointer(key)), uintptr(unsafe.Pointer(value)), uintptr(aux), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Getdents(fd int, buf []byte) (n int, err error) { var _p0 unsafe.Pointer if len(buf) > 0 { diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux.go b/vendor/golang.org/x/sys/unix/ztypes_linux.go index dc0c955ee..eff6bcdef 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux.go @@ -836,6 +836,15 @@ const ( FSPICK_EMPTY_PATH = 0x8 FSMOUNT_CLOEXEC = 0x1 + + FSCONFIG_SET_FLAG = 0x0 + FSCONFIG_SET_STRING = 0x1 + FSCONFIG_SET_BINARY = 0x2 + FSCONFIG_SET_PATH = 0x3 + FSCONFIG_SET_PATH_EMPTY = 0x4 + FSCONFIG_SET_FD = 0x5 + FSCONFIG_CMD_CREATE = 0x6 + FSCONFIG_CMD_RECONFIGURE = 0x7 ) type OpenHow struct { @@ -1550,6 +1559,7 @@ const ( IFLA_DEVLINK_PORT = 0x3e IFLA_GSO_IPV4_MAX_SIZE = 0x3f IFLA_GRO_IPV4_MAX_SIZE = 0x40 + IFLA_DPLL_PIN = 0x41 IFLA_PROTO_DOWN_REASON_UNSPEC = 0x0 IFLA_PROTO_DOWN_REASON_MASK = 0x1 IFLA_PROTO_DOWN_REASON_VALUE = 0x2 @@ -1565,6 +1575,7 @@ const ( IFLA_INET6_ICMP6STATS = 0x6 IFLA_INET6_TOKEN = 0x7 IFLA_INET6_ADDR_GEN_MODE = 0x8 + IFLA_INET6_RA_MTU = 0x9 IFLA_BR_UNSPEC = 0x0 IFLA_BR_FORWARD_DELAY = 0x1 IFLA_BR_HELLO_TIME = 0x2 @@ -1612,6 +1623,9 @@ const ( IFLA_BR_MCAST_MLD_VERSION = 0x2c IFLA_BR_VLAN_STATS_PER_PORT = 0x2d IFLA_BR_MULTI_BOOLOPT = 0x2e + IFLA_BR_MCAST_QUERIER_STATE = 0x2f + IFLA_BR_FDB_N_LEARNED = 0x30 + IFLA_BR_FDB_MAX_LEARNED = 0x31 IFLA_BRPORT_UNSPEC = 0x0 IFLA_BRPORT_STATE = 0x1 IFLA_BRPORT_PRIORITY = 0x2 @@ -1649,6 +1663,14 @@ const ( IFLA_BRPORT_BACKUP_PORT = 0x22 IFLA_BRPORT_MRP_RING_OPEN = 0x23 IFLA_BRPORT_MRP_IN_OPEN = 0x24 + IFLA_BRPORT_MCAST_EHT_HOSTS_LIMIT = 0x25 + IFLA_BRPORT_MCAST_EHT_HOSTS_CNT = 0x26 + IFLA_BRPORT_LOCKED = 0x27 + IFLA_BRPORT_MAB = 0x28 + IFLA_BRPORT_MCAST_N_GROUPS = 0x29 + IFLA_BRPORT_MCAST_MAX_GROUPS = 0x2a + IFLA_BRPORT_NEIGH_VLAN_SUPPRESS = 0x2b + IFLA_BRPORT_BACKUP_NHID = 0x2c IFLA_INFO_UNSPEC = 0x0 IFLA_INFO_KIND = 0x1 IFLA_INFO_DATA = 0x2 @@ -1670,6 +1692,9 @@ const ( IFLA_MACVLAN_MACADDR = 0x4 IFLA_MACVLAN_MACADDR_DATA = 0x5 IFLA_MACVLAN_MACADDR_COUNT = 0x6 + IFLA_MACVLAN_BC_QUEUE_LEN = 0x7 + IFLA_MACVLAN_BC_QUEUE_LEN_USED = 0x8 + IFLA_MACVLAN_BC_CUTOFF = 0x9 IFLA_VRF_UNSPEC = 0x0 IFLA_VRF_TABLE = 0x1 IFLA_VRF_PORT_UNSPEC = 0x0 @@ -1693,9 +1718,22 @@ const ( IFLA_XFRM_UNSPEC = 0x0 IFLA_XFRM_LINK = 0x1 IFLA_XFRM_IF_ID = 0x2 + IFLA_XFRM_COLLECT_METADATA = 0x3 IFLA_IPVLAN_UNSPEC = 0x0 IFLA_IPVLAN_MODE = 0x1 IFLA_IPVLAN_FLAGS = 0x2 + NETKIT_NEXT = -0x1 + NETKIT_PASS = 0x0 + NETKIT_DROP = 0x2 + NETKIT_REDIRECT = 0x7 + NETKIT_L2 = 0x0 + NETKIT_L3 = 0x1 + IFLA_NETKIT_UNSPEC = 0x0 + IFLA_NETKIT_PEER_INFO = 0x1 + IFLA_NETKIT_PRIMARY = 0x2 + IFLA_NETKIT_POLICY = 0x3 + IFLA_NETKIT_PEER_POLICY = 0x4 + IFLA_NETKIT_MODE = 0x5 IFLA_VXLAN_UNSPEC = 0x0 IFLA_VXLAN_ID = 0x1 IFLA_VXLAN_GROUP = 0x2 @@ -1726,6 +1764,8 @@ const ( IFLA_VXLAN_GPE = 0x1b IFLA_VXLAN_TTL_INHERIT = 0x1c IFLA_VXLAN_DF = 0x1d + IFLA_VXLAN_VNIFILTER = 0x1e + IFLA_VXLAN_LOCALBYPASS = 0x1f IFLA_GENEVE_UNSPEC = 0x0 IFLA_GENEVE_ID = 0x1 IFLA_GENEVE_REMOTE = 0x2 @@ -1740,6 +1780,7 @@ const ( IFLA_GENEVE_LABEL = 0xb IFLA_GENEVE_TTL_INHERIT = 0xc IFLA_GENEVE_DF = 0xd + IFLA_GENEVE_INNER_PROTO_INHERIT = 0xe IFLA_BAREUDP_UNSPEC = 0x0 IFLA_BAREUDP_PORT = 0x1 IFLA_BAREUDP_ETHERTYPE = 0x2 @@ -1752,6 +1793,8 @@ const ( IFLA_GTP_FD1 = 0x2 IFLA_GTP_PDP_HASHSIZE = 0x3 IFLA_GTP_ROLE = 0x4 + IFLA_GTP_CREATE_SOCKETS = 0x5 + IFLA_GTP_RESTART_COUNT = 0x6 IFLA_BOND_UNSPEC = 0x0 IFLA_BOND_MODE = 0x1 IFLA_BOND_ACTIVE_SLAVE = 0x2 @@ -1781,6 +1824,9 @@ const ( IFLA_BOND_AD_ACTOR_SYSTEM = 0x1a IFLA_BOND_TLB_DYNAMIC_LB = 0x1b IFLA_BOND_PEER_NOTIF_DELAY = 0x1c + IFLA_BOND_AD_LACP_ACTIVE = 0x1d + IFLA_BOND_MISSED_MAX = 0x1e + IFLA_BOND_NS_IP6_TARGET = 0x1f IFLA_BOND_AD_INFO_UNSPEC = 0x0 IFLA_BOND_AD_INFO_AGGREGATOR = 0x1 IFLA_BOND_AD_INFO_NUM_PORTS = 0x2 @@ -1796,6 +1842,7 @@ const ( IFLA_BOND_SLAVE_AD_AGGREGATOR_ID = 0x6 IFLA_BOND_SLAVE_AD_ACTOR_OPER_PORT_STATE = 0x7 IFLA_BOND_SLAVE_AD_PARTNER_OPER_PORT_STATE = 0x8 + IFLA_BOND_SLAVE_PRIO = 0x9 IFLA_VF_INFO_UNSPEC = 0x0 IFLA_VF_INFO = 0x1 IFLA_VF_UNSPEC = 0x0 @@ -1854,8 +1901,16 @@ const ( IFLA_STATS_LINK_XSTATS_SLAVE = 0x3 IFLA_STATS_LINK_OFFLOAD_XSTATS = 0x4 IFLA_STATS_AF_SPEC = 0x5 + IFLA_STATS_GETSET_UNSPEC = 0x0 + IFLA_STATS_GET_FILTERS = 0x1 + IFLA_STATS_SET_OFFLOAD_XSTATS_L3_STATS = 0x2 IFLA_OFFLOAD_XSTATS_UNSPEC = 0x0 IFLA_OFFLOAD_XSTATS_CPU_HIT = 0x1 + IFLA_OFFLOAD_XSTATS_HW_S_INFO = 0x2 + IFLA_OFFLOAD_XSTATS_L3_STATS = 0x3 + IFLA_OFFLOAD_XSTATS_HW_S_INFO_UNSPEC = 0x0 + IFLA_OFFLOAD_XSTATS_HW_S_INFO_REQUEST = 0x1 + IFLA_OFFLOAD_XSTATS_HW_S_INFO_USED = 0x2 IFLA_XDP_UNSPEC = 0x0 IFLA_XDP_FD = 0x1 IFLA_XDP_ATTACHED = 0x2 @@ -1885,6 +1940,11 @@ const ( IFLA_RMNET_UNSPEC = 0x0 IFLA_RMNET_MUX_ID = 0x1 IFLA_RMNET_FLAGS = 0x2 + IFLA_MCTP_UNSPEC = 0x0 + IFLA_MCTP_NET = 0x1 + IFLA_DSA_UNSPEC = 0x0 + IFLA_DSA_CONDUIT = 0x1 + IFLA_DSA_MASTER = 0x1 ) const ( diff --git a/vendor/google.golang.org/protobuf/encoding/protojson/decode.go b/vendor/google.golang.org/protobuf/encoding/protojson/decode.go index 5f28148d8..f47902371 100644 --- a/vendor/google.golang.org/protobuf/encoding/protojson/decode.go +++ b/vendor/google.golang.org/protobuf/encoding/protojson/decode.go @@ -11,6 +11,7 @@ import ( "strconv" "strings" + "google.golang.org/protobuf/encoding/protowire" "google.golang.org/protobuf/internal/encoding/json" "google.golang.org/protobuf/internal/encoding/messageset" "google.golang.org/protobuf/internal/errors" @@ -23,7 +24,7 @@ import ( "google.golang.org/protobuf/reflect/protoregistry" ) -// Unmarshal reads the given []byte into the given proto.Message. +// Unmarshal reads the given []byte into the given [proto.Message]. // The provided message must be mutable (e.g., a non-nil pointer to a message). func Unmarshal(b []byte, m proto.Message) error { return UnmarshalOptions{}.Unmarshal(b, m) @@ -37,7 +38,7 @@ type UnmarshalOptions struct { // required fields will not return an error. AllowPartial bool - // If DiscardUnknown is set, unknown fields are ignored. + // If DiscardUnknown is set, unknown fields and enum name values are ignored. DiscardUnknown bool // Resolver is used for looking up types when unmarshaling @@ -47,9 +48,13 @@ type UnmarshalOptions struct { protoregistry.MessageTypeResolver protoregistry.ExtensionTypeResolver } + + // RecursionLimit limits how deeply messages may be nested. + // If zero, a default limit is applied. + RecursionLimit int } -// Unmarshal reads the given []byte and populates the given proto.Message +// Unmarshal reads the given []byte and populates the given [proto.Message] // using options in the UnmarshalOptions object. // It will clear the message first before setting the fields. // If it returns an error, the given message may be partially set. @@ -67,6 +72,9 @@ func (o UnmarshalOptions) unmarshal(b []byte, m proto.Message) error { if o.Resolver == nil { o.Resolver = protoregistry.GlobalTypes } + if o.RecursionLimit == 0 { + o.RecursionLimit = protowire.DefaultRecursionLimit + } dec := decoder{json.NewDecoder(b), o} if err := dec.unmarshalMessage(m.ProtoReflect(), false); err != nil { @@ -114,6 +122,10 @@ func (d decoder) syntaxError(pos int, f string, x ...interface{}) error { // unmarshalMessage unmarshals a message into the given protoreflect.Message. func (d decoder) unmarshalMessage(m protoreflect.Message, skipTypeURL bool) error { + d.opts.RecursionLimit-- + if d.opts.RecursionLimit < 0 { + return errors.New("exceeded max recursion depth") + } if unmarshal := wellKnownTypeUnmarshaler(m.Descriptor().FullName()); unmarshal != nil { return unmarshal(d, m) } @@ -266,7 +278,9 @@ func (d decoder) unmarshalSingular(m protoreflect.Message, fd protoreflect.Field if err != nil { return err } - m.Set(fd, val) + if val.IsValid() { + m.Set(fd, val) + } return nil } @@ -329,7 +343,7 @@ func (d decoder) unmarshalScalar(fd protoreflect.FieldDescriptor) (protoreflect. } case protoreflect.EnumKind: - if v, ok := unmarshalEnum(tok, fd); ok { + if v, ok := unmarshalEnum(tok, fd, d.opts.DiscardUnknown); ok { return v, nil } @@ -474,7 +488,7 @@ func unmarshalBytes(tok json.Token) (protoreflect.Value, bool) { return protoreflect.ValueOfBytes(b), true } -func unmarshalEnum(tok json.Token, fd protoreflect.FieldDescriptor) (protoreflect.Value, bool) { +func unmarshalEnum(tok json.Token, fd protoreflect.FieldDescriptor, discardUnknown bool) (protoreflect.Value, bool) { switch tok.Kind() { case json.String: // Lookup EnumNumber based on name. @@ -482,6 +496,9 @@ func unmarshalEnum(tok json.Token, fd protoreflect.FieldDescriptor) (protoreflec if enumVal := fd.Enum().Values().ByName(protoreflect.Name(s)); enumVal != nil { return protoreflect.ValueOfEnum(enumVal.Number()), true } + if discardUnknown { + return protoreflect.Value{}, true + } case json.Number: if n, ok := tok.Int(32); ok { @@ -542,7 +559,9 @@ func (d decoder) unmarshalList(list protoreflect.List, fd protoreflect.FieldDesc if err != nil { return err } - list.Append(val) + if val.IsValid() { + list.Append(val) + } } } @@ -609,8 +628,9 @@ Loop: if err != nil { return err } - - mmap.Set(pkey, pval) + if pval.IsValid() { + mmap.Set(pkey, pval) + } } return nil diff --git a/vendor/google.golang.org/protobuf/encoding/protojson/doc.go b/vendor/google.golang.org/protobuf/encoding/protojson/doc.go index 21d5d2cb1..ae71007c1 100644 --- a/vendor/google.golang.org/protobuf/encoding/protojson/doc.go +++ b/vendor/google.golang.org/protobuf/encoding/protojson/doc.go @@ -6,6 +6,6 @@ // format. It follows the guide at // https://protobuf.dev/programming-guides/proto3#json. // -// This package produces a different output than the standard "encoding/json" +// This package produces a different output than the standard [encoding/json] // package, which does not operate correctly on protocol buffer messages. package protojson diff --git a/vendor/google.golang.org/protobuf/encoding/protojson/encode.go b/vendor/google.golang.org/protobuf/encoding/protojson/encode.go index 66b95870e..3f75098b6 100644 --- a/vendor/google.golang.org/protobuf/encoding/protojson/encode.go +++ b/vendor/google.golang.org/protobuf/encoding/protojson/encode.go @@ -31,7 +31,7 @@ func Format(m proto.Message) string { return MarshalOptions{Multiline: true}.Format(m) } -// Marshal writes the given proto.Message in JSON format using default options. +// Marshal writes the given [proto.Message] in JSON format using default options. // Do not depend on the output being stable. It may change over time across // different versions of the program. func Marshal(m proto.Message) ([]byte, error) { @@ -81,6 +81,25 @@ type MarshalOptions struct { // ╚═══════╧════════════════════════════╝ EmitUnpopulated bool + // EmitDefaultValues specifies whether to emit default-valued primitive fields, + // empty lists, and empty maps. The fields affected are as follows: + // ╔═══════╤════════════════════════════════════════╗ + // ║ JSON │ Protobuf field ║ + // ╠═══════╪════════════════════════════════════════╣ + // ║ false │ non-optional scalar boolean fields ║ + // ║ 0 │ non-optional scalar numeric fields ║ + // ║ "" │ non-optional scalar string/byte fields ║ + // ║ [] │ empty repeated fields ║ + // ║ {} │ empty map fields ║ + // ╚═══════╧════════════════════════════════════════╝ + // + // Behaves similarly to EmitUnpopulated, but does not emit "null"-value fields, + // i.e. presence-sensing fields that are omitted will remain omitted to preserve + // presence-sensing. + // EmitUnpopulated takes precedence over EmitDefaultValues since the former generates + // a strict superset of the latter. + EmitDefaultValues bool + // Resolver is used for looking up types when expanding google.protobuf.Any // messages. If nil, this defaults to using protoregistry.GlobalTypes. Resolver interface { @@ -102,7 +121,7 @@ func (o MarshalOptions) Format(m proto.Message) string { return string(b) } -// Marshal marshals the given proto.Message in the JSON format using options in +// Marshal marshals the given [proto.Message] in the JSON format using options in // MarshalOptions. Do not depend on the output being stable. It may change over // time across different versions of the program. func (o MarshalOptions) Marshal(m proto.Message) ([]byte, error) { @@ -178,7 +197,11 @@ func (m typeURLFieldRanger) Range(f func(protoreflect.FieldDescriptor, protorefl // unpopulatedFieldRanger wraps a protoreflect.Message and modifies its Range // method to additionally iterate over unpopulated fields. -type unpopulatedFieldRanger struct{ protoreflect.Message } +type unpopulatedFieldRanger struct { + protoreflect.Message + + skipNull bool +} func (m unpopulatedFieldRanger) Range(f func(protoreflect.FieldDescriptor, protoreflect.Value) bool) { fds := m.Descriptor().Fields() @@ -192,6 +215,9 @@ func (m unpopulatedFieldRanger) Range(f func(protoreflect.FieldDescriptor, proto isProto2Scalar := fd.Syntax() == protoreflect.Proto2 && fd.Default().IsValid() isSingularMessage := fd.Cardinality() != protoreflect.Repeated && fd.Message() != nil if isProto2Scalar || isSingularMessage { + if m.skipNull { + continue + } v = protoreflect.Value{} // use invalid value to emit null } if !f(fd, v) { @@ -217,8 +243,11 @@ func (e encoder) marshalMessage(m protoreflect.Message, typeURL string) error { defer e.EndObject() var fields order.FieldRanger = m - if e.opts.EmitUnpopulated { - fields = unpopulatedFieldRanger{m} + switch { + case e.opts.EmitUnpopulated: + fields = unpopulatedFieldRanger{Message: m, skipNull: false} + case e.opts.EmitDefaultValues: + fields = unpopulatedFieldRanger{Message: m, skipNull: true} } if typeURL != "" { fields = typeURLFieldRanger{fields, typeURL} diff --git a/vendor/google.golang.org/protobuf/encoding/protojson/well_known_types.go b/vendor/google.golang.org/protobuf/encoding/protojson/well_known_types.go index 6c37d4174..4b177c820 100644 --- a/vendor/google.golang.org/protobuf/encoding/protojson/well_known_types.go +++ b/vendor/google.golang.org/protobuf/encoding/protojson/well_known_types.go @@ -176,7 +176,7 @@ func (d decoder) unmarshalAny(m protoreflect.Message) error { // Use another decoder to parse the unread bytes for @type field. This // avoids advancing a read from current decoder because the current JSON // object may contain the fields of the embedded type. - dec := decoder{d.Clone(), UnmarshalOptions{}} + dec := decoder{d.Clone(), UnmarshalOptions{RecursionLimit: d.opts.RecursionLimit}} tok, err := findTypeURL(dec) switch err { case errEmptyObject: @@ -308,48 +308,29 @@ Loop: // array) in order to advance the read to the next JSON value. It relies on // the decoder returning an error if the types are not in valid sequence. func (d decoder) skipJSONValue() error { - tok, err := d.Read() - if err != nil { - return err - } - // Only need to continue reading for objects and arrays. - switch tok.Kind() { - case json.ObjectOpen: - for { - tok, err := d.Read() - if err != nil { - return err - } - switch tok.Kind() { - case json.ObjectClose: - return nil - case json.Name: - // Skip object field value. - if err := d.skipJSONValue(); err != nil { - return err - } - } + var open int + for { + tok, err := d.Read() + if err != nil { + return err } - - case json.ArrayOpen: - for { - tok, err := d.Peek() - if err != nil { - return err - } - switch tok.Kind() { - case json.ArrayClose: - d.Read() - return nil - default: - // Skip array item. - if err := d.skipJSONValue(); err != nil { - return err - } + switch tok.Kind() { + case json.ObjectClose, json.ArrayClose: + open-- + case json.ObjectOpen, json.ArrayOpen: + open++ + if open > d.opts.RecursionLimit { + return errors.New("exceeded max recursion depth") } + case json.EOF: + // This can only happen if there's a bug in Decoder.Read. + // Avoid an infinite loop if this does happen. + return errors.New("unexpected EOF") + } + if open == 0 { + return nil } } - return nil } // unmarshalAnyValue unmarshals the given custom-type message from the JSON diff --git a/vendor/google.golang.org/protobuf/encoding/prototext/decode.go b/vendor/google.golang.org/protobuf/encoding/prototext/decode.go index 4921b2d4a..a45f112bc 100644 --- a/vendor/google.golang.org/protobuf/encoding/prototext/decode.go +++ b/vendor/google.golang.org/protobuf/encoding/prototext/decode.go @@ -21,7 +21,7 @@ import ( "google.golang.org/protobuf/reflect/protoregistry" ) -// Unmarshal reads the given []byte into the given proto.Message. +// Unmarshal reads the given []byte into the given [proto.Message]. // The provided message must be mutable (e.g., a non-nil pointer to a message). func Unmarshal(b []byte, m proto.Message) error { return UnmarshalOptions{}.Unmarshal(b, m) @@ -51,7 +51,7 @@ type UnmarshalOptions struct { } } -// Unmarshal reads the given []byte and populates the given proto.Message +// Unmarshal reads the given []byte and populates the given [proto.Message] // using options in the UnmarshalOptions object. // The provided message must be mutable (e.g., a non-nil pointer to a message). func (o UnmarshalOptions) Unmarshal(b []byte, m proto.Message) error { @@ -739,7 +739,9 @@ func (d decoder) skipValue() error { case text.ListClose: return nil case text.MessageOpen: - return d.skipMessageValue() + if err := d.skipMessageValue(); err != nil { + return err + } default: // Skip items. This will not validate whether skipped values are // of the same type or not, same behavior as C++ diff --git a/vendor/google.golang.org/protobuf/encoding/prototext/encode.go b/vendor/google.golang.org/protobuf/encoding/prototext/encode.go index 722a7b41d..95967e811 100644 --- a/vendor/google.golang.org/protobuf/encoding/prototext/encode.go +++ b/vendor/google.golang.org/protobuf/encoding/prototext/encode.go @@ -33,7 +33,7 @@ func Format(m proto.Message) string { return MarshalOptions{Multiline: true}.Format(m) } -// Marshal writes the given proto.Message in textproto format using default +// Marshal writes the given [proto.Message] in textproto format using default // options. Do not depend on the output being stable. It may change over time // across different versions of the program. func Marshal(m proto.Message) ([]byte, error) { @@ -97,7 +97,7 @@ func (o MarshalOptions) Format(m proto.Message) string { return string(b) } -// Marshal writes the given proto.Message in textproto format using options in +// Marshal writes the given [proto.Message] in textproto format using options in // MarshalOptions object. Do not depend on the output being stable. It may // change over time across different versions of the program. func (o MarshalOptions) Marshal(m proto.Message) ([]byte, error) { diff --git a/vendor/google.golang.org/protobuf/encoding/protowire/wire.go b/vendor/google.golang.org/protobuf/encoding/protowire/wire.go index f4b4686cf..e942bc983 100644 --- a/vendor/google.golang.org/protobuf/encoding/protowire/wire.go +++ b/vendor/google.golang.org/protobuf/encoding/protowire/wire.go @@ -6,7 +6,7 @@ // See https://protobuf.dev/programming-guides/encoding. // // For marshaling and unmarshaling entire protobuf messages, -// use the "google.golang.org/protobuf/proto" package instead. +// use the [google.golang.org/protobuf/proto] package instead. package protowire import ( @@ -87,7 +87,7 @@ func ParseError(n int) error { // ConsumeField parses an entire field record (both tag and value) and returns // the field number, the wire type, and the total length. -// This returns a negative length upon an error (see ParseError). +// This returns a negative length upon an error (see [ParseError]). // // The total length includes the tag header and the end group marker (if the // field is a group). @@ -104,8 +104,8 @@ func ConsumeField(b []byte) (Number, Type, int) { } // ConsumeFieldValue parses a field value and returns its length. -// This assumes that the field Number and wire Type have already been parsed. -// This returns a negative length upon an error (see ParseError). +// This assumes that the field [Number] and wire [Type] have already been parsed. +// This returns a negative length upon an error (see [ParseError]). // // When parsing a group, the length includes the end group marker and // the end group is verified to match the starting field number. @@ -164,7 +164,7 @@ func AppendTag(b []byte, num Number, typ Type) []byte { } // ConsumeTag parses b as a varint-encoded tag, reporting its length. -// This returns a negative length upon an error (see ParseError). +// This returns a negative length upon an error (see [ParseError]). func ConsumeTag(b []byte) (Number, Type, int) { v, n := ConsumeVarint(b) if n < 0 { @@ -263,7 +263,7 @@ func AppendVarint(b []byte, v uint64) []byte { } // ConsumeVarint parses b as a varint-encoded uint64, reporting its length. -// This returns a negative length upon an error (see ParseError). +// This returns a negative length upon an error (see [ParseError]). func ConsumeVarint(b []byte) (v uint64, n int) { var y uint64 if len(b) <= 0 { @@ -384,7 +384,7 @@ func AppendFixed32(b []byte, v uint32) []byte { } // ConsumeFixed32 parses b as a little-endian uint32, reporting its length. -// This returns a negative length upon an error (see ParseError). +// This returns a negative length upon an error (see [ParseError]). func ConsumeFixed32(b []byte) (v uint32, n int) { if len(b) < 4 { return 0, errCodeTruncated @@ -412,7 +412,7 @@ func AppendFixed64(b []byte, v uint64) []byte { } // ConsumeFixed64 parses b as a little-endian uint64, reporting its length. -// This returns a negative length upon an error (see ParseError). +// This returns a negative length upon an error (see [ParseError]). func ConsumeFixed64(b []byte) (v uint64, n int) { if len(b) < 8 { return 0, errCodeTruncated @@ -432,7 +432,7 @@ func AppendBytes(b []byte, v []byte) []byte { } // ConsumeBytes parses b as a length-prefixed bytes value, reporting its length. -// This returns a negative length upon an error (see ParseError). +// This returns a negative length upon an error (see [ParseError]). func ConsumeBytes(b []byte) (v []byte, n int) { m, n := ConsumeVarint(b) if n < 0 { @@ -456,7 +456,7 @@ func AppendString(b []byte, v string) []byte { } // ConsumeString parses b as a length-prefixed bytes value, reporting its length. -// This returns a negative length upon an error (see ParseError). +// This returns a negative length upon an error (see [ParseError]). func ConsumeString(b []byte) (v string, n int) { bb, n := ConsumeBytes(b) return string(bb), n @@ -471,7 +471,7 @@ func AppendGroup(b []byte, num Number, v []byte) []byte { // ConsumeGroup parses b as a group value until the trailing end group marker, // and verifies that the end marker matches the provided num. The value v // does not contain the end marker, while the length does contain the end marker. -// This returns a negative length upon an error (see ParseError). +// This returns a negative length upon an error (see [ParseError]). func ConsumeGroup(num Number, b []byte) (v []byte, n int) { n = ConsumeFieldValue(num, StartGroupType, b) if n < 0 { @@ -495,8 +495,8 @@ func SizeGroup(num Number, n int) int { return n + SizeTag(num) } -// DecodeTag decodes the field Number and wire Type from its unified form. -// The Number is -1 if the decoded field number overflows int32. +// DecodeTag decodes the field [Number] and wire [Type] from its unified form. +// The [Number] is -1 if the decoded field number overflows int32. // Other than overflow, this does not check for field number validity. func DecodeTag(x uint64) (Number, Type) { // NOTE: MessageSet allows for larger field numbers than normal. @@ -506,7 +506,7 @@ func DecodeTag(x uint64) (Number, Type) { return Number(x >> 3), Type(x & 7) } -// EncodeTag encodes the field Number and wire Type into its unified form. +// EncodeTag encodes the field [Number] and wire [Type] into its unified form. func EncodeTag(num Number, typ Type) uint64 { return uint64(num)<<3 | uint64(typ&7) } diff --git a/vendor/google.golang.org/protobuf/internal/descfmt/stringer.go b/vendor/google.golang.org/protobuf/internal/descfmt/stringer.go index db5248e1b..a45625c8d 100644 --- a/vendor/google.golang.org/protobuf/internal/descfmt/stringer.go +++ b/vendor/google.golang.org/protobuf/internal/descfmt/stringer.go @@ -83,7 +83,13 @@ func formatListOpt(vs list, isRoot, allowMulti bool) string { case protoreflect.FileImports: for i := 0; i < vs.Len(); i++ { var rs records - rs.Append(reflect.ValueOf(vs.Get(i)), "Path", "Package", "IsPublic", "IsWeak") + rv := reflect.ValueOf(vs.Get(i)) + rs.Append(rv, []methodAndName{ + {rv.MethodByName("Path"), "Path"}, + {rv.MethodByName("Package"), "Package"}, + {rv.MethodByName("IsPublic"), "IsPublic"}, + {rv.MethodByName("IsWeak"), "IsWeak"}, + }...) ss = append(ss, "{"+rs.Join()+"}") } return start + joinStrings(ss, allowMulti) + end @@ -92,34 +98,26 @@ func formatListOpt(vs list, isRoot, allowMulti bool) string { for i := 0; i < vs.Len(); i++ { m := reflect.ValueOf(vs).MethodByName("Get") v := m.Call([]reflect.Value{reflect.ValueOf(i)})[0].Interface() - ss = append(ss, formatDescOpt(v.(protoreflect.Descriptor), false, allowMulti && !isEnumValue)) + ss = append(ss, formatDescOpt(v.(protoreflect.Descriptor), false, allowMulti && !isEnumValue, nil)) } return start + joinStrings(ss, allowMulti && isEnumValue) + end } } -// descriptorAccessors is a list of accessors to print for each descriptor. -// -// Do not print all accessors since some contain redundant information, -// while others are pointers that we do not want to follow since the descriptor -// is actually a cyclic graph. -// -// Using a list allows us to print the accessors in a sensible order. -var descriptorAccessors = map[reflect.Type][]string{ - reflect.TypeOf((*protoreflect.FileDescriptor)(nil)).Elem(): {"Path", "Package", "Imports", "Messages", "Enums", "Extensions", "Services"}, - reflect.TypeOf((*protoreflect.MessageDescriptor)(nil)).Elem(): {"IsMapEntry", "Fields", "Oneofs", "ReservedNames", "ReservedRanges", "RequiredNumbers", "ExtensionRanges", "Messages", "Enums", "Extensions"}, - reflect.TypeOf((*protoreflect.FieldDescriptor)(nil)).Elem(): {"Number", "Cardinality", "Kind", "HasJSONName", "JSONName", "HasPresence", "IsExtension", "IsPacked", "IsWeak", "IsList", "IsMap", "MapKey", "MapValue", "HasDefault", "Default", "ContainingOneof", "ContainingMessage", "Message", "Enum"}, - reflect.TypeOf((*protoreflect.OneofDescriptor)(nil)).Elem(): {"Fields"}, // not directly used; must keep in sync with formatDescOpt - reflect.TypeOf((*protoreflect.EnumDescriptor)(nil)).Elem(): {"Values", "ReservedNames", "ReservedRanges"}, - reflect.TypeOf((*protoreflect.EnumValueDescriptor)(nil)).Elem(): {"Number"}, - reflect.TypeOf((*protoreflect.ServiceDescriptor)(nil)).Elem(): {"Methods"}, - reflect.TypeOf((*protoreflect.MethodDescriptor)(nil)).Elem(): {"Input", "Output", "IsStreamingClient", "IsStreamingServer"}, +type methodAndName struct { + method reflect.Value + name string } func FormatDesc(s fmt.State, r rune, t protoreflect.Descriptor) { - io.WriteString(s, formatDescOpt(t, true, r == 'v' && (s.Flag('+') || s.Flag('#')))) + io.WriteString(s, formatDescOpt(t, true, r == 'v' && (s.Flag('+') || s.Flag('#')), nil)) } -func formatDescOpt(t protoreflect.Descriptor, isRoot, allowMulti bool) string { + +func InternalFormatDescOptForTesting(t protoreflect.Descriptor, isRoot, allowMulti bool, record func(string)) string { + return formatDescOpt(t, isRoot, allowMulti, record) +} + +func formatDescOpt(t protoreflect.Descriptor, isRoot, allowMulti bool, record func(string)) string { rv := reflect.ValueOf(t) rt := rv.MethodByName("ProtoType").Type().In(0) @@ -129,26 +127,60 @@ func formatDescOpt(t protoreflect.Descriptor, isRoot, allowMulti bool) string { } _, isFile := t.(protoreflect.FileDescriptor) - rs := records{allowMulti: allowMulti} + rs := records{ + allowMulti: allowMulti, + record: record, + } if t.IsPlaceholder() { if isFile { - rs.Append(rv, "Path", "Package", "IsPlaceholder") + rs.Append(rv, []methodAndName{ + {rv.MethodByName("Path"), "Path"}, + {rv.MethodByName("Package"), "Package"}, + {rv.MethodByName("IsPlaceholder"), "IsPlaceholder"}, + }...) } else { - rs.Append(rv, "FullName", "IsPlaceholder") + rs.Append(rv, []methodAndName{ + {rv.MethodByName("FullName"), "FullName"}, + {rv.MethodByName("IsPlaceholder"), "IsPlaceholder"}, + }...) } } else { switch { case isFile: - rs.Append(rv, "Syntax") + rs.Append(rv, methodAndName{rv.MethodByName("Syntax"), "Syntax"}) case isRoot: - rs.Append(rv, "Syntax", "FullName") + rs.Append(rv, []methodAndName{ + {rv.MethodByName("Syntax"), "Syntax"}, + {rv.MethodByName("FullName"), "FullName"}, + }...) default: - rs.Append(rv, "Name") + rs.Append(rv, methodAndName{rv.MethodByName("Name"), "Name"}) } switch t := t.(type) { case protoreflect.FieldDescriptor: - for _, s := range descriptorAccessors[rt] { - switch s { + accessors := []methodAndName{ + {rv.MethodByName("Number"), "Number"}, + {rv.MethodByName("Cardinality"), "Cardinality"}, + {rv.MethodByName("Kind"), "Kind"}, + {rv.MethodByName("HasJSONName"), "HasJSONName"}, + {rv.MethodByName("JSONName"), "JSONName"}, + {rv.MethodByName("HasPresence"), "HasPresence"}, + {rv.MethodByName("IsExtension"), "IsExtension"}, + {rv.MethodByName("IsPacked"), "IsPacked"}, + {rv.MethodByName("IsWeak"), "IsWeak"}, + {rv.MethodByName("IsList"), "IsList"}, + {rv.MethodByName("IsMap"), "IsMap"}, + {rv.MethodByName("MapKey"), "MapKey"}, + {rv.MethodByName("MapValue"), "MapValue"}, + {rv.MethodByName("HasDefault"), "HasDefault"}, + {rv.MethodByName("Default"), "Default"}, + {rv.MethodByName("ContainingOneof"), "ContainingOneof"}, + {rv.MethodByName("ContainingMessage"), "ContainingMessage"}, + {rv.MethodByName("Message"), "Message"}, + {rv.MethodByName("Enum"), "Enum"}, + } + for _, s := range accessors { + switch s.name { case "MapKey": if k := t.MapKey(); k != nil { rs.recs = append(rs.recs, [2]string{"MapKey", k.Kind().String()}) @@ -157,20 +189,20 @@ func formatDescOpt(t protoreflect.Descriptor, isRoot, allowMulti bool) string { if v := t.MapValue(); v != nil { switch v.Kind() { case protoreflect.EnumKind: - rs.recs = append(rs.recs, [2]string{"MapValue", string(v.Enum().FullName())}) + rs.AppendRecs("MapValue", [2]string{"MapValue", string(v.Enum().FullName())}) case protoreflect.MessageKind, protoreflect.GroupKind: - rs.recs = append(rs.recs, [2]string{"MapValue", string(v.Message().FullName())}) + rs.AppendRecs("MapValue", [2]string{"MapValue", string(v.Message().FullName())}) default: - rs.recs = append(rs.recs, [2]string{"MapValue", v.Kind().String()}) + rs.AppendRecs("MapValue", [2]string{"MapValue", v.Kind().String()}) } } case "ContainingOneof": if od := t.ContainingOneof(); od != nil { - rs.recs = append(rs.recs, [2]string{"Oneof", string(od.Name())}) + rs.AppendRecs("ContainingOneof", [2]string{"Oneof", string(od.Name())}) } case "ContainingMessage": if t.IsExtension() { - rs.recs = append(rs.recs, [2]string{"Extendee", string(t.ContainingMessage().FullName())}) + rs.AppendRecs("ContainingMessage", [2]string{"Extendee", string(t.ContainingMessage().FullName())}) } case "Message": if !t.IsMap() { @@ -187,13 +219,61 @@ func formatDescOpt(t protoreflect.Descriptor, isRoot, allowMulti bool) string { ss = append(ss, string(fs.Get(i).Name())) } if len(ss) > 0 { - rs.recs = append(rs.recs, [2]string{"Fields", "[" + joinStrings(ss, false) + "]"}) + rs.AppendRecs("Fields", [2]string{"Fields", "[" + joinStrings(ss, false) + "]"}) } - default: - rs.Append(rv, descriptorAccessors[rt]...) + + case protoreflect.FileDescriptor: + rs.Append(rv, []methodAndName{ + {rv.MethodByName("Path"), "Path"}, + {rv.MethodByName("Package"), "Package"}, + {rv.MethodByName("Imports"), "Imports"}, + {rv.MethodByName("Messages"), "Messages"}, + {rv.MethodByName("Enums"), "Enums"}, + {rv.MethodByName("Extensions"), "Extensions"}, + {rv.MethodByName("Services"), "Services"}, + }...) + + case protoreflect.MessageDescriptor: + rs.Append(rv, []methodAndName{ + {rv.MethodByName("IsMapEntry"), "IsMapEntry"}, + {rv.MethodByName("Fields"), "Fields"}, + {rv.MethodByName("Oneofs"), "Oneofs"}, + {rv.MethodByName("ReservedNames"), "ReservedNames"}, + {rv.MethodByName("ReservedRanges"), "ReservedRanges"}, + {rv.MethodByName("RequiredNumbers"), "RequiredNumbers"}, + {rv.MethodByName("ExtensionRanges"), "ExtensionRanges"}, + {rv.MethodByName("Messages"), "Messages"}, + {rv.MethodByName("Enums"), "Enums"}, + {rv.MethodByName("Extensions"), "Extensions"}, + }...) + + case protoreflect.EnumDescriptor: + rs.Append(rv, []methodAndName{ + {rv.MethodByName("Values"), "Values"}, + {rv.MethodByName("ReservedNames"), "ReservedNames"}, + {rv.MethodByName("ReservedRanges"), "ReservedRanges"}, + }...) + + case protoreflect.EnumValueDescriptor: + rs.Append(rv, []methodAndName{ + {rv.MethodByName("Number"), "Number"}, + }...) + + case protoreflect.ServiceDescriptor: + rs.Append(rv, []methodAndName{ + {rv.MethodByName("Methods"), "Methods"}, + }...) + + case protoreflect.MethodDescriptor: + rs.Append(rv, []methodAndName{ + {rv.MethodByName("Input"), "Input"}, + {rv.MethodByName("Output"), "Output"}, + {rv.MethodByName("IsStreamingClient"), "IsStreamingClient"}, + {rv.MethodByName("IsStreamingServer"), "IsStreamingServer"}, + }...) } - if rv.MethodByName("GoType").IsValid() { - rs.Append(rv, "GoType") + if m := rv.MethodByName("GoType"); m.IsValid() { + rs.Append(rv, methodAndName{m, "GoType"}) } } return start + rs.Join() + end @@ -202,19 +282,34 @@ func formatDescOpt(t protoreflect.Descriptor, isRoot, allowMulti bool) string { type records struct { recs [][2]string allowMulti bool + + // record is a function that will be called for every Append() or + // AppendRecs() call, to be used for testing with the + // InternalFormatDescOptForTesting function. + record func(string) } -func (rs *records) Append(v reflect.Value, accessors ...string) { +func (rs *records) AppendRecs(fieldName string, newRecs [2]string) { + if rs.record != nil { + rs.record(fieldName) + } + rs.recs = append(rs.recs, newRecs) +} + +func (rs *records) Append(v reflect.Value, accessors ...methodAndName) { for _, a := range accessors { + if rs.record != nil { + rs.record(a.name) + } var rv reflect.Value - if m := v.MethodByName(a); m.IsValid() { - rv = m.Call(nil)[0] + if a.method.IsValid() { + rv = a.method.Call(nil)[0] } if v.Kind() == reflect.Struct && !rv.IsValid() { - rv = v.FieldByName(a) + rv = v.FieldByName(a.name) } if !rv.IsValid() { - panic(fmt.Sprintf("unknown accessor: %v.%s", v.Type(), a)) + panic(fmt.Sprintf("unknown accessor: %v.%s", v.Type(), a.name)) } if _, ok := rv.Interface().(protoreflect.Value); ok { rv = rv.MethodByName("Interface").Call(nil)[0] @@ -261,7 +356,7 @@ func (rs *records) Append(v reflect.Value, accessors ...string) { default: s = fmt.Sprint(v) } - rs.recs = append(rs.recs, [2]string{a, s}) + rs.recs = append(rs.recs, [2]string{a.name, s}) } } diff --git a/vendor/google.golang.org/protobuf/internal/editiondefaults/defaults.go b/vendor/google.golang.org/protobuf/internal/editiondefaults/defaults.go new file mode 100644 index 000000000..14656b65a --- /dev/null +++ b/vendor/google.golang.org/protobuf/internal/editiondefaults/defaults.go @@ -0,0 +1,12 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package editiondefaults contains the binary representation of the editions +// defaults. +package editiondefaults + +import _ "embed" + +//go:embed editions_defaults.binpb +var Defaults []byte diff --git a/vendor/google.golang.org/protobuf/internal/editiondefaults/editions_defaults.binpb b/vendor/google.golang.org/protobuf/internal/editiondefaults/editions_defaults.binpb new file mode 100644 index 000000000..18f075687 --- /dev/null +++ b/vendor/google.golang.org/protobuf/internal/editiondefaults/editions_defaults.binpb @@ -0,0 +1,4 @@ + +  (0 +  (0 +  (0 ( \ No newline at end of file diff --git a/vendor/google.golang.org/protobuf/internal/encoding/json/decode.go b/vendor/google.golang.org/protobuf/internal/encoding/json/decode.go index d043a6ebe..d2b3ac031 100644 --- a/vendor/google.golang.org/protobuf/internal/encoding/json/decode.go +++ b/vendor/google.golang.org/protobuf/internal/encoding/json/decode.go @@ -121,7 +121,7 @@ func (d *Decoder) Read() (Token, error) { case ObjectClose: if len(d.openStack) == 0 || - d.lastToken.kind == comma || + d.lastToken.kind&(Name|comma) != 0 || d.openStack[len(d.openStack)-1] != ObjectOpen { return Token{}, d.newSyntaxError(tok.pos, unexpectedFmt, tok.RawString()) } diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/desc.go b/vendor/google.golang.org/protobuf/internal/filedesc/desc.go index 7c3689bae..8826bcf40 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/desc.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/desc.go @@ -21,11 +21,26 @@ import ( "google.golang.org/protobuf/reflect/protoregistry" ) +// Edition is an Enum for proto2.Edition +type Edition int32 + +// These values align with the value of Enum in descriptor.proto which allows +// direct conversion between the proto enum and this enum. +const ( + EditionUnknown Edition = 0 + EditionProto2 Edition = 998 + EditionProto3 Edition = 999 + Edition2023 Edition = 1000 + EditionUnsupported Edition = 100000 +) + // The types in this file may have a suffix: // • L0: Contains fields common to all descriptors (except File) and // must be initialized up front. // • L1: Contains fields specific to a descriptor and -// must be initialized up front. +// must be initialized up front. If the associated proto uses Editions, the +// Editions features must always be resolved. If not explicitly set, the +// appropriate default must be resolved and set. // • L2: Contains fields that are lazily initialized when constructing // from the raw file descriptor. When constructing as a literal, the L2 // fields must be initialized up front. @@ -44,6 +59,7 @@ type ( } FileL1 struct { Syntax protoreflect.Syntax + Edition Edition // Only used if Syntax == Editions Path string Package protoreflect.FullName @@ -51,12 +67,41 @@ type ( Messages Messages Extensions Extensions Services Services + + EditionFeatures EditionFeatures } FileL2 struct { Options func() protoreflect.ProtoMessage Imports FileImports Locations SourceLocations } + + EditionFeatures struct { + // IsFieldPresence is true if field_presence is EXPLICIT + // https://protobuf.dev/editions/features/#field_presence + IsFieldPresence bool + // IsFieldPresence is true if field_presence is LEGACY_REQUIRED + // https://protobuf.dev/editions/features/#field_presence + IsLegacyRequired bool + // IsOpenEnum is true if enum_type is OPEN + // https://protobuf.dev/editions/features/#enum_type + IsOpenEnum bool + // IsPacked is true if repeated_field_encoding is PACKED + // https://protobuf.dev/editions/features/#repeated_field_encoding + IsPacked bool + // IsUTF8Validated is true if utf_validation is VERIFY + // https://protobuf.dev/editions/features/#utf8_validation + IsUTF8Validated bool + // IsDelimitedEncoded is true if message_encoding is DELIMITED + // https://protobuf.dev/editions/features/#message_encoding + IsDelimitedEncoded bool + // IsJSONCompliant is true if json_format is ALLOW + // https://protobuf.dev/editions/features/#json_format + IsJSONCompliant bool + // GenerateLegacyUnmarshalJSON determines if the plugin generates the + // UnmarshalJSON([]byte) error method for enums. + GenerateLegacyUnmarshalJSON bool + } ) func (fd *File) ParentFile() protoreflect.FileDescriptor { return fd } @@ -117,6 +162,8 @@ type ( } EnumL1 struct { eagerValues bool // controls whether EnumL2.Values is already populated + + EditionFeatures EditionFeatures } EnumL2 struct { Options func() protoreflect.ProtoMessage @@ -178,6 +225,8 @@ type ( Extensions Extensions IsMapEntry bool // promoted from google.protobuf.MessageOptions IsMessageSet bool // promoted from google.protobuf.MessageOptions + + EditionFeatures EditionFeatures } MessageL2 struct { Options func() protoreflect.ProtoMessage @@ -210,6 +259,8 @@ type ( ContainingOneof protoreflect.OneofDescriptor // must be consistent with Message.Oneofs.Fields Enum protoreflect.EnumDescriptor Message protoreflect.MessageDescriptor + + EditionFeatures EditionFeatures } Oneof struct { @@ -219,6 +270,8 @@ type ( OneofL1 struct { Options func() protoreflect.ProtoMessage Fields OneofFields // must be consistent with Message.Fields.ContainingOneof + + EditionFeatures EditionFeatures } ) @@ -268,23 +321,36 @@ func (fd *Field) Options() protoreflect.ProtoMessage { } func (fd *Field) Number() protoreflect.FieldNumber { return fd.L1.Number } func (fd *Field) Cardinality() protoreflect.Cardinality { return fd.L1.Cardinality } -func (fd *Field) Kind() protoreflect.Kind { return fd.L1.Kind } -func (fd *Field) HasJSONName() bool { return fd.L1.StringName.hasJSON } -func (fd *Field) JSONName() string { return fd.L1.StringName.getJSON(fd) } -func (fd *Field) TextName() string { return fd.L1.StringName.getText(fd) } +func (fd *Field) Kind() protoreflect.Kind { + return fd.L1.Kind +} +func (fd *Field) HasJSONName() bool { return fd.L1.StringName.hasJSON } +func (fd *Field) JSONName() string { return fd.L1.StringName.getJSON(fd) } +func (fd *Field) TextName() string { return fd.L1.StringName.getText(fd) } func (fd *Field) HasPresence() bool { - return fd.L1.Cardinality != protoreflect.Repeated && (fd.L0.ParentFile.L1.Syntax == protoreflect.Proto2 || fd.L1.Message != nil || fd.L1.ContainingOneof != nil) + if fd.L1.Cardinality == protoreflect.Repeated { + return false + } + explicitFieldPresence := fd.Syntax() == protoreflect.Editions && fd.L1.EditionFeatures.IsFieldPresence + return fd.Syntax() == protoreflect.Proto2 || explicitFieldPresence || fd.L1.Message != nil || fd.L1.ContainingOneof != nil } func (fd *Field) HasOptionalKeyword() bool { return (fd.L0.ParentFile.L1.Syntax == protoreflect.Proto2 && fd.L1.Cardinality == protoreflect.Optional && fd.L1.ContainingOneof == nil) || fd.L1.IsProto3Optional } func (fd *Field) IsPacked() bool { - if !fd.L1.HasPacked && fd.L0.ParentFile.L1.Syntax != protoreflect.Proto2 && fd.L1.Cardinality == protoreflect.Repeated { - switch fd.L1.Kind { - case protoreflect.StringKind, protoreflect.BytesKind, protoreflect.MessageKind, protoreflect.GroupKind: - default: - return true - } + if fd.L1.Cardinality != protoreflect.Repeated { + return false + } + switch fd.L1.Kind { + case protoreflect.StringKind, protoreflect.BytesKind, protoreflect.MessageKind, protoreflect.GroupKind: + return false + } + if fd.L0.ParentFile.L1.Syntax == protoreflect.Editions { + return fd.L1.EditionFeatures.IsPacked + } + if fd.L0.ParentFile.L1.Syntax == protoreflect.Proto3 { + // proto3 repeated fields are packed by default. + return !fd.L1.HasPacked || fd.L1.IsPacked } return fd.L1.IsPacked } @@ -333,6 +399,9 @@ func (fd *Field) ProtoType(protoreflect.FieldDescriptor) {} // WARNING: This method is exempt from the compatibility promise and may be // removed in the future without warning. func (fd *Field) EnforceUTF8() bool { + if fd.L0.ParentFile.L1.Syntax == protoreflect.Editions { + return fd.L1.EditionFeatures.IsUTF8Validated + } if fd.L1.HasEnforceUTF8 { return fd.L1.EnforceUTF8 } @@ -359,10 +428,11 @@ type ( L2 *ExtensionL2 // protected by fileDesc.once } ExtensionL1 struct { - Number protoreflect.FieldNumber - Extendee protoreflect.MessageDescriptor - Cardinality protoreflect.Cardinality - Kind protoreflect.Kind + Number protoreflect.FieldNumber + Extendee protoreflect.MessageDescriptor + Cardinality protoreflect.Cardinality + Kind protoreflect.Kind + EditionFeatures EditionFeatures } ExtensionL2 struct { Options func() protoreflect.ProtoMessage diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/desc_init.go b/vendor/google.golang.org/protobuf/internal/filedesc/desc_init.go index 4a1584c9d..237e64fd2 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/desc_init.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/desc_init.go @@ -5,6 +5,7 @@ package filedesc import ( + "fmt" "sync" "google.golang.org/protobuf/encoding/protowire" @@ -98,6 +99,7 @@ func (fd *File) unmarshalSeed(b []byte) { var prevField protoreflect.FieldNumber var numEnums, numMessages, numExtensions, numServices int var posEnums, posMessages, posExtensions, posServices int + var options []byte b0 := b for len(b) > 0 { num, typ, n := protowire.ConsumeTag(b) @@ -113,6 +115,8 @@ func (fd *File) unmarshalSeed(b []byte) { fd.L1.Syntax = protoreflect.Proto2 case "proto3": fd.L1.Syntax = protoreflect.Proto3 + case "editions": + fd.L1.Syntax = protoreflect.Editions default: panic("invalid syntax") } @@ -120,6 +124,8 @@ func (fd *File) unmarshalSeed(b []byte) { fd.L1.Path = sb.MakeString(v) case genid.FileDescriptorProto_Package_field_number: fd.L1.Package = protoreflect.FullName(sb.MakeString(v)) + case genid.FileDescriptorProto_Options_field_number: + options = v case genid.FileDescriptorProto_EnumType_field_number: if prevField != genid.FileDescriptorProto_EnumType_field_number { if numEnums > 0 { @@ -154,6 +160,13 @@ func (fd *File) unmarshalSeed(b []byte) { numServices++ } prevField = num + case protowire.VarintType: + v, m := protowire.ConsumeVarint(b) + b = b[m:] + switch num { + case genid.FileDescriptorProto_Edition_field_number: + fd.L1.Edition = Edition(v) + } default: m := protowire.ConsumeFieldValue(num, typ, b) b = b[m:] @@ -166,6 +179,15 @@ func (fd *File) unmarshalSeed(b []byte) { fd.L1.Syntax = protoreflect.Proto2 } + if fd.L1.Syntax == protoreflect.Editions { + fd.L1.EditionFeatures = getFeaturesFor(fd.L1.Edition) + } + + // Parse editions features from options if any + if options != nil { + fd.unmarshalSeedOptions(options) + } + // Must allocate all declarations before parsing each descriptor type // to ensure we handled all descriptors in "flattened ordering". if numEnums > 0 { @@ -219,6 +241,28 @@ func (fd *File) unmarshalSeed(b []byte) { } } +func (fd *File) unmarshalSeedOptions(b []byte) { + for b := b; len(b) > 0; { + num, typ, n := protowire.ConsumeTag(b) + b = b[n:] + switch typ { + case protowire.BytesType: + v, m := protowire.ConsumeBytes(b) + b = b[m:] + switch num { + case genid.FileOptions_Features_field_number: + if fd.Syntax() != protoreflect.Editions { + panic(fmt.Sprintf("invalid descriptor: using edition features in a proto with syntax %s", fd.Syntax())) + } + fd.L1.EditionFeatures = unmarshalFeatureSet(v, fd.L1.EditionFeatures) + } + default: + m := protowire.ConsumeFieldValue(num, typ, b) + b = b[m:] + } + } +} + func (ed *Enum) unmarshalSeed(b []byte, sb *strs.Builder, pf *File, pd protoreflect.Descriptor, i int) { ed.L0.ParentFile = pf ed.L0.Parent = pd @@ -275,6 +319,7 @@ func (md *Message) unmarshalSeed(b []byte, sb *strs.Builder, pf *File, pd protor md.L0.ParentFile = pf md.L0.Parent = pd md.L0.Index = i + md.L1.EditionFeatures = featuresFromParentDesc(md.Parent()) var prevField protoreflect.FieldNumber var numEnums, numMessages, numExtensions int @@ -380,6 +425,13 @@ func (md *Message) unmarshalSeedOptions(b []byte) { case genid.MessageOptions_MessageSetWireFormat_field_number: md.L1.IsMessageSet = protowire.DecodeBool(v) } + case protowire.BytesType: + v, m := protowire.ConsumeBytes(b) + b = b[m:] + switch num { + case genid.MessageOptions_Features_field_number: + md.L1.EditionFeatures = unmarshalFeatureSet(v, md.L1.EditionFeatures) + } default: m := protowire.ConsumeFieldValue(num, typ, b) b = b[m:] diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go b/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go index 736a19a75..482a61cc1 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go @@ -414,6 +414,7 @@ func (fd *Field) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd protoref fd.L0.ParentFile = pf fd.L0.Parent = pd fd.L0.Index = i + fd.L1.EditionFeatures = featuresFromParentDesc(fd.Parent()) var rawTypeName []byte var rawOptions []byte @@ -465,6 +466,12 @@ func (fd *Field) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd protoref b = b[m:] } } + if fd.Syntax() == protoreflect.Editions && fd.L1.Kind == protoreflect.MessageKind && fd.L1.EditionFeatures.IsDelimitedEncoded { + fd.L1.Kind = protoreflect.GroupKind + } + if fd.Syntax() == protoreflect.Editions && fd.L1.EditionFeatures.IsLegacyRequired { + fd.L1.Cardinality = protoreflect.Required + } if rawTypeName != nil { name := makeFullName(sb, rawTypeName) switch fd.L1.Kind { @@ -497,6 +504,13 @@ func (fd *Field) unmarshalOptions(b []byte) { fd.L1.HasEnforceUTF8 = true fd.L1.EnforceUTF8 = protowire.DecodeBool(v) } + case protowire.BytesType: + v, m := protowire.ConsumeBytes(b) + b = b[m:] + switch num { + case genid.FieldOptions_Features_field_number: + fd.L1.EditionFeatures = unmarshalFeatureSet(v, fd.L1.EditionFeatures) + } default: m := protowire.ConsumeFieldValue(num, typ, b) b = b[m:] @@ -534,6 +548,7 @@ func (od *Oneof) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd protoref func (xd *Extension) unmarshalFull(b []byte, sb *strs.Builder) { var rawTypeName []byte var rawOptions []byte + xd.L1.EditionFeatures = featuresFromParentDesc(xd.L1.Extendee) xd.L2 = new(ExtensionL2) for len(b) > 0 { num, typ, n := protowire.ConsumeTag(b) @@ -565,6 +580,12 @@ func (xd *Extension) unmarshalFull(b []byte, sb *strs.Builder) { b = b[m:] } } + if xd.Syntax() == protoreflect.Editions && xd.L1.Kind == protoreflect.MessageKind && xd.L1.EditionFeatures.IsDelimitedEncoded { + xd.L1.Kind = protoreflect.GroupKind + } + if xd.Syntax() == protoreflect.Editions && xd.L1.EditionFeatures.IsLegacyRequired { + xd.L1.Cardinality = protoreflect.Required + } if rawTypeName != nil { name := makeFullName(sb, rawTypeName) switch xd.L1.Kind { @@ -589,6 +610,13 @@ func (xd *Extension) unmarshalOptions(b []byte) { case genid.FieldOptions_Packed_field_number: xd.L2.IsPacked = protowire.DecodeBool(v) } + case protowire.BytesType: + v, m := protowire.ConsumeBytes(b) + b = b[m:] + switch num { + case genid.FieldOptions_Features_field_number: + xd.L1.EditionFeatures = unmarshalFeatureSet(v, xd.L1.EditionFeatures) + } default: m := protowire.ConsumeFieldValue(num, typ, b) b = b[m:] diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/editions.go b/vendor/google.golang.org/protobuf/internal/filedesc/editions.go new file mode 100644 index 000000000..0375a49d4 --- /dev/null +++ b/vendor/google.golang.org/protobuf/internal/filedesc/editions.go @@ -0,0 +1,142 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package filedesc + +import ( + "fmt" + + "google.golang.org/protobuf/encoding/protowire" + "google.golang.org/protobuf/internal/editiondefaults" + "google.golang.org/protobuf/internal/genid" + "google.golang.org/protobuf/reflect/protoreflect" +) + +var defaultsCache = make(map[Edition]EditionFeatures) + +func init() { + unmarshalEditionDefaults(editiondefaults.Defaults) +} + +func unmarshalGoFeature(b []byte, parent EditionFeatures) EditionFeatures { + for len(b) > 0 { + num, _, n := protowire.ConsumeTag(b) + b = b[n:] + switch num { + case genid.GoFeatures_LegacyUnmarshalJsonEnum_field_number: + v, m := protowire.ConsumeVarint(b) + b = b[m:] + parent.GenerateLegacyUnmarshalJSON = protowire.DecodeBool(v) + default: + panic(fmt.Sprintf("unkown field number %d while unmarshalling GoFeatures", num)) + } + } + return parent +} + +func unmarshalFeatureSet(b []byte, parent EditionFeatures) EditionFeatures { + for len(b) > 0 { + num, typ, n := protowire.ConsumeTag(b) + b = b[n:] + switch typ { + case protowire.VarintType: + v, m := protowire.ConsumeVarint(b) + b = b[m:] + switch num { + case genid.FeatureSet_FieldPresence_field_number: + parent.IsFieldPresence = v == genid.FeatureSet_EXPLICIT_enum_value || v == genid.FeatureSet_LEGACY_REQUIRED_enum_value + parent.IsLegacyRequired = v == genid.FeatureSet_LEGACY_REQUIRED_enum_value + case genid.FeatureSet_EnumType_field_number: + parent.IsOpenEnum = v == genid.FeatureSet_OPEN_enum_value + case genid.FeatureSet_RepeatedFieldEncoding_field_number: + parent.IsPacked = v == genid.FeatureSet_PACKED_enum_value + case genid.FeatureSet_Utf8Validation_field_number: + parent.IsUTF8Validated = v == genid.FeatureSet_VERIFY_enum_value + case genid.FeatureSet_MessageEncoding_field_number: + parent.IsDelimitedEncoded = v == genid.FeatureSet_DELIMITED_enum_value + case genid.FeatureSet_JsonFormat_field_number: + parent.IsJSONCompliant = v == genid.FeatureSet_ALLOW_enum_value + default: + panic(fmt.Sprintf("unkown field number %d while unmarshalling FeatureSet", num)) + } + case protowire.BytesType: + v, m := protowire.ConsumeBytes(b) + b = b[m:] + switch num { + case genid.GoFeatures_LegacyUnmarshalJsonEnum_field_number: + parent = unmarshalGoFeature(v, parent) + } + } + } + + return parent +} + +func featuresFromParentDesc(parentDesc protoreflect.Descriptor) EditionFeatures { + var parentFS EditionFeatures + switch p := parentDesc.(type) { + case *File: + parentFS = p.L1.EditionFeatures + case *Message: + parentFS = p.L1.EditionFeatures + default: + panic(fmt.Sprintf("unknown parent type %T", parentDesc)) + } + return parentFS +} + +func unmarshalEditionDefault(b []byte) { + var ed Edition + var fs EditionFeatures + for len(b) > 0 { + num, typ, n := protowire.ConsumeTag(b) + b = b[n:] + switch typ { + case protowire.VarintType: + v, m := protowire.ConsumeVarint(b) + b = b[m:] + switch num { + case genid.FeatureSetDefaults_FeatureSetEditionDefault_Edition_field_number: + ed = Edition(v) + } + case protowire.BytesType: + v, m := protowire.ConsumeBytes(b) + b = b[m:] + switch num { + case genid.FeatureSetDefaults_FeatureSetEditionDefault_Features_field_number: + fs = unmarshalFeatureSet(v, fs) + } + } + } + defaultsCache[ed] = fs +} + +func unmarshalEditionDefaults(b []byte) { + for len(b) > 0 { + num, _, n := protowire.ConsumeTag(b) + b = b[n:] + switch num { + case genid.FeatureSetDefaults_Defaults_field_number: + def, m := protowire.ConsumeBytes(b) + b = b[m:] + unmarshalEditionDefault(def) + case genid.FeatureSetDefaults_MinimumEdition_field_number, + genid.FeatureSetDefaults_MaximumEdition_field_number: + // We don't care about the minimum and maximum editions. If the + // edition we are looking for later on is not in the cache we know + // it is outside of the range between minimum and maximum edition. + _, m := protowire.ConsumeVarint(b) + b = b[m:] + default: + panic(fmt.Sprintf("unkown field number %d while unmarshalling EditionDefault", num)) + } + } +} + +func getFeaturesFor(ed Edition) EditionFeatures { + if def, ok := defaultsCache[ed]; ok { + return def + } + panic(fmt.Sprintf("unsupported edition: %v", ed)) +} diff --git a/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go b/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go index 136f1b215..40272c893 100644 --- a/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go +++ b/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go @@ -12,6 +12,27 @@ import ( const File_google_protobuf_descriptor_proto = "google/protobuf/descriptor.proto" +// Full and short names for google.protobuf.Edition. +const ( + Edition_enum_fullname = "google.protobuf.Edition" + Edition_enum_name = "Edition" +) + +// Enum values for google.protobuf.Edition. +const ( + Edition_EDITION_UNKNOWN_enum_value = 0 + Edition_EDITION_PROTO2_enum_value = 998 + Edition_EDITION_PROTO3_enum_value = 999 + Edition_EDITION_2023_enum_value = 1000 + Edition_EDITION_2024_enum_value = 1001 + Edition_EDITION_1_TEST_ONLY_enum_value = 1 + Edition_EDITION_2_TEST_ONLY_enum_value = 2 + Edition_EDITION_99997_TEST_ONLY_enum_value = 99997 + Edition_EDITION_99998_TEST_ONLY_enum_value = 99998 + Edition_EDITION_99999_TEST_ONLY_enum_value = 99999 + Edition_EDITION_MAX_enum_value = 2147483647 +) + // Names for google.protobuf.FileDescriptorSet. const ( FileDescriptorSet_message_name protoreflect.Name = "FileDescriptorSet" @@ -81,7 +102,7 @@ const ( FileDescriptorProto_Options_field_number protoreflect.FieldNumber = 8 FileDescriptorProto_SourceCodeInfo_field_number protoreflect.FieldNumber = 9 FileDescriptorProto_Syntax_field_number protoreflect.FieldNumber = 12 - FileDescriptorProto_Edition_field_number protoreflect.FieldNumber = 13 + FileDescriptorProto_Edition_field_number protoreflect.FieldNumber = 14 ) // Names for google.protobuf.DescriptorProto. @@ -184,10 +205,12 @@ const ( const ( ExtensionRangeOptions_UninterpretedOption_field_name protoreflect.Name = "uninterpreted_option" ExtensionRangeOptions_Declaration_field_name protoreflect.Name = "declaration" + ExtensionRangeOptions_Features_field_name protoreflect.Name = "features" ExtensionRangeOptions_Verification_field_name protoreflect.Name = "verification" ExtensionRangeOptions_UninterpretedOption_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.uninterpreted_option" ExtensionRangeOptions_Declaration_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.declaration" + ExtensionRangeOptions_Features_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.features" ExtensionRangeOptions_Verification_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.verification" ) @@ -195,6 +218,7 @@ const ( const ( ExtensionRangeOptions_UninterpretedOption_field_number protoreflect.FieldNumber = 999 ExtensionRangeOptions_Declaration_field_number protoreflect.FieldNumber = 2 + ExtensionRangeOptions_Features_field_number protoreflect.FieldNumber = 50 ExtensionRangeOptions_Verification_field_number protoreflect.FieldNumber = 3 ) @@ -204,6 +228,12 @@ const ( ExtensionRangeOptions_VerificationState_enum_name = "VerificationState" ) +// Enum values for google.protobuf.ExtensionRangeOptions.VerificationState. +const ( + ExtensionRangeOptions_DECLARATION_enum_value = 0 + ExtensionRangeOptions_UNVERIFIED_enum_value = 1 +) + // Names for google.protobuf.ExtensionRangeOptions.Declaration. const ( ExtensionRangeOptions_Declaration_message_name protoreflect.Name = "Declaration" @@ -212,29 +242,26 @@ const ( // Field names for google.protobuf.ExtensionRangeOptions.Declaration. const ( - ExtensionRangeOptions_Declaration_Number_field_name protoreflect.Name = "number" - ExtensionRangeOptions_Declaration_FullName_field_name protoreflect.Name = "full_name" - ExtensionRangeOptions_Declaration_Type_field_name protoreflect.Name = "type" - ExtensionRangeOptions_Declaration_IsRepeated_field_name protoreflect.Name = "is_repeated" - ExtensionRangeOptions_Declaration_Reserved_field_name protoreflect.Name = "reserved" - ExtensionRangeOptions_Declaration_Repeated_field_name protoreflect.Name = "repeated" + ExtensionRangeOptions_Declaration_Number_field_name protoreflect.Name = "number" + ExtensionRangeOptions_Declaration_FullName_field_name protoreflect.Name = "full_name" + ExtensionRangeOptions_Declaration_Type_field_name protoreflect.Name = "type" + ExtensionRangeOptions_Declaration_Reserved_field_name protoreflect.Name = "reserved" + ExtensionRangeOptions_Declaration_Repeated_field_name protoreflect.Name = "repeated" - ExtensionRangeOptions_Declaration_Number_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.number" - ExtensionRangeOptions_Declaration_FullName_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.full_name" - ExtensionRangeOptions_Declaration_Type_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.type" - ExtensionRangeOptions_Declaration_IsRepeated_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.is_repeated" - ExtensionRangeOptions_Declaration_Reserved_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.reserved" - ExtensionRangeOptions_Declaration_Repeated_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.repeated" + ExtensionRangeOptions_Declaration_Number_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.number" + ExtensionRangeOptions_Declaration_FullName_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.full_name" + ExtensionRangeOptions_Declaration_Type_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.type" + ExtensionRangeOptions_Declaration_Reserved_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.reserved" + ExtensionRangeOptions_Declaration_Repeated_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.repeated" ) // Field numbers for google.protobuf.ExtensionRangeOptions.Declaration. const ( - ExtensionRangeOptions_Declaration_Number_field_number protoreflect.FieldNumber = 1 - ExtensionRangeOptions_Declaration_FullName_field_number protoreflect.FieldNumber = 2 - ExtensionRangeOptions_Declaration_Type_field_number protoreflect.FieldNumber = 3 - ExtensionRangeOptions_Declaration_IsRepeated_field_number protoreflect.FieldNumber = 4 - ExtensionRangeOptions_Declaration_Reserved_field_number protoreflect.FieldNumber = 5 - ExtensionRangeOptions_Declaration_Repeated_field_number protoreflect.FieldNumber = 6 + ExtensionRangeOptions_Declaration_Number_field_number protoreflect.FieldNumber = 1 + ExtensionRangeOptions_Declaration_FullName_field_number protoreflect.FieldNumber = 2 + ExtensionRangeOptions_Declaration_Type_field_number protoreflect.FieldNumber = 3 + ExtensionRangeOptions_Declaration_Reserved_field_number protoreflect.FieldNumber = 5 + ExtensionRangeOptions_Declaration_Repeated_field_number protoreflect.FieldNumber = 6 ) // Names for google.protobuf.FieldDescriptorProto. @@ -291,12 +318,41 @@ const ( FieldDescriptorProto_Type_enum_name = "Type" ) +// Enum values for google.protobuf.FieldDescriptorProto.Type. +const ( + FieldDescriptorProto_TYPE_DOUBLE_enum_value = 1 + FieldDescriptorProto_TYPE_FLOAT_enum_value = 2 + FieldDescriptorProto_TYPE_INT64_enum_value = 3 + FieldDescriptorProto_TYPE_UINT64_enum_value = 4 + FieldDescriptorProto_TYPE_INT32_enum_value = 5 + FieldDescriptorProto_TYPE_FIXED64_enum_value = 6 + FieldDescriptorProto_TYPE_FIXED32_enum_value = 7 + FieldDescriptorProto_TYPE_BOOL_enum_value = 8 + FieldDescriptorProto_TYPE_STRING_enum_value = 9 + FieldDescriptorProto_TYPE_GROUP_enum_value = 10 + FieldDescriptorProto_TYPE_MESSAGE_enum_value = 11 + FieldDescriptorProto_TYPE_BYTES_enum_value = 12 + FieldDescriptorProto_TYPE_UINT32_enum_value = 13 + FieldDescriptorProto_TYPE_ENUM_enum_value = 14 + FieldDescriptorProto_TYPE_SFIXED32_enum_value = 15 + FieldDescriptorProto_TYPE_SFIXED64_enum_value = 16 + FieldDescriptorProto_TYPE_SINT32_enum_value = 17 + FieldDescriptorProto_TYPE_SINT64_enum_value = 18 +) + // Full and short names for google.protobuf.FieldDescriptorProto.Label. const ( FieldDescriptorProto_Label_enum_fullname = "google.protobuf.FieldDescriptorProto.Label" FieldDescriptorProto_Label_enum_name = "Label" ) +// Enum values for google.protobuf.FieldDescriptorProto.Label. +const ( + FieldDescriptorProto_LABEL_OPTIONAL_enum_value = 1 + FieldDescriptorProto_LABEL_REPEATED_enum_value = 3 + FieldDescriptorProto_LABEL_REQUIRED_enum_value = 2 +) + // Names for google.protobuf.OneofDescriptorProto. const ( OneofDescriptorProto_message_name protoreflect.Name = "OneofDescriptorProto" @@ -468,7 +524,6 @@ const ( FileOptions_CcGenericServices_field_name protoreflect.Name = "cc_generic_services" FileOptions_JavaGenericServices_field_name protoreflect.Name = "java_generic_services" FileOptions_PyGenericServices_field_name protoreflect.Name = "py_generic_services" - FileOptions_PhpGenericServices_field_name protoreflect.Name = "php_generic_services" FileOptions_Deprecated_field_name protoreflect.Name = "deprecated" FileOptions_CcEnableArenas_field_name protoreflect.Name = "cc_enable_arenas" FileOptions_ObjcClassPrefix_field_name protoreflect.Name = "objc_class_prefix" @@ -478,6 +533,7 @@ const ( FileOptions_PhpNamespace_field_name protoreflect.Name = "php_namespace" FileOptions_PhpMetadataNamespace_field_name protoreflect.Name = "php_metadata_namespace" FileOptions_RubyPackage_field_name protoreflect.Name = "ruby_package" + FileOptions_Features_field_name protoreflect.Name = "features" FileOptions_UninterpretedOption_field_name protoreflect.Name = "uninterpreted_option" FileOptions_JavaPackage_field_fullname protoreflect.FullName = "google.protobuf.FileOptions.java_package" @@ -490,7 +546,6 @@ const ( FileOptions_CcGenericServices_field_fullname protoreflect.FullName = "google.protobuf.FileOptions.cc_generic_services" FileOptions_JavaGenericServices_field_fullname protoreflect.FullName = "google.protobuf.FileOptions.java_generic_services" FileOptions_PyGenericServices_field_fullname protoreflect.FullName = "google.protobuf.FileOptions.py_generic_services" - FileOptions_PhpGenericServices_field_fullname protoreflect.FullName = "google.protobuf.FileOptions.php_generic_services" FileOptions_Deprecated_field_fullname protoreflect.FullName = "google.protobuf.FileOptions.deprecated" FileOptions_CcEnableArenas_field_fullname protoreflect.FullName = "google.protobuf.FileOptions.cc_enable_arenas" FileOptions_ObjcClassPrefix_field_fullname protoreflect.FullName = "google.protobuf.FileOptions.objc_class_prefix" @@ -500,6 +555,7 @@ const ( FileOptions_PhpNamespace_field_fullname protoreflect.FullName = "google.protobuf.FileOptions.php_namespace" FileOptions_PhpMetadataNamespace_field_fullname protoreflect.FullName = "google.protobuf.FileOptions.php_metadata_namespace" FileOptions_RubyPackage_field_fullname protoreflect.FullName = "google.protobuf.FileOptions.ruby_package" + FileOptions_Features_field_fullname protoreflect.FullName = "google.protobuf.FileOptions.features" FileOptions_UninterpretedOption_field_fullname protoreflect.FullName = "google.protobuf.FileOptions.uninterpreted_option" ) @@ -515,7 +571,6 @@ const ( FileOptions_CcGenericServices_field_number protoreflect.FieldNumber = 16 FileOptions_JavaGenericServices_field_number protoreflect.FieldNumber = 17 FileOptions_PyGenericServices_field_number protoreflect.FieldNumber = 18 - FileOptions_PhpGenericServices_field_number protoreflect.FieldNumber = 42 FileOptions_Deprecated_field_number protoreflect.FieldNumber = 23 FileOptions_CcEnableArenas_field_number protoreflect.FieldNumber = 31 FileOptions_ObjcClassPrefix_field_number protoreflect.FieldNumber = 36 @@ -525,6 +580,7 @@ const ( FileOptions_PhpNamespace_field_number protoreflect.FieldNumber = 41 FileOptions_PhpMetadataNamespace_field_number protoreflect.FieldNumber = 44 FileOptions_RubyPackage_field_number protoreflect.FieldNumber = 45 + FileOptions_Features_field_number protoreflect.FieldNumber = 50 FileOptions_UninterpretedOption_field_number protoreflect.FieldNumber = 999 ) @@ -534,6 +590,13 @@ const ( FileOptions_OptimizeMode_enum_name = "OptimizeMode" ) +// Enum values for google.protobuf.FileOptions.OptimizeMode. +const ( + FileOptions_SPEED_enum_value = 1 + FileOptions_CODE_SIZE_enum_value = 2 + FileOptions_LITE_RUNTIME_enum_value = 3 +) + // Names for google.protobuf.MessageOptions. const ( MessageOptions_message_name protoreflect.Name = "MessageOptions" @@ -547,6 +610,7 @@ const ( MessageOptions_Deprecated_field_name protoreflect.Name = "deprecated" MessageOptions_MapEntry_field_name protoreflect.Name = "map_entry" MessageOptions_DeprecatedLegacyJsonFieldConflicts_field_name protoreflect.Name = "deprecated_legacy_json_field_conflicts" + MessageOptions_Features_field_name protoreflect.Name = "features" MessageOptions_UninterpretedOption_field_name protoreflect.Name = "uninterpreted_option" MessageOptions_MessageSetWireFormat_field_fullname protoreflect.FullName = "google.protobuf.MessageOptions.message_set_wire_format" @@ -554,6 +618,7 @@ const ( MessageOptions_Deprecated_field_fullname protoreflect.FullName = "google.protobuf.MessageOptions.deprecated" MessageOptions_MapEntry_field_fullname protoreflect.FullName = "google.protobuf.MessageOptions.map_entry" MessageOptions_DeprecatedLegacyJsonFieldConflicts_field_fullname protoreflect.FullName = "google.protobuf.MessageOptions.deprecated_legacy_json_field_conflicts" + MessageOptions_Features_field_fullname protoreflect.FullName = "google.protobuf.MessageOptions.features" MessageOptions_UninterpretedOption_field_fullname protoreflect.FullName = "google.protobuf.MessageOptions.uninterpreted_option" ) @@ -564,6 +629,7 @@ const ( MessageOptions_Deprecated_field_number protoreflect.FieldNumber = 3 MessageOptions_MapEntry_field_number protoreflect.FieldNumber = 7 MessageOptions_DeprecatedLegacyJsonFieldConflicts_field_number protoreflect.FieldNumber = 11 + MessageOptions_Features_field_number protoreflect.FieldNumber = 12 MessageOptions_UninterpretedOption_field_number protoreflect.FieldNumber = 999 ) @@ -584,8 +650,9 @@ const ( FieldOptions_Weak_field_name protoreflect.Name = "weak" FieldOptions_DebugRedact_field_name protoreflect.Name = "debug_redact" FieldOptions_Retention_field_name protoreflect.Name = "retention" - FieldOptions_Target_field_name protoreflect.Name = "target" FieldOptions_Targets_field_name protoreflect.Name = "targets" + FieldOptions_EditionDefaults_field_name protoreflect.Name = "edition_defaults" + FieldOptions_Features_field_name protoreflect.Name = "features" FieldOptions_UninterpretedOption_field_name protoreflect.Name = "uninterpreted_option" FieldOptions_Ctype_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.ctype" @@ -597,8 +664,9 @@ const ( FieldOptions_Weak_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.weak" FieldOptions_DebugRedact_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.debug_redact" FieldOptions_Retention_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.retention" - FieldOptions_Target_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.target" FieldOptions_Targets_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.targets" + FieldOptions_EditionDefaults_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.edition_defaults" + FieldOptions_Features_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.features" FieldOptions_UninterpretedOption_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.uninterpreted_option" ) @@ -613,8 +681,9 @@ const ( FieldOptions_Weak_field_number protoreflect.FieldNumber = 10 FieldOptions_DebugRedact_field_number protoreflect.FieldNumber = 16 FieldOptions_Retention_field_number protoreflect.FieldNumber = 17 - FieldOptions_Target_field_number protoreflect.FieldNumber = 18 FieldOptions_Targets_field_number protoreflect.FieldNumber = 19 + FieldOptions_EditionDefaults_field_number protoreflect.FieldNumber = 20 + FieldOptions_Features_field_number protoreflect.FieldNumber = 21 FieldOptions_UninterpretedOption_field_number protoreflect.FieldNumber = 999 ) @@ -624,24 +693,80 @@ const ( FieldOptions_CType_enum_name = "CType" ) +// Enum values for google.protobuf.FieldOptions.CType. +const ( + FieldOptions_STRING_enum_value = 0 + FieldOptions_CORD_enum_value = 1 + FieldOptions_STRING_PIECE_enum_value = 2 +) + // Full and short names for google.protobuf.FieldOptions.JSType. const ( FieldOptions_JSType_enum_fullname = "google.protobuf.FieldOptions.JSType" FieldOptions_JSType_enum_name = "JSType" ) +// Enum values for google.protobuf.FieldOptions.JSType. +const ( + FieldOptions_JS_NORMAL_enum_value = 0 + FieldOptions_JS_STRING_enum_value = 1 + FieldOptions_JS_NUMBER_enum_value = 2 +) + // Full and short names for google.protobuf.FieldOptions.OptionRetention. const ( FieldOptions_OptionRetention_enum_fullname = "google.protobuf.FieldOptions.OptionRetention" FieldOptions_OptionRetention_enum_name = "OptionRetention" ) +// Enum values for google.protobuf.FieldOptions.OptionRetention. +const ( + FieldOptions_RETENTION_UNKNOWN_enum_value = 0 + FieldOptions_RETENTION_RUNTIME_enum_value = 1 + FieldOptions_RETENTION_SOURCE_enum_value = 2 +) + // Full and short names for google.protobuf.FieldOptions.OptionTargetType. const ( FieldOptions_OptionTargetType_enum_fullname = "google.protobuf.FieldOptions.OptionTargetType" FieldOptions_OptionTargetType_enum_name = "OptionTargetType" ) +// Enum values for google.protobuf.FieldOptions.OptionTargetType. +const ( + FieldOptions_TARGET_TYPE_UNKNOWN_enum_value = 0 + FieldOptions_TARGET_TYPE_FILE_enum_value = 1 + FieldOptions_TARGET_TYPE_EXTENSION_RANGE_enum_value = 2 + FieldOptions_TARGET_TYPE_MESSAGE_enum_value = 3 + FieldOptions_TARGET_TYPE_FIELD_enum_value = 4 + FieldOptions_TARGET_TYPE_ONEOF_enum_value = 5 + FieldOptions_TARGET_TYPE_ENUM_enum_value = 6 + FieldOptions_TARGET_TYPE_ENUM_ENTRY_enum_value = 7 + FieldOptions_TARGET_TYPE_SERVICE_enum_value = 8 + FieldOptions_TARGET_TYPE_METHOD_enum_value = 9 +) + +// Names for google.protobuf.FieldOptions.EditionDefault. +const ( + FieldOptions_EditionDefault_message_name protoreflect.Name = "EditionDefault" + FieldOptions_EditionDefault_message_fullname protoreflect.FullName = "google.protobuf.FieldOptions.EditionDefault" +) + +// Field names for google.protobuf.FieldOptions.EditionDefault. +const ( + FieldOptions_EditionDefault_Edition_field_name protoreflect.Name = "edition" + FieldOptions_EditionDefault_Value_field_name protoreflect.Name = "value" + + FieldOptions_EditionDefault_Edition_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.EditionDefault.edition" + FieldOptions_EditionDefault_Value_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.EditionDefault.value" +) + +// Field numbers for google.protobuf.FieldOptions.EditionDefault. +const ( + FieldOptions_EditionDefault_Edition_field_number protoreflect.FieldNumber = 3 + FieldOptions_EditionDefault_Value_field_number protoreflect.FieldNumber = 2 +) + // Names for google.protobuf.OneofOptions. const ( OneofOptions_message_name protoreflect.Name = "OneofOptions" @@ -650,13 +775,16 @@ const ( // Field names for google.protobuf.OneofOptions. const ( + OneofOptions_Features_field_name protoreflect.Name = "features" OneofOptions_UninterpretedOption_field_name protoreflect.Name = "uninterpreted_option" + OneofOptions_Features_field_fullname protoreflect.FullName = "google.protobuf.OneofOptions.features" OneofOptions_UninterpretedOption_field_fullname protoreflect.FullName = "google.protobuf.OneofOptions.uninterpreted_option" ) // Field numbers for google.protobuf.OneofOptions. const ( + OneofOptions_Features_field_number protoreflect.FieldNumber = 1 OneofOptions_UninterpretedOption_field_number protoreflect.FieldNumber = 999 ) @@ -671,11 +799,13 @@ const ( EnumOptions_AllowAlias_field_name protoreflect.Name = "allow_alias" EnumOptions_Deprecated_field_name protoreflect.Name = "deprecated" EnumOptions_DeprecatedLegacyJsonFieldConflicts_field_name protoreflect.Name = "deprecated_legacy_json_field_conflicts" + EnumOptions_Features_field_name protoreflect.Name = "features" EnumOptions_UninterpretedOption_field_name protoreflect.Name = "uninterpreted_option" EnumOptions_AllowAlias_field_fullname protoreflect.FullName = "google.protobuf.EnumOptions.allow_alias" EnumOptions_Deprecated_field_fullname protoreflect.FullName = "google.protobuf.EnumOptions.deprecated" EnumOptions_DeprecatedLegacyJsonFieldConflicts_field_fullname protoreflect.FullName = "google.protobuf.EnumOptions.deprecated_legacy_json_field_conflicts" + EnumOptions_Features_field_fullname protoreflect.FullName = "google.protobuf.EnumOptions.features" EnumOptions_UninterpretedOption_field_fullname protoreflect.FullName = "google.protobuf.EnumOptions.uninterpreted_option" ) @@ -684,6 +814,7 @@ const ( EnumOptions_AllowAlias_field_number protoreflect.FieldNumber = 2 EnumOptions_Deprecated_field_number protoreflect.FieldNumber = 3 EnumOptions_DeprecatedLegacyJsonFieldConflicts_field_number protoreflect.FieldNumber = 6 + EnumOptions_Features_field_number protoreflect.FieldNumber = 7 EnumOptions_UninterpretedOption_field_number protoreflect.FieldNumber = 999 ) @@ -696,15 +827,21 @@ const ( // Field names for google.protobuf.EnumValueOptions. const ( EnumValueOptions_Deprecated_field_name protoreflect.Name = "deprecated" + EnumValueOptions_Features_field_name protoreflect.Name = "features" + EnumValueOptions_DebugRedact_field_name protoreflect.Name = "debug_redact" EnumValueOptions_UninterpretedOption_field_name protoreflect.Name = "uninterpreted_option" EnumValueOptions_Deprecated_field_fullname protoreflect.FullName = "google.protobuf.EnumValueOptions.deprecated" + EnumValueOptions_Features_field_fullname protoreflect.FullName = "google.protobuf.EnumValueOptions.features" + EnumValueOptions_DebugRedact_field_fullname protoreflect.FullName = "google.protobuf.EnumValueOptions.debug_redact" EnumValueOptions_UninterpretedOption_field_fullname protoreflect.FullName = "google.protobuf.EnumValueOptions.uninterpreted_option" ) // Field numbers for google.protobuf.EnumValueOptions. const ( EnumValueOptions_Deprecated_field_number protoreflect.FieldNumber = 1 + EnumValueOptions_Features_field_number protoreflect.FieldNumber = 2 + EnumValueOptions_DebugRedact_field_number protoreflect.FieldNumber = 3 EnumValueOptions_UninterpretedOption_field_number protoreflect.FieldNumber = 999 ) @@ -716,15 +853,18 @@ const ( // Field names for google.protobuf.ServiceOptions. const ( + ServiceOptions_Features_field_name protoreflect.Name = "features" ServiceOptions_Deprecated_field_name protoreflect.Name = "deprecated" ServiceOptions_UninterpretedOption_field_name protoreflect.Name = "uninterpreted_option" + ServiceOptions_Features_field_fullname protoreflect.FullName = "google.protobuf.ServiceOptions.features" ServiceOptions_Deprecated_field_fullname protoreflect.FullName = "google.protobuf.ServiceOptions.deprecated" ServiceOptions_UninterpretedOption_field_fullname protoreflect.FullName = "google.protobuf.ServiceOptions.uninterpreted_option" ) // Field numbers for google.protobuf.ServiceOptions. const ( + ServiceOptions_Features_field_number protoreflect.FieldNumber = 34 ServiceOptions_Deprecated_field_number protoreflect.FieldNumber = 33 ServiceOptions_UninterpretedOption_field_number protoreflect.FieldNumber = 999 ) @@ -739,10 +879,12 @@ const ( const ( MethodOptions_Deprecated_field_name protoreflect.Name = "deprecated" MethodOptions_IdempotencyLevel_field_name protoreflect.Name = "idempotency_level" + MethodOptions_Features_field_name protoreflect.Name = "features" MethodOptions_UninterpretedOption_field_name protoreflect.Name = "uninterpreted_option" MethodOptions_Deprecated_field_fullname protoreflect.FullName = "google.protobuf.MethodOptions.deprecated" MethodOptions_IdempotencyLevel_field_fullname protoreflect.FullName = "google.protobuf.MethodOptions.idempotency_level" + MethodOptions_Features_field_fullname protoreflect.FullName = "google.protobuf.MethodOptions.features" MethodOptions_UninterpretedOption_field_fullname protoreflect.FullName = "google.protobuf.MethodOptions.uninterpreted_option" ) @@ -750,6 +892,7 @@ const ( const ( MethodOptions_Deprecated_field_number protoreflect.FieldNumber = 33 MethodOptions_IdempotencyLevel_field_number protoreflect.FieldNumber = 34 + MethodOptions_Features_field_number protoreflect.FieldNumber = 35 MethodOptions_UninterpretedOption_field_number protoreflect.FieldNumber = 999 ) @@ -759,6 +902,13 @@ const ( MethodOptions_IdempotencyLevel_enum_name = "IdempotencyLevel" ) +// Enum values for google.protobuf.MethodOptions.IdempotencyLevel. +const ( + MethodOptions_IDEMPOTENCY_UNKNOWN_enum_value = 0 + MethodOptions_NO_SIDE_EFFECTS_enum_value = 1 + MethodOptions_IDEMPOTENT_enum_value = 2 +) + // Names for google.protobuf.UninterpretedOption. const ( UninterpretedOption_message_name protoreflect.Name = "UninterpretedOption" @@ -816,6 +966,163 @@ const ( UninterpretedOption_NamePart_IsExtension_field_number protoreflect.FieldNumber = 2 ) +// Names for google.protobuf.FeatureSet. +const ( + FeatureSet_message_name protoreflect.Name = "FeatureSet" + FeatureSet_message_fullname protoreflect.FullName = "google.protobuf.FeatureSet" +) + +// Field names for google.protobuf.FeatureSet. +const ( + FeatureSet_FieldPresence_field_name protoreflect.Name = "field_presence" + FeatureSet_EnumType_field_name protoreflect.Name = "enum_type" + FeatureSet_RepeatedFieldEncoding_field_name protoreflect.Name = "repeated_field_encoding" + FeatureSet_Utf8Validation_field_name protoreflect.Name = "utf8_validation" + FeatureSet_MessageEncoding_field_name protoreflect.Name = "message_encoding" + FeatureSet_JsonFormat_field_name protoreflect.Name = "json_format" + + FeatureSet_FieldPresence_field_fullname protoreflect.FullName = "google.protobuf.FeatureSet.field_presence" + FeatureSet_EnumType_field_fullname protoreflect.FullName = "google.protobuf.FeatureSet.enum_type" + FeatureSet_RepeatedFieldEncoding_field_fullname protoreflect.FullName = "google.protobuf.FeatureSet.repeated_field_encoding" + FeatureSet_Utf8Validation_field_fullname protoreflect.FullName = "google.protobuf.FeatureSet.utf8_validation" + FeatureSet_MessageEncoding_field_fullname protoreflect.FullName = "google.protobuf.FeatureSet.message_encoding" + FeatureSet_JsonFormat_field_fullname protoreflect.FullName = "google.protobuf.FeatureSet.json_format" +) + +// Field numbers for google.protobuf.FeatureSet. +const ( + FeatureSet_FieldPresence_field_number protoreflect.FieldNumber = 1 + FeatureSet_EnumType_field_number protoreflect.FieldNumber = 2 + FeatureSet_RepeatedFieldEncoding_field_number protoreflect.FieldNumber = 3 + FeatureSet_Utf8Validation_field_number protoreflect.FieldNumber = 4 + FeatureSet_MessageEncoding_field_number protoreflect.FieldNumber = 5 + FeatureSet_JsonFormat_field_number protoreflect.FieldNumber = 6 +) + +// Full and short names for google.protobuf.FeatureSet.FieldPresence. +const ( + FeatureSet_FieldPresence_enum_fullname = "google.protobuf.FeatureSet.FieldPresence" + FeatureSet_FieldPresence_enum_name = "FieldPresence" +) + +// Enum values for google.protobuf.FeatureSet.FieldPresence. +const ( + FeatureSet_FIELD_PRESENCE_UNKNOWN_enum_value = 0 + FeatureSet_EXPLICIT_enum_value = 1 + FeatureSet_IMPLICIT_enum_value = 2 + FeatureSet_LEGACY_REQUIRED_enum_value = 3 +) + +// Full and short names for google.protobuf.FeatureSet.EnumType. +const ( + FeatureSet_EnumType_enum_fullname = "google.protobuf.FeatureSet.EnumType" + FeatureSet_EnumType_enum_name = "EnumType" +) + +// Enum values for google.protobuf.FeatureSet.EnumType. +const ( + FeatureSet_ENUM_TYPE_UNKNOWN_enum_value = 0 + FeatureSet_OPEN_enum_value = 1 + FeatureSet_CLOSED_enum_value = 2 +) + +// Full and short names for google.protobuf.FeatureSet.RepeatedFieldEncoding. +const ( + FeatureSet_RepeatedFieldEncoding_enum_fullname = "google.protobuf.FeatureSet.RepeatedFieldEncoding" + FeatureSet_RepeatedFieldEncoding_enum_name = "RepeatedFieldEncoding" +) + +// Enum values for google.protobuf.FeatureSet.RepeatedFieldEncoding. +const ( + FeatureSet_REPEATED_FIELD_ENCODING_UNKNOWN_enum_value = 0 + FeatureSet_PACKED_enum_value = 1 + FeatureSet_EXPANDED_enum_value = 2 +) + +// Full and short names for google.protobuf.FeatureSet.Utf8Validation. +const ( + FeatureSet_Utf8Validation_enum_fullname = "google.protobuf.FeatureSet.Utf8Validation" + FeatureSet_Utf8Validation_enum_name = "Utf8Validation" +) + +// Enum values for google.protobuf.FeatureSet.Utf8Validation. +const ( + FeatureSet_UTF8_VALIDATION_UNKNOWN_enum_value = 0 + FeatureSet_VERIFY_enum_value = 2 + FeatureSet_NONE_enum_value = 3 +) + +// Full and short names for google.protobuf.FeatureSet.MessageEncoding. +const ( + FeatureSet_MessageEncoding_enum_fullname = "google.protobuf.FeatureSet.MessageEncoding" + FeatureSet_MessageEncoding_enum_name = "MessageEncoding" +) + +// Enum values for google.protobuf.FeatureSet.MessageEncoding. +const ( + FeatureSet_MESSAGE_ENCODING_UNKNOWN_enum_value = 0 + FeatureSet_LENGTH_PREFIXED_enum_value = 1 + FeatureSet_DELIMITED_enum_value = 2 +) + +// Full and short names for google.protobuf.FeatureSet.JsonFormat. +const ( + FeatureSet_JsonFormat_enum_fullname = "google.protobuf.FeatureSet.JsonFormat" + FeatureSet_JsonFormat_enum_name = "JsonFormat" +) + +// Enum values for google.protobuf.FeatureSet.JsonFormat. +const ( + FeatureSet_JSON_FORMAT_UNKNOWN_enum_value = 0 + FeatureSet_ALLOW_enum_value = 1 + FeatureSet_LEGACY_BEST_EFFORT_enum_value = 2 +) + +// Names for google.protobuf.FeatureSetDefaults. +const ( + FeatureSetDefaults_message_name protoreflect.Name = "FeatureSetDefaults" + FeatureSetDefaults_message_fullname protoreflect.FullName = "google.protobuf.FeatureSetDefaults" +) + +// Field names for google.protobuf.FeatureSetDefaults. +const ( + FeatureSetDefaults_Defaults_field_name protoreflect.Name = "defaults" + FeatureSetDefaults_MinimumEdition_field_name protoreflect.Name = "minimum_edition" + FeatureSetDefaults_MaximumEdition_field_name protoreflect.Name = "maximum_edition" + + FeatureSetDefaults_Defaults_field_fullname protoreflect.FullName = "google.protobuf.FeatureSetDefaults.defaults" + FeatureSetDefaults_MinimumEdition_field_fullname protoreflect.FullName = "google.protobuf.FeatureSetDefaults.minimum_edition" + FeatureSetDefaults_MaximumEdition_field_fullname protoreflect.FullName = "google.protobuf.FeatureSetDefaults.maximum_edition" +) + +// Field numbers for google.protobuf.FeatureSetDefaults. +const ( + FeatureSetDefaults_Defaults_field_number protoreflect.FieldNumber = 1 + FeatureSetDefaults_MinimumEdition_field_number protoreflect.FieldNumber = 4 + FeatureSetDefaults_MaximumEdition_field_number protoreflect.FieldNumber = 5 +) + +// Names for google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault. +const ( + FeatureSetDefaults_FeatureSetEditionDefault_message_name protoreflect.Name = "FeatureSetEditionDefault" + FeatureSetDefaults_FeatureSetEditionDefault_message_fullname protoreflect.FullName = "google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault" +) + +// Field names for google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault. +const ( + FeatureSetDefaults_FeatureSetEditionDefault_Edition_field_name protoreflect.Name = "edition" + FeatureSetDefaults_FeatureSetEditionDefault_Features_field_name protoreflect.Name = "features" + + FeatureSetDefaults_FeatureSetEditionDefault_Edition_field_fullname protoreflect.FullName = "google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.edition" + FeatureSetDefaults_FeatureSetEditionDefault_Features_field_fullname protoreflect.FullName = "google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.features" +) + +// Field numbers for google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault. +const ( + FeatureSetDefaults_FeatureSetEditionDefault_Edition_field_number protoreflect.FieldNumber = 3 + FeatureSetDefaults_FeatureSetEditionDefault_Features_field_number protoreflect.FieldNumber = 2 +) + // Names for google.protobuf.SourceCodeInfo. const ( SourceCodeInfo_message_name protoreflect.Name = "SourceCodeInfo" @@ -917,3 +1224,10 @@ const ( GeneratedCodeInfo_Annotation_Semantic_enum_fullname = "google.protobuf.GeneratedCodeInfo.Annotation.Semantic" GeneratedCodeInfo_Annotation_Semantic_enum_name = "Semantic" ) + +// Enum values for google.protobuf.GeneratedCodeInfo.Annotation.Semantic. +const ( + GeneratedCodeInfo_Annotation_NONE_enum_value = 0 + GeneratedCodeInfo_Annotation_SET_enum_value = 1 + GeneratedCodeInfo_Annotation_ALIAS_enum_value = 2 +) diff --git a/vendor/google.golang.org/protobuf/internal/genid/go_features_gen.go b/vendor/google.golang.org/protobuf/internal/genid/go_features_gen.go new file mode 100644 index 000000000..fd9015e8e --- /dev/null +++ b/vendor/google.golang.org/protobuf/internal/genid/go_features_gen.go @@ -0,0 +1,31 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Code generated by generate-protos. DO NOT EDIT. + +package genid + +import ( + protoreflect "google.golang.org/protobuf/reflect/protoreflect" +) + +const File_reflect_protodesc_proto_go_features_proto = "reflect/protodesc/proto/go_features.proto" + +// Names for google.protobuf.GoFeatures. +const ( + GoFeatures_message_name protoreflect.Name = "GoFeatures" + GoFeatures_message_fullname protoreflect.FullName = "google.protobuf.GoFeatures" +) + +// Field names for google.protobuf.GoFeatures. +const ( + GoFeatures_LegacyUnmarshalJsonEnum_field_name protoreflect.Name = "legacy_unmarshal_json_enum" + + GoFeatures_LegacyUnmarshalJsonEnum_field_fullname protoreflect.FullName = "google.protobuf.GoFeatures.legacy_unmarshal_json_enum" +) + +// Field numbers for google.protobuf.GoFeatures. +const ( + GoFeatures_LegacyUnmarshalJsonEnum_field_number protoreflect.FieldNumber = 1 +) diff --git a/vendor/google.golang.org/protobuf/internal/genid/struct_gen.go b/vendor/google.golang.org/protobuf/internal/genid/struct_gen.go index 1a38944b2..ad6f80c46 100644 --- a/vendor/google.golang.org/protobuf/internal/genid/struct_gen.go +++ b/vendor/google.golang.org/protobuf/internal/genid/struct_gen.go @@ -18,6 +18,11 @@ const ( NullValue_enum_name = "NullValue" ) +// Enum values for google.protobuf.NullValue. +const ( + NullValue_NULL_VALUE_enum_value = 0 +) + // Names for google.protobuf.Struct. const ( Struct_message_name protoreflect.Name = "Struct" diff --git a/vendor/google.golang.org/protobuf/internal/genid/type_gen.go b/vendor/google.golang.org/protobuf/internal/genid/type_gen.go index e0f75fea0..49bc73e25 100644 --- a/vendor/google.golang.org/protobuf/internal/genid/type_gen.go +++ b/vendor/google.golang.org/protobuf/internal/genid/type_gen.go @@ -18,6 +18,13 @@ const ( Syntax_enum_name = "Syntax" ) +// Enum values for google.protobuf.Syntax. +const ( + Syntax_SYNTAX_PROTO2_enum_value = 0 + Syntax_SYNTAX_PROTO3_enum_value = 1 + Syntax_SYNTAX_EDITIONS_enum_value = 2 +) + // Names for google.protobuf.Type. const ( Type_message_name protoreflect.Name = "Type" @@ -105,12 +112,43 @@ const ( Field_Kind_enum_name = "Kind" ) +// Enum values for google.protobuf.Field.Kind. +const ( + Field_TYPE_UNKNOWN_enum_value = 0 + Field_TYPE_DOUBLE_enum_value = 1 + Field_TYPE_FLOAT_enum_value = 2 + Field_TYPE_INT64_enum_value = 3 + Field_TYPE_UINT64_enum_value = 4 + Field_TYPE_INT32_enum_value = 5 + Field_TYPE_FIXED64_enum_value = 6 + Field_TYPE_FIXED32_enum_value = 7 + Field_TYPE_BOOL_enum_value = 8 + Field_TYPE_STRING_enum_value = 9 + Field_TYPE_GROUP_enum_value = 10 + Field_TYPE_MESSAGE_enum_value = 11 + Field_TYPE_BYTES_enum_value = 12 + Field_TYPE_UINT32_enum_value = 13 + Field_TYPE_ENUM_enum_value = 14 + Field_TYPE_SFIXED32_enum_value = 15 + Field_TYPE_SFIXED64_enum_value = 16 + Field_TYPE_SINT32_enum_value = 17 + Field_TYPE_SINT64_enum_value = 18 +) + // Full and short names for google.protobuf.Field.Cardinality. const ( Field_Cardinality_enum_fullname = "google.protobuf.Field.Cardinality" Field_Cardinality_enum_name = "Cardinality" ) +// Enum values for google.protobuf.Field.Cardinality. +const ( + Field_CARDINALITY_UNKNOWN_enum_value = 0 + Field_CARDINALITY_OPTIONAL_enum_value = 1 + Field_CARDINALITY_REQUIRED_enum_value = 2 + Field_CARDINALITY_REPEATED_enum_value = 3 +) + // Names for google.protobuf.Enum. const ( Enum_message_name protoreflect.Name = "Enum" diff --git a/vendor/google.golang.org/protobuf/internal/impl/codec_extension.go b/vendor/google.golang.org/protobuf/internal/impl/codec_extension.go index e74cefdc5..2b8f122c2 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/codec_extension.go +++ b/vendor/google.golang.org/protobuf/internal/impl/codec_extension.go @@ -21,26 +21,18 @@ type extensionFieldInfo struct { validation validationInfo } -var legacyExtensionFieldInfoCache sync.Map // map[protoreflect.ExtensionType]*extensionFieldInfo - func getExtensionFieldInfo(xt protoreflect.ExtensionType) *extensionFieldInfo { if xi, ok := xt.(*ExtensionInfo); ok { xi.lazyInit() return xi.info } - return legacyLoadExtensionFieldInfo(xt) -} - -// legacyLoadExtensionFieldInfo dynamically loads a *ExtensionInfo for xt. -func legacyLoadExtensionFieldInfo(xt protoreflect.ExtensionType) *extensionFieldInfo { - if xi, ok := legacyExtensionFieldInfoCache.Load(xt); ok { - return xi.(*extensionFieldInfo) - } - e := makeExtensionFieldInfo(xt.TypeDescriptor()) - if e, ok := legacyMessageTypeCache.LoadOrStore(xt, e); ok { - return e.(*extensionFieldInfo) - } - return e + // Ideally we'd cache the resulting *extensionFieldInfo so we don't have to + // recompute this metadata repeatedly. But without support for something like + // weak references, such a cache would pin temporary values (like dynamic + // extension types, constructed for the duration of a user request) to the + // heap forever, causing memory usage of the cache to grow unbounded. + // See discussion in https://github.com/golang/protobuf/issues/1521. + return makeExtensionFieldInfo(xt.TypeDescriptor()) } func makeExtensionFieldInfo(xd protoreflect.ExtensionDescriptor) *extensionFieldInfo { diff --git a/vendor/google.golang.org/protobuf/internal/impl/codec_gen.go b/vendor/google.golang.org/protobuf/internal/impl/codec_gen.go index 1a509b63e..f55dc01e3 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/codec_gen.go +++ b/vendor/google.golang.org/protobuf/internal/impl/codec_gen.go @@ -162,11 +162,20 @@ func appendBoolSlice(b []byte, p pointer, f *coderFieldInfo, opts marshalOptions func consumeBoolSlice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) { sp := p.BoolSlice() if wtyp == protowire.BytesType { - s := *sp b, n := protowire.ConsumeBytes(b) if n < 0 { return out, errDecode } + count := 0 + for _, v := range b { + if v < 0x80 { + count++ + } + } + if count > 0 { + p.growBoolSlice(count) + } + s := *sp for len(b) > 0 { var v uint64 var n int @@ -732,11 +741,20 @@ func appendInt32Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOption func consumeInt32Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) { sp := p.Int32Slice() if wtyp == protowire.BytesType { - s := *sp b, n := protowire.ConsumeBytes(b) if n < 0 { return out, errDecode } + count := 0 + for _, v := range b { + if v < 0x80 { + count++ + } + } + if count > 0 { + p.growInt32Slice(count) + } + s := *sp for len(b) > 0 { var v uint64 var n int @@ -1138,11 +1156,20 @@ func appendSint32Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOptio func consumeSint32Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) { sp := p.Int32Slice() if wtyp == protowire.BytesType { - s := *sp b, n := protowire.ConsumeBytes(b) if n < 0 { return out, errDecode } + count := 0 + for _, v := range b { + if v < 0x80 { + count++ + } + } + if count > 0 { + p.growInt32Slice(count) + } + s := *sp for len(b) > 0 { var v uint64 var n int @@ -1544,11 +1571,20 @@ func appendUint32Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOptio func consumeUint32Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) { sp := p.Uint32Slice() if wtyp == protowire.BytesType { - s := *sp b, n := protowire.ConsumeBytes(b) if n < 0 { return out, errDecode } + count := 0 + for _, v := range b { + if v < 0x80 { + count++ + } + } + if count > 0 { + p.growUint32Slice(count) + } + s := *sp for len(b) > 0 { var v uint64 var n int @@ -1950,11 +1986,20 @@ func appendInt64Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOption func consumeInt64Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) { sp := p.Int64Slice() if wtyp == protowire.BytesType { - s := *sp b, n := protowire.ConsumeBytes(b) if n < 0 { return out, errDecode } + count := 0 + for _, v := range b { + if v < 0x80 { + count++ + } + } + if count > 0 { + p.growInt64Slice(count) + } + s := *sp for len(b) > 0 { var v uint64 var n int @@ -2356,11 +2401,20 @@ func appendSint64Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOptio func consumeSint64Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) { sp := p.Int64Slice() if wtyp == protowire.BytesType { - s := *sp b, n := protowire.ConsumeBytes(b) if n < 0 { return out, errDecode } + count := 0 + for _, v := range b { + if v < 0x80 { + count++ + } + } + if count > 0 { + p.growInt64Slice(count) + } + s := *sp for len(b) > 0 { var v uint64 var n int @@ -2762,11 +2816,20 @@ func appendUint64Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOptio func consumeUint64Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) { sp := p.Uint64Slice() if wtyp == protowire.BytesType { - s := *sp b, n := protowire.ConsumeBytes(b) if n < 0 { return out, errDecode } + count := 0 + for _, v := range b { + if v < 0x80 { + count++ + } + } + if count > 0 { + p.growUint64Slice(count) + } + s := *sp for len(b) > 0 { var v uint64 var n int @@ -3145,11 +3208,15 @@ func appendSfixed32Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOpt func consumeSfixed32Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) { sp := p.Int32Slice() if wtyp == protowire.BytesType { - s := *sp b, n := protowire.ConsumeBytes(b) if n < 0 { return out, errDecode } + count := len(b) / protowire.SizeFixed32() + if count > 0 { + p.growInt32Slice(count) + } + s := *sp for len(b) > 0 { v, n := protowire.ConsumeFixed32(b) if n < 0 { @@ -3461,11 +3528,15 @@ func appendFixed32Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOpti func consumeFixed32Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) { sp := p.Uint32Slice() if wtyp == protowire.BytesType { - s := *sp b, n := protowire.ConsumeBytes(b) if n < 0 { return out, errDecode } + count := len(b) / protowire.SizeFixed32() + if count > 0 { + p.growUint32Slice(count) + } + s := *sp for len(b) > 0 { v, n := protowire.ConsumeFixed32(b) if n < 0 { @@ -3777,11 +3848,15 @@ func appendFloatSlice(b []byte, p pointer, f *coderFieldInfo, opts marshalOption func consumeFloatSlice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) { sp := p.Float32Slice() if wtyp == protowire.BytesType { - s := *sp b, n := protowire.ConsumeBytes(b) if n < 0 { return out, errDecode } + count := len(b) / protowire.SizeFixed32() + if count > 0 { + p.growFloat32Slice(count) + } + s := *sp for len(b) > 0 { v, n := protowire.ConsumeFixed32(b) if n < 0 { @@ -4093,11 +4168,15 @@ func appendSfixed64Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOpt func consumeSfixed64Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) { sp := p.Int64Slice() if wtyp == protowire.BytesType { - s := *sp b, n := protowire.ConsumeBytes(b) if n < 0 { return out, errDecode } + count := len(b) / protowire.SizeFixed64() + if count > 0 { + p.growInt64Slice(count) + } + s := *sp for len(b) > 0 { v, n := protowire.ConsumeFixed64(b) if n < 0 { @@ -4409,11 +4488,15 @@ func appendFixed64Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOpti func consumeFixed64Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) { sp := p.Uint64Slice() if wtyp == protowire.BytesType { - s := *sp b, n := protowire.ConsumeBytes(b) if n < 0 { return out, errDecode } + count := len(b) / protowire.SizeFixed64() + if count > 0 { + p.growUint64Slice(count) + } + s := *sp for len(b) > 0 { v, n := protowire.ConsumeFixed64(b) if n < 0 { @@ -4725,11 +4808,15 @@ func appendDoubleSlice(b []byte, p pointer, f *coderFieldInfo, opts marshalOptio func consumeDoubleSlice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) { sp := p.Float64Slice() if wtyp == protowire.BytesType { - s := *sp b, n := protowire.ConsumeBytes(b) if n < 0 { return out, errDecode } + count := len(b) / protowire.SizeFixed64() + if count > 0 { + p.growFloat64Slice(count) + } + s := *sp for len(b) > 0 { v, n := protowire.ConsumeFixed64(b) if n < 0 { diff --git a/vendor/google.golang.org/protobuf/internal/impl/codec_tables.go b/vendor/google.golang.org/protobuf/internal/impl/codec_tables.go index 576dcf3aa..13077751e 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/codec_tables.go +++ b/vendor/google.golang.org/protobuf/internal/impl/codec_tables.go @@ -197,7 +197,7 @@ func fieldCoder(fd protoreflect.FieldDescriptor, ft reflect.Type) (*MessageInfo, return getMessageInfo(ft), makeMessageFieldCoder(fd, ft) case fd.Kind() == protoreflect.GroupKind: return getMessageInfo(ft), makeGroupFieldCoder(fd, ft) - case fd.Syntax() == protoreflect.Proto3 && fd.ContainingOneof() == nil: + case !fd.HasPresence() && fd.ContainingOneof() == nil: // Populated oneof fields always encode even if set to the zero value, // which normally are not encoded in proto3. switch fd.Kind() { diff --git a/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go b/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go index 61c483fac..2ab2c6297 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go +++ b/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go @@ -206,13 +206,18 @@ func aberrantLoadMessageDescReentrant(t reflect.Type, name protoreflect.FullName // Obtain a list of oneof wrapper types. var oneofWrappers []reflect.Type - for _, method := range []string{"XXX_OneofFuncs", "XXX_OneofWrappers"} { - if fn, ok := t.MethodByName(method); ok { - for _, v := range fn.Func.Call([]reflect.Value{reflect.Zero(fn.Type.In(0))}) { - if vs, ok := v.Interface().([]interface{}); ok { - for _, v := range vs { - oneofWrappers = append(oneofWrappers, reflect.TypeOf(v)) - } + methods := make([]reflect.Method, 0, 2) + if m, ok := t.MethodByName("XXX_OneofFuncs"); ok { + methods = append(methods, m) + } + if m, ok := t.MethodByName("XXX_OneofWrappers"); ok { + methods = append(methods, m) + } + for _, fn := range methods { + for _, v := range fn.Func.Call([]reflect.Value{reflect.Zero(fn.Type.In(0))}) { + if vs, ok := v.Interface().([]interface{}); ok { + for _, v := range vs { + oneofWrappers = append(oneofWrappers, reflect.TypeOf(v)) } } } diff --git a/vendor/google.golang.org/protobuf/internal/impl/message.go b/vendor/google.golang.org/protobuf/internal/impl/message.go index 4f5fb67a0..629bacdce 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/message.go +++ b/vendor/google.golang.org/protobuf/internal/impl/message.go @@ -192,12 +192,17 @@ fieldLoop: // Derive a mapping of oneof wrappers to fields. oneofWrappers := mi.OneofWrappers - for _, method := range []string{"XXX_OneofFuncs", "XXX_OneofWrappers"} { - if fn, ok := reflect.PtrTo(t).MethodByName(method); ok { - for _, v := range fn.Func.Call([]reflect.Value{reflect.Zero(fn.Type.In(0))}) { - if vs, ok := v.Interface().([]interface{}); ok { - oneofWrappers = vs - } + methods := make([]reflect.Method, 0, 2) + if m, ok := reflect.PtrTo(t).MethodByName("XXX_OneofFuncs"); ok { + methods = append(methods, m) + } + if m, ok := reflect.PtrTo(t).MethodByName("XXX_OneofWrappers"); ok { + methods = append(methods, m) + } + for _, fn := range methods { + for _, v := range fn.Func.Call([]reflect.Value{reflect.Zero(fn.Type.In(0))}) { + if vs, ok := v.Interface().([]interface{}); ok { + oneofWrappers = vs } } } diff --git a/vendor/google.golang.org/protobuf/internal/impl/message_reflect_field.go b/vendor/google.golang.org/protobuf/internal/impl/message_reflect_field.go index 5e736c60e..986322b19 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/message_reflect_field.go +++ b/vendor/google.golang.org/protobuf/internal/impl/message_reflect_field.go @@ -538,6 +538,6 @@ func isZero(v reflect.Value) bool { } return true default: - panic(&reflect.ValueError{"reflect.Value.IsZero", v.Kind()}) + panic(&reflect.ValueError{Method: "reflect.Value.IsZero", Kind: v.Kind()}) } } diff --git a/vendor/google.golang.org/protobuf/internal/impl/pointer_reflect.go b/vendor/google.golang.org/protobuf/internal/impl/pointer_reflect.go index 4c491bdf4..517e94434 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/pointer_reflect.go +++ b/vendor/google.golang.org/protobuf/internal/impl/pointer_reflect.go @@ -159,6 +159,42 @@ func (p pointer) SetPointer(v pointer) { p.v.Elem().Set(v.v) } +func growSlice(p pointer, addCap int) { + // TODO: Once we only support Go 1.20 and newer, use reflect.Grow. + in := p.v.Elem() + out := reflect.MakeSlice(in.Type(), in.Len(), in.Len()+addCap) + reflect.Copy(out, in) + p.v.Elem().Set(out) +} + +func (p pointer) growBoolSlice(addCap int) { + growSlice(p, addCap) +} + +func (p pointer) growInt32Slice(addCap int) { + growSlice(p, addCap) +} + +func (p pointer) growUint32Slice(addCap int) { + growSlice(p, addCap) +} + +func (p pointer) growInt64Slice(addCap int) { + growSlice(p, addCap) +} + +func (p pointer) growUint64Slice(addCap int) { + growSlice(p, addCap) +} + +func (p pointer) growFloat64Slice(addCap int) { + growSlice(p, addCap) +} + +func (p pointer) growFloat32Slice(addCap int) { + growSlice(p, addCap) +} + func (Export) MessageStateOf(p Pointer) *messageState { panic("not supported") } func (ms *messageState) pointer() pointer { panic("not supported") } func (ms *messageState) messageInfo() *MessageInfo { panic("not supported") } diff --git a/vendor/google.golang.org/protobuf/internal/impl/pointer_unsafe.go b/vendor/google.golang.org/protobuf/internal/impl/pointer_unsafe.go index ee0e0573e..4b020e311 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/pointer_unsafe.go +++ b/vendor/google.golang.org/protobuf/internal/impl/pointer_unsafe.go @@ -138,6 +138,46 @@ func (p pointer) SetPointer(v pointer) { *(*unsafe.Pointer)(p.p) = (unsafe.Pointer)(v.p) } +func (p pointer) growBoolSlice(addCap int) { + sp := p.BoolSlice() + s := make([]bool, 0, addCap+len(*sp)) + s = s[:len(*sp)] + copy(s, *sp) + *sp = s +} + +func (p pointer) growInt32Slice(addCap int) { + sp := p.Int32Slice() + s := make([]int32, 0, addCap+len(*sp)) + s = s[:len(*sp)] + copy(s, *sp) + *sp = s +} + +func (p pointer) growUint32Slice(addCap int) { + p.growInt32Slice(addCap) +} + +func (p pointer) growFloat32Slice(addCap int) { + p.growInt32Slice(addCap) +} + +func (p pointer) growInt64Slice(addCap int) { + sp := p.Int64Slice() + s := make([]int64, 0, addCap+len(*sp)) + s = s[:len(*sp)] + copy(s, *sp) + *sp = s +} + +func (p pointer) growUint64Slice(addCap int) { + p.growInt64Slice(addCap) +} + +func (p pointer) growFloat64Slice(addCap int) { + p.growInt64Slice(addCap) +} + // Static check that MessageState does not exceed the size of a pointer. const _ = uint(unsafe.Sizeof(unsafe.Pointer(nil)) - unsafe.Sizeof(MessageState{})) diff --git a/vendor/google.golang.org/protobuf/internal/strs/strings.go b/vendor/google.golang.org/protobuf/internal/strs/strings.go index 0b74e7658..a6e7df244 100644 --- a/vendor/google.golang.org/protobuf/internal/strs/strings.go +++ b/vendor/google.golang.org/protobuf/internal/strs/strings.go @@ -17,7 +17,7 @@ import ( // EnforceUTF8 reports whether to enforce strict UTF-8 validation. func EnforceUTF8(fd protoreflect.FieldDescriptor) bool { - if flags.ProtoLegacy { + if flags.ProtoLegacy || fd.Syntax() == protoreflect.Editions { if fd, ok := fd.(interface{ EnforceUTF8() bool }); ok { return fd.EnforceUTF8() } diff --git a/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe.go b/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe.go deleted file mode 100644 index 61a84d341..000000000 --- a/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe.go +++ /dev/null @@ -1,95 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !purego && !appengine -// +build !purego,!appengine - -package strs - -import ( - "unsafe" - - "google.golang.org/protobuf/reflect/protoreflect" -) - -type ( - stringHeader struct { - Data unsafe.Pointer - Len int - } - sliceHeader struct { - Data unsafe.Pointer - Len int - Cap int - } -) - -// UnsafeString returns an unsafe string reference of b. -// The caller must treat the input slice as immutable. -// -// WARNING: Use carefully. The returned result must not leak to the end user -// unless the input slice is provably immutable. -func UnsafeString(b []byte) (s string) { - src := (*sliceHeader)(unsafe.Pointer(&b)) - dst := (*stringHeader)(unsafe.Pointer(&s)) - dst.Data = src.Data - dst.Len = src.Len - return s -} - -// UnsafeBytes returns an unsafe bytes slice reference of s. -// The caller must treat returned slice as immutable. -// -// WARNING: Use carefully. The returned result must not leak to the end user. -func UnsafeBytes(s string) (b []byte) { - src := (*stringHeader)(unsafe.Pointer(&s)) - dst := (*sliceHeader)(unsafe.Pointer(&b)) - dst.Data = src.Data - dst.Len = src.Len - dst.Cap = src.Len - return b -} - -// Builder builds a set of strings with shared lifetime. -// This differs from strings.Builder, which is for building a single string. -type Builder struct { - buf []byte -} - -// AppendFullName is equivalent to protoreflect.FullName.Append, -// but optimized for large batches where each name has a shared lifetime. -func (sb *Builder) AppendFullName(prefix protoreflect.FullName, name protoreflect.Name) protoreflect.FullName { - n := len(prefix) + len(".") + len(name) - if len(prefix) == 0 { - n -= len(".") - } - sb.grow(n) - sb.buf = append(sb.buf, prefix...) - sb.buf = append(sb.buf, '.') - sb.buf = append(sb.buf, name...) - return protoreflect.FullName(sb.last(n)) -} - -// MakeString is equivalent to string(b), but optimized for large batches -// with a shared lifetime. -func (sb *Builder) MakeString(b []byte) string { - sb.grow(len(b)) - sb.buf = append(sb.buf, b...) - return sb.last(len(b)) -} - -func (sb *Builder) grow(n int) { - if cap(sb.buf)-len(sb.buf) >= n { - return - } - - // Unlike strings.Builder, we do not need to copy over the contents - // of the old buffer since our builder provides no API for - // retrieving previously created strings. - sb.buf = make([]byte, 0, 2*(cap(sb.buf)+n)) -} - -func (sb *Builder) last(n int) string { - return UnsafeString(sb.buf[len(sb.buf)-n:]) -} diff --git a/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go120.go b/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go120.go new file mode 100644 index 000000000..a008acd09 --- /dev/null +++ b/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go120.go @@ -0,0 +1,95 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !purego && !appengine && !go1.21 +// +build !purego,!appengine,!go1.21 + +package strs + +import ( + "unsafe" + + "google.golang.org/protobuf/reflect/protoreflect" +) + +type ( + stringHeader struct { + Data unsafe.Pointer + Len int + } + sliceHeader struct { + Data unsafe.Pointer + Len int + Cap int + } +) + +// UnsafeString returns an unsafe string reference of b. +// The caller must treat the input slice as immutable. +// +// WARNING: Use carefully. The returned result must not leak to the end user +// unless the input slice is provably immutable. +func UnsafeString(b []byte) (s string) { + src := (*sliceHeader)(unsafe.Pointer(&b)) + dst := (*stringHeader)(unsafe.Pointer(&s)) + dst.Data = src.Data + dst.Len = src.Len + return s +} + +// UnsafeBytes returns an unsafe bytes slice reference of s. +// The caller must treat returned slice as immutable. +// +// WARNING: Use carefully. The returned result must not leak to the end user. +func UnsafeBytes(s string) (b []byte) { + src := (*stringHeader)(unsafe.Pointer(&s)) + dst := (*sliceHeader)(unsafe.Pointer(&b)) + dst.Data = src.Data + dst.Len = src.Len + dst.Cap = src.Len + return b +} + +// Builder builds a set of strings with shared lifetime. +// This differs from strings.Builder, which is for building a single string. +type Builder struct { + buf []byte +} + +// AppendFullName is equivalent to protoreflect.FullName.Append, +// but optimized for large batches where each name has a shared lifetime. +func (sb *Builder) AppendFullName(prefix protoreflect.FullName, name protoreflect.Name) protoreflect.FullName { + n := len(prefix) + len(".") + len(name) + if len(prefix) == 0 { + n -= len(".") + } + sb.grow(n) + sb.buf = append(sb.buf, prefix...) + sb.buf = append(sb.buf, '.') + sb.buf = append(sb.buf, name...) + return protoreflect.FullName(sb.last(n)) +} + +// MakeString is equivalent to string(b), but optimized for large batches +// with a shared lifetime. +func (sb *Builder) MakeString(b []byte) string { + sb.grow(len(b)) + sb.buf = append(sb.buf, b...) + return sb.last(len(b)) +} + +func (sb *Builder) grow(n int) { + if cap(sb.buf)-len(sb.buf) >= n { + return + } + + // Unlike strings.Builder, we do not need to copy over the contents + // of the old buffer since our builder provides no API for + // retrieving previously created strings. + sb.buf = make([]byte, 0, 2*(cap(sb.buf)+n)) +} + +func (sb *Builder) last(n int) string { + return UnsafeString(sb.buf[len(sb.buf)-n:]) +} diff --git a/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go121.go b/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go121.go new file mode 100644 index 000000000..60166f2ba --- /dev/null +++ b/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go121.go @@ -0,0 +1,74 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !purego && !appengine && go1.21 +// +build !purego,!appengine,go1.21 + +package strs + +import ( + "unsafe" + + "google.golang.org/protobuf/reflect/protoreflect" +) + +// UnsafeString returns an unsafe string reference of b. +// The caller must treat the input slice as immutable. +// +// WARNING: Use carefully. The returned result must not leak to the end user +// unless the input slice is provably immutable. +func UnsafeString(b []byte) string { + return unsafe.String(unsafe.SliceData(b), len(b)) +} + +// UnsafeBytes returns an unsafe bytes slice reference of s. +// The caller must treat returned slice as immutable. +// +// WARNING: Use carefully. The returned result must not leak to the end user. +func UnsafeBytes(s string) []byte { + return unsafe.Slice(unsafe.StringData(s), len(s)) +} + +// Builder builds a set of strings with shared lifetime. +// This differs from strings.Builder, which is for building a single string. +type Builder struct { + buf []byte +} + +// AppendFullName is equivalent to protoreflect.FullName.Append, +// but optimized for large batches where each name has a shared lifetime. +func (sb *Builder) AppendFullName(prefix protoreflect.FullName, name protoreflect.Name) protoreflect.FullName { + n := len(prefix) + len(".") + len(name) + if len(prefix) == 0 { + n -= len(".") + } + sb.grow(n) + sb.buf = append(sb.buf, prefix...) + sb.buf = append(sb.buf, '.') + sb.buf = append(sb.buf, name...) + return protoreflect.FullName(sb.last(n)) +} + +// MakeString is equivalent to string(b), but optimized for large batches +// with a shared lifetime. +func (sb *Builder) MakeString(b []byte) string { + sb.grow(len(b)) + sb.buf = append(sb.buf, b...) + return sb.last(len(b)) +} + +func (sb *Builder) grow(n int) { + if cap(sb.buf)-len(sb.buf) >= n { + return + } + + // Unlike strings.Builder, we do not need to copy over the contents + // of the old buffer since our builder provides no API for + // retrieving previously created strings. + sb.buf = make([]byte, 0, 2*(cap(sb.buf)+n)) +} + +func (sb *Builder) last(n int) string { + return UnsafeString(sb.buf[len(sb.buf)-n:]) +} diff --git a/vendor/google.golang.org/protobuf/internal/version/version.go b/vendor/google.golang.org/protobuf/internal/version/version.go index 0999f29d5..a50fcfb49 100644 --- a/vendor/google.golang.org/protobuf/internal/version/version.go +++ b/vendor/google.golang.org/protobuf/internal/version/version.go @@ -51,7 +51,7 @@ import ( // 10. Send out the CL for review and submit it. const ( Major = 1 - Minor = 31 + Minor = 33 Patch = 0 PreRelease = "" ) diff --git a/vendor/google.golang.org/protobuf/proto/decode.go b/vendor/google.golang.org/protobuf/proto/decode.go index 48d47946b..e5b03b567 100644 --- a/vendor/google.golang.org/protobuf/proto/decode.go +++ b/vendor/google.golang.org/protobuf/proto/decode.go @@ -69,7 +69,7 @@ func (o UnmarshalOptions) Unmarshal(b []byte, m Message) error { // UnmarshalState parses a wire-format message and places the result in m. // // This method permits fine-grained control over the unmarshaler. -// Most users should use Unmarshal instead. +// Most users should use [Unmarshal] instead. func (o UnmarshalOptions) UnmarshalState(in protoiface.UnmarshalInput) (protoiface.UnmarshalOutput, error) { if o.RecursionLimit == 0 { o.RecursionLimit = protowire.DefaultRecursionLimit diff --git a/vendor/google.golang.org/protobuf/proto/doc.go b/vendor/google.golang.org/protobuf/proto/doc.go index ec71e717f..80ed16a0c 100644 --- a/vendor/google.golang.org/protobuf/proto/doc.go +++ b/vendor/google.golang.org/protobuf/proto/doc.go @@ -18,27 +18,27 @@ // This package contains functions to convert to and from the wire format, // an efficient binary serialization of protocol buffers. // -// • Size reports the size of a message in the wire format. +// - [Size] reports the size of a message in the wire format. // -// • Marshal converts a message to the wire format. -// The MarshalOptions type provides more control over wire marshaling. +// - [Marshal] converts a message to the wire format. +// The [MarshalOptions] type provides more control over wire marshaling. // -// • Unmarshal converts a message from the wire format. -// The UnmarshalOptions type provides more control over wire unmarshaling. +// - [Unmarshal] converts a message from the wire format. +// The [UnmarshalOptions] type provides more control over wire unmarshaling. // // # Basic message operations // -// • Clone makes a deep copy of a message. +// - [Clone] makes a deep copy of a message. // -// • Merge merges the content of a message into another. +// - [Merge] merges the content of a message into another. // -// • Equal compares two messages. For more control over comparisons -// and detailed reporting of differences, see package -// "google.golang.org/protobuf/testing/protocmp". +// - [Equal] compares two messages. For more control over comparisons +// and detailed reporting of differences, see package +// [google.golang.org/protobuf/testing/protocmp]. // -// • Reset clears the content of a message. +// - [Reset] clears the content of a message. // -// • CheckInitialized reports whether all required fields in a message are set. +// - [CheckInitialized] reports whether all required fields in a message are set. // // # Optional scalar constructors // @@ -46,9 +46,9 @@ // as pointers to a value. For example, an optional string field has the // Go type *string. // -// • Bool, Int32, Int64, Uint32, Uint64, Float32, Float64, and String -// take a value and return a pointer to a new instance of it, -// to simplify construction of optional field values. +// - [Bool], [Int32], [Int64], [Uint32], [Uint64], [Float32], [Float64], and [String] +// take a value and return a pointer to a new instance of it, +// to simplify construction of optional field values. // // Generated enum types usually have an Enum method which performs the // same operation. @@ -57,29 +57,29 @@ // // # Extension accessors // -// • HasExtension, GetExtension, SetExtension, and ClearExtension -// access extension field values in a protocol buffer message. +// - [HasExtension], [GetExtension], [SetExtension], and [ClearExtension] +// access extension field values in a protocol buffer message. // // Extension fields are only supported in proto2. // // # Related packages // -// • Package "google.golang.org/protobuf/encoding/protojson" converts messages to -// and from JSON. +// - Package [google.golang.org/protobuf/encoding/protojson] converts messages to +// and from JSON. // -// • Package "google.golang.org/protobuf/encoding/prototext" converts messages to -// and from the text format. +// - Package [google.golang.org/protobuf/encoding/prototext] converts messages to +// and from the text format. // -// • Package "google.golang.org/protobuf/reflect/protoreflect" provides a -// reflection interface for protocol buffer data types. +// - Package [google.golang.org/protobuf/reflect/protoreflect] provides a +// reflection interface for protocol buffer data types. // -// • Package "google.golang.org/protobuf/testing/protocmp" provides features -// to compare protocol buffer messages with the "github.com/google/go-cmp/cmp" -// package. +// - Package [google.golang.org/protobuf/testing/protocmp] provides features +// to compare protocol buffer messages with the [github.com/google/go-cmp/cmp] +// package. // -// • Package "google.golang.org/protobuf/types/dynamicpb" provides a dynamic -// message type, suitable for working with messages where the protocol buffer -// type is only known at runtime. +// - Package [google.golang.org/protobuf/types/dynamicpb] provides a dynamic +// message type, suitable for working with messages where the protocol buffer +// type is only known at runtime. // // This module contains additional packages for more specialized use cases. // Consult the individual package documentation for details. diff --git a/vendor/google.golang.org/protobuf/proto/encode.go b/vendor/google.golang.org/protobuf/proto/encode.go index bf7f816d0..4fed202f9 100644 --- a/vendor/google.golang.org/protobuf/proto/encode.go +++ b/vendor/google.golang.org/protobuf/proto/encode.go @@ -129,7 +129,7 @@ func (o MarshalOptions) MarshalAppend(b []byte, m Message) ([]byte, error) { // MarshalState returns the wire-format encoding of a message. // // This method permits fine-grained control over the marshaler. -// Most users should use Marshal instead. +// Most users should use [Marshal] instead. func (o MarshalOptions) MarshalState(in protoiface.MarshalInput) (protoiface.MarshalOutput, error) { return o.marshal(in.Buf, in.Message) } diff --git a/vendor/google.golang.org/protobuf/proto/extension.go b/vendor/google.golang.org/protobuf/proto/extension.go index 5f293cda8..17899a3a7 100644 --- a/vendor/google.golang.org/protobuf/proto/extension.go +++ b/vendor/google.golang.org/protobuf/proto/extension.go @@ -26,7 +26,7 @@ func HasExtension(m Message, xt protoreflect.ExtensionType) bool { } // ClearExtension clears an extension field such that subsequent -// HasExtension calls return false. +// [HasExtension] calls return false. // It panics if m is invalid or if xt does not extend m. func ClearExtension(m Message, xt protoreflect.ExtensionType) { m.ProtoReflect().Clear(xt.TypeDescriptor()) diff --git a/vendor/google.golang.org/protobuf/proto/merge.go b/vendor/google.golang.org/protobuf/proto/merge.go index d761ab331..3c6fe5780 100644 --- a/vendor/google.golang.org/protobuf/proto/merge.go +++ b/vendor/google.golang.org/protobuf/proto/merge.go @@ -21,7 +21,7 @@ import ( // The unknown fields of src are appended to the unknown fields of dst. // // It is semantically equivalent to unmarshaling the encoded form of src -// into dst with the UnmarshalOptions.Merge option specified. +// into dst with the [UnmarshalOptions.Merge] option specified. func Merge(dst, src Message) { // TODO: Should nil src be treated as semantically equivalent to a // untyped, read-only, empty message? What about a nil dst? diff --git a/vendor/google.golang.org/protobuf/proto/proto.go b/vendor/google.golang.org/protobuf/proto/proto.go index 1f0d183b1..7543ee6b2 100644 --- a/vendor/google.golang.org/protobuf/proto/proto.go +++ b/vendor/google.golang.org/protobuf/proto/proto.go @@ -15,18 +15,20 @@ import ( // protobuf module that accept a Message, except where otherwise specified. // // This is the v2 interface definition for protobuf messages. -// The v1 interface definition is "github.com/golang/protobuf/proto".Message. +// The v1 interface definition is [github.com/golang/protobuf/proto.Message]. // -// To convert a v1 message to a v2 message, -// use "github.com/golang/protobuf/proto".MessageV2. -// To convert a v2 message to a v1 message, -// use "github.com/golang/protobuf/proto".MessageV1. +// - To convert a v1 message to a v2 message, +// use [google.golang.org/protobuf/protoadapt.MessageV2Of]. +// - To convert a v2 message to a v1 message, +// use [google.golang.org/protobuf/protoadapt.MessageV1Of]. type Message = protoreflect.ProtoMessage -// Error matches all errors produced by packages in the protobuf module. +// Error matches all errors produced by packages in the protobuf module +// according to [errors.Is]. // -// That is, errors.Is(err, Error) reports whether an error is produced -// by this module. +// Example usage: +// +// if errors.Is(err, proto.Error) { ... } var Error error func init() { diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/desc.go b/vendor/google.golang.org/protobuf/reflect/protodesc/desc.go index e4dfb1205..baa0cc621 100644 --- a/vendor/google.golang.org/protobuf/reflect/protodesc/desc.go +++ b/vendor/google.golang.org/protobuf/reflect/protodesc/desc.go @@ -3,11 +3,11 @@ // license that can be found in the LICENSE file. // Package protodesc provides functionality for converting -// FileDescriptorProto messages to/from protoreflect.FileDescriptor values. +// FileDescriptorProto messages to/from [protoreflect.FileDescriptor] values. // // The google.protobuf.FileDescriptorProto is a protobuf message that describes // the type information for a .proto file in a form that is easily serializable. -// The protoreflect.FileDescriptor is a more structured representation of +// The [protoreflect.FileDescriptor] is a more structured representation of // the FileDescriptorProto message where references and remote dependencies // can be directly followed. package protodesc @@ -24,11 +24,11 @@ import ( "google.golang.org/protobuf/types/descriptorpb" ) -// Resolver is the resolver used by NewFile to resolve dependencies. +// Resolver is the resolver used by [NewFile] to resolve dependencies. // The enums and messages provided must belong to some parent file, // which is also registered. // -// It is implemented by protoregistry.Files. +// It is implemented by [protoregistry.Files]. type Resolver interface { FindFileByPath(string) (protoreflect.FileDescriptor, error) FindDescriptorByName(protoreflect.FullName) (protoreflect.Descriptor, error) @@ -61,19 +61,19 @@ type FileOptions struct { AllowUnresolvable bool } -// NewFile creates a new protoreflect.FileDescriptor from the provided -// file descriptor message. See FileOptions.New for more information. +// NewFile creates a new [protoreflect.FileDescriptor] from the provided +// file descriptor message. See [FileOptions.New] for more information. func NewFile(fd *descriptorpb.FileDescriptorProto, r Resolver) (protoreflect.FileDescriptor, error) { return FileOptions{}.New(fd, r) } -// NewFiles creates a new protoregistry.Files from the provided -// FileDescriptorSet message. See FileOptions.NewFiles for more information. +// NewFiles creates a new [protoregistry.Files] from the provided +// FileDescriptorSet message. See [FileOptions.NewFiles] for more information. func NewFiles(fd *descriptorpb.FileDescriptorSet) (*protoregistry.Files, error) { return FileOptions{}.NewFiles(fd) } -// New creates a new protoreflect.FileDescriptor from the provided +// New creates a new [protoreflect.FileDescriptor] from the provided // file descriptor message. The file must represent a valid proto file according // to protobuf semantics. The returned descriptor is a deep copy of the input. // @@ -93,9 +93,15 @@ func (o FileOptions) New(fd *descriptorpb.FileDescriptorProto, r Resolver) (prot f.L1.Syntax = protoreflect.Proto2 case "proto3": f.L1.Syntax = protoreflect.Proto3 + case "editions": + f.L1.Syntax = protoreflect.Editions + f.L1.Edition = fromEditionProto(fd.GetEdition()) default: return nil, errors.New("invalid syntax: %q", fd.GetSyntax()) } + if f.L1.Syntax == protoreflect.Editions && (fd.GetEdition() < SupportedEditionsMinimum || fd.GetEdition() > SupportedEditionsMaximum) { + return nil, errors.New("use of edition %v not yet supported by the Go Protobuf runtime", fd.GetEdition()) + } f.L1.Path = fd.GetName() if f.L1.Path == "" { return nil, errors.New("file path must be populated") @@ -108,6 +114,9 @@ func (o FileOptions) New(fd *descriptorpb.FileDescriptorProto, r Resolver) (prot opts = proto.Clone(opts).(*descriptorpb.FileOptions) f.L2.Options = func() protoreflect.ProtoMessage { return opts } } + if f.L1.Syntax == protoreflect.Editions { + initFileDescFromFeatureSet(f, fd.GetOptions().GetFeatures()) + } f.L2.Imports = make(filedesc.FileImports, len(fd.GetDependency())) for _, i := range fd.GetPublicDependency() { @@ -231,7 +240,7 @@ func (is importSet) importPublic(imps protoreflect.FileImports) { } } -// NewFiles creates a new protoregistry.Files from the provided +// NewFiles creates a new [protoregistry.Files] from the provided // FileDescriptorSet message. The descriptor set must include only // valid files according to protobuf semantics. The returned descriptors // are a deep copy of the input. diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_init.go b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_init.go index 37efda1af..b3278163c 100644 --- a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_init.go +++ b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_init.go @@ -28,6 +28,7 @@ func (r descsByName) initEnumDeclarations(eds []*descriptorpb.EnumDescriptorProt opts = proto.Clone(opts).(*descriptorpb.EnumOptions) e.L2.Options = func() protoreflect.ProtoMessage { return opts } } + e.L1.EditionFeatures = mergeEditionFeatures(parent, ed.GetOptions().GetFeatures()) for _, s := range ed.GetReservedName() { e.L2.ReservedNames.List = append(e.L2.ReservedNames.List, protoreflect.Name(s)) } @@ -68,6 +69,9 @@ func (r descsByName) initMessagesDeclarations(mds []*descriptorpb.DescriptorProt if m.L0, err = r.makeBase(m, parent, md.GetName(), i, sb); err != nil { return nil, err } + if m.Base.L0.ParentFile.Syntax() == protoreflect.Editions { + m.L1.EditionFeatures = mergeEditionFeatures(parent, md.GetOptions().GetFeatures()) + } if opts := md.GetOptions(); opts != nil { opts = proto.Clone(opts).(*descriptorpb.MessageOptions) m.L2.Options = func() protoreflect.ProtoMessage { return opts } @@ -114,6 +118,27 @@ func (r descsByName) initMessagesDeclarations(mds []*descriptorpb.DescriptorProt return ms, nil } +// canBePacked returns whether the field can use packed encoding: +// https://protobuf.dev/programming-guides/encoding/#packed +func canBePacked(fd *descriptorpb.FieldDescriptorProto) bool { + if fd.GetLabel() != descriptorpb.FieldDescriptorProto_LABEL_REPEATED { + return false // not a repeated field + } + + switch protoreflect.Kind(fd.GetType()) { + case protoreflect.MessageKind, protoreflect.GroupKind: + return false // not a scalar type field + + case protoreflect.StringKind, protoreflect.BytesKind: + // string and bytes can explicitly not be declared as packed, + // see https://protobuf.dev/programming-guides/encoding/#packed + return false + + default: + return true + } +} + func (r descsByName) initFieldsFromDescriptorProto(fds []*descriptorpb.FieldDescriptorProto, parent protoreflect.Descriptor, sb *strs.Builder) (fs []filedesc.Field, err error) { fs = make([]filedesc.Field, len(fds)) // allocate up-front to ensure stable pointers for i, fd := range fds { @@ -137,6 +162,34 @@ func (r descsByName) initFieldsFromDescriptorProto(fds []*descriptorpb.FieldDesc if fd.JsonName != nil { f.L1.StringName.InitJSON(fd.GetJsonName()) } + + if f.Base.L0.ParentFile.Syntax() == protoreflect.Editions { + f.L1.EditionFeatures = mergeEditionFeatures(parent, fd.GetOptions().GetFeatures()) + + if f.L1.EditionFeatures.IsLegacyRequired { + f.L1.Cardinality = protoreflect.Required + } + // We reuse the existing field because the old option `[packed = + // true]` is mutually exclusive with the editions feature. + if canBePacked(fd) { + f.L1.HasPacked = true + f.L1.IsPacked = f.L1.EditionFeatures.IsPacked + } + + // We pretend this option is always explicitly set because the only + // use of HasEnforceUTF8 is to determine whether to use EnforceUTF8 + // or to return the appropriate default. + // When using editions we either parse the option or resolve the + // appropriate default here (instead of later when this option is + // requested from the descriptor). + // In proto2/proto3 syntax HasEnforceUTF8 might be false. + f.L1.HasEnforceUTF8 = true + f.L1.EnforceUTF8 = f.L1.EditionFeatures.IsUTF8Validated + + if f.L1.Kind == protoreflect.MessageKind && f.L1.EditionFeatures.IsDelimitedEncoded { + f.L1.Kind = protoreflect.GroupKind + } + } } return fs, nil } @@ -151,6 +204,9 @@ func (r descsByName) initOneofsFromDescriptorProto(ods []*descriptorpb.OneofDesc if opts := od.GetOptions(); opts != nil { opts = proto.Clone(opts).(*descriptorpb.OneofOptions) o.L1.Options = func() protoreflect.ProtoMessage { return opts } + if parent.Syntax() == protoreflect.Editions { + o.L1.EditionFeatures = mergeEditionFeatures(parent, opts.GetFeatures()) + } } } return os, nil diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go index 27d7e3501..254ca5854 100644 --- a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go +++ b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go @@ -276,8 +276,8 @@ func unmarshalDefault(s string, fd protoreflect.FieldDescriptor, allowUnresolvab } else if err != nil { return v, ev, err } - if fd.Syntax() == protoreflect.Proto3 { - return v, ev, errors.New("cannot be specified under proto3 semantics") + if !fd.HasPresence() { + return v, ev, errors.New("cannot be specified with implicit field presence") } if fd.Kind() == protoreflect.MessageKind || fd.Kind() == protoreflect.GroupKind || fd.Cardinality() == protoreflect.Repeated { return v, ev, errors.New("cannot be specified on composite types") diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_validate.go b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_validate.go index 9af1d5648..e4dcaf876 100644 --- a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_validate.go +++ b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_validate.go @@ -107,7 +107,7 @@ func validateMessageDeclarations(ms []filedesc.Message, mds []*descriptorpb.Desc if isMessageSet && !flags.ProtoLegacy { return errors.New("message %q is a MessageSet, which is a legacy proto1 feature that is no longer supported", m.FullName()) } - if isMessageSet && (m.Syntax() != protoreflect.Proto2 || m.Fields().Len() > 0 || m.ExtensionRanges().Len() == 0) { + if isMessageSet && (m.Syntax() == protoreflect.Proto3 || m.Fields().Len() > 0 || m.ExtensionRanges().Len() == 0) { return errors.New("message %q is an invalid proto1 MessageSet", m.FullName()) } if m.Syntax() == protoreflect.Proto3 { @@ -314,8 +314,8 @@ func checkValidGroup(fd protoreflect.FieldDescriptor) error { switch { case fd.Kind() != protoreflect.GroupKind: return nil - case fd.Syntax() != protoreflect.Proto2: - return errors.New("invalid under proto2 semantics") + case fd.Syntax() == protoreflect.Proto3: + return errors.New("invalid under proto3 semantics") case md == nil || md.IsPlaceholder(): return errors.New("message must be resolvable") case fd.FullName().Parent() != md.FullName().Parent(): diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/editions.go b/vendor/google.golang.org/protobuf/reflect/protodesc/editions.go new file mode 100644 index 000000000..2a6b29d17 --- /dev/null +++ b/vendor/google.golang.org/protobuf/reflect/protodesc/editions.go @@ -0,0 +1,148 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package protodesc + +import ( + "fmt" + "os" + "sync" + + "google.golang.org/protobuf/internal/editiondefaults" + "google.golang.org/protobuf/internal/filedesc" + "google.golang.org/protobuf/proto" + "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/types/descriptorpb" + gofeaturespb "google.golang.org/protobuf/types/gofeaturespb" +) + +const ( + SupportedEditionsMinimum = descriptorpb.Edition_EDITION_PROTO2 + SupportedEditionsMaximum = descriptorpb.Edition_EDITION_2023 +) + +var defaults = &descriptorpb.FeatureSetDefaults{} +var defaultsCacheMu sync.Mutex +var defaultsCache = make(map[filedesc.Edition]*descriptorpb.FeatureSet) + +func init() { + err := proto.Unmarshal(editiondefaults.Defaults, defaults) + if err != nil { + fmt.Fprintf(os.Stderr, "unmarshal editions defaults: %v\n", err) + os.Exit(1) + } +} + +func fromEditionProto(epb descriptorpb.Edition) filedesc.Edition { + return filedesc.Edition(epb) +} + +func toEditionProto(ed filedesc.Edition) descriptorpb.Edition { + switch ed { + case filedesc.EditionUnknown: + return descriptorpb.Edition_EDITION_UNKNOWN + case filedesc.EditionProto2: + return descriptorpb.Edition_EDITION_PROTO2 + case filedesc.EditionProto3: + return descriptorpb.Edition_EDITION_PROTO3 + case filedesc.Edition2023: + return descriptorpb.Edition_EDITION_2023 + default: + panic(fmt.Sprintf("unknown value for edition: %v", ed)) + } +} + +func getFeatureSetFor(ed filedesc.Edition) *descriptorpb.FeatureSet { + defaultsCacheMu.Lock() + defer defaultsCacheMu.Unlock() + if def, ok := defaultsCache[ed]; ok { + return def + } + edpb := toEditionProto(ed) + if defaults.GetMinimumEdition() > edpb || defaults.GetMaximumEdition() < edpb { + // This should never happen protodesc.(FileOptions).New would fail when + // initializing the file descriptor. + // This most likely means the embedded defaults were not updated. + fmt.Fprintf(os.Stderr, "internal error: unsupported edition %v (did you forget to update the embedded defaults (i.e. the bootstrap descriptor proto)?)\n", edpb) + os.Exit(1) + } + fs := defaults.GetDefaults()[0].GetFeatures() + // Using a linear search for now. + // Editions are guaranteed to be sorted and thus we could use a binary search. + // Given that there are only a handful of editions (with one more per year) + // there is not much reason to use a binary search. + for _, def := range defaults.GetDefaults() { + if def.GetEdition() <= edpb { + fs = def.GetFeatures() + } else { + break + } + } + defaultsCache[ed] = fs + return fs +} + +// mergeEditionFeatures merges the parent and child feature sets. This function +// should be used when initializing Go descriptors from descriptor protos which +// is why the parent is a filedesc.EditionsFeatures (Go representation) while +// the child is a descriptorproto.FeatureSet (protoc representation). +// Any feature set by the child overwrites what is set by the parent. +func mergeEditionFeatures(parentDesc protoreflect.Descriptor, child *descriptorpb.FeatureSet) filedesc.EditionFeatures { + var parentFS filedesc.EditionFeatures + switch p := parentDesc.(type) { + case *filedesc.File: + parentFS = p.L1.EditionFeatures + case *filedesc.Message: + parentFS = p.L1.EditionFeatures + default: + panic(fmt.Sprintf("unknown parent type %T", parentDesc)) + } + if child == nil { + return parentFS + } + if fp := child.FieldPresence; fp != nil { + parentFS.IsFieldPresence = *fp == descriptorpb.FeatureSet_LEGACY_REQUIRED || + *fp == descriptorpb.FeatureSet_EXPLICIT + parentFS.IsLegacyRequired = *fp == descriptorpb.FeatureSet_LEGACY_REQUIRED + } + if et := child.EnumType; et != nil { + parentFS.IsOpenEnum = *et == descriptorpb.FeatureSet_OPEN + } + + if rfe := child.RepeatedFieldEncoding; rfe != nil { + parentFS.IsPacked = *rfe == descriptorpb.FeatureSet_PACKED + } + + if utf8val := child.Utf8Validation; utf8val != nil { + parentFS.IsUTF8Validated = *utf8val == descriptorpb.FeatureSet_VERIFY + } + + if me := child.MessageEncoding; me != nil { + parentFS.IsDelimitedEncoded = *me == descriptorpb.FeatureSet_DELIMITED + } + + if jf := child.JsonFormat; jf != nil { + parentFS.IsJSONCompliant = *jf == descriptorpb.FeatureSet_ALLOW + } + + if goFeatures, ok := proto.GetExtension(child, gofeaturespb.E_Go).(*gofeaturespb.GoFeatures); ok && goFeatures != nil { + if luje := goFeatures.LegacyUnmarshalJsonEnum; luje != nil { + parentFS.GenerateLegacyUnmarshalJSON = *luje + } + } + + return parentFS +} + +// initFileDescFromFeatureSet initializes editions related fields in fd based +// on fs. If fs is nil it is assumed to be an empty featureset and all fields +// will be initialized with the appropriate default. fd.L1.Edition must be set +// before calling this function. +func initFileDescFromFeatureSet(fd *filedesc.File, fs *descriptorpb.FeatureSet) { + dfs := getFeatureSetFor(fd.L1.Edition) + // initialize the featureset with the defaults + fd.L1.EditionFeatures = mergeEditionFeatures(fd, dfs) + // overwrite any options explicitly specified + fd.L1.EditionFeatures = mergeEditionFeatures(fd, fs) +} diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/proto.go b/vendor/google.golang.org/protobuf/reflect/protodesc/proto.go index a7c5ceffc..9d6e05420 100644 --- a/vendor/google.golang.org/protobuf/reflect/protodesc/proto.go +++ b/vendor/google.golang.org/protobuf/reflect/protodesc/proto.go @@ -16,7 +16,7 @@ import ( "google.golang.org/protobuf/types/descriptorpb" ) -// ToFileDescriptorProto copies a protoreflect.FileDescriptor into a +// ToFileDescriptorProto copies a [protoreflect.FileDescriptor] into a // google.protobuf.FileDescriptorProto message. func ToFileDescriptorProto(file protoreflect.FileDescriptor) *descriptorpb.FileDescriptorProto { p := &descriptorpb.FileDescriptorProto{ @@ -70,13 +70,13 @@ func ToFileDescriptorProto(file protoreflect.FileDescriptor) *descriptorpb.FileD for i, exts := 0, file.Extensions(); i < exts.Len(); i++ { p.Extension = append(p.Extension, ToFieldDescriptorProto(exts.Get(i))) } - if syntax := file.Syntax(); syntax != protoreflect.Proto2 { + if syntax := file.Syntax(); syntax != protoreflect.Proto2 && syntax.IsValid() { p.Syntax = proto.String(file.Syntax().String()) } return p } -// ToDescriptorProto copies a protoreflect.MessageDescriptor into a +// ToDescriptorProto copies a [protoreflect.MessageDescriptor] into a // google.protobuf.DescriptorProto message. func ToDescriptorProto(message protoreflect.MessageDescriptor) *descriptorpb.DescriptorProto { p := &descriptorpb.DescriptorProto{ @@ -119,7 +119,7 @@ func ToDescriptorProto(message protoreflect.MessageDescriptor) *descriptorpb.Des return p } -// ToFieldDescriptorProto copies a protoreflect.FieldDescriptor into a +// ToFieldDescriptorProto copies a [protoreflect.FieldDescriptor] into a // google.protobuf.FieldDescriptorProto message. func ToFieldDescriptorProto(field protoreflect.FieldDescriptor) *descriptorpb.FieldDescriptorProto { p := &descriptorpb.FieldDescriptorProto{ @@ -168,7 +168,7 @@ func ToFieldDescriptorProto(field protoreflect.FieldDescriptor) *descriptorpb.Fi return p } -// ToOneofDescriptorProto copies a protoreflect.OneofDescriptor into a +// ToOneofDescriptorProto copies a [protoreflect.OneofDescriptor] into a // google.protobuf.OneofDescriptorProto message. func ToOneofDescriptorProto(oneof protoreflect.OneofDescriptor) *descriptorpb.OneofDescriptorProto { return &descriptorpb.OneofDescriptorProto{ @@ -177,7 +177,7 @@ func ToOneofDescriptorProto(oneof protoreflect.OneofDescriptor) *descriptorpb.On } } -// ToEnumDescriptorProto copies a protoreflect.EnumDescriptor into a +// ToEnumDescriptorProto copies a [protoreflect.EnumDescriptor] into a // google.protobuf.EnumDescriptorProto message. func ToEnumDescriptorProto(enum protoreflect.EnumDescriptor) *descriptorpb.EnumDescriptorProto { p := &descriptorpb.EnumDescriptorProto{ @@ -200,7 +200,7 @@ func ToEnumDescriptorProto(enum protoreflect.EnumDescriptor) *descriptorpb.EnumD return p } -// ToEnumValueDescriptorProto copies a protoreflect.EnumValueDescriptor into a +// ToEnumValueDescriptorProto copies a [protoreflect.EnumValueDescriptor] into a // google.protobuf.EnumValueDescriptorProto message. func ToEnumValueDescriptorProto(value protoreflect.EnumValueDescriptor) *descriptorpb.EnumValueDescriptorProto { return &descriptorpb.EnumValueDescriptorProto{ @@ -210,7 +210,7 @@ func ToEnumValueDescriptorProto(value protoreflect.EnumValueDescriptor) *descrip } } -// ToServiceDescriptorProto copies a protoreflect.ServiceDescriptor into a +// ToServiceDescriptorProto copies a [protoreflect.ServiceDescriptor] into a // google.protobuf.ServiceDescriptorProto message. func ToServiceDescriptorProto(service protoreflect.ServiceDescriptor) *descriptorpb.ServiceDescriptorProto { p := &descriptorpb.ServiceDescriptorProto{ @@ -223,7 +223,7 @@ func ToServiceDescriptorProto(service protoreflect.ServiceDescriptor) *descripto return p } -// ToMethodDescriptorProto copies a protoreflect.MethodDescriptor into a +// ToMethodDescriptorProto copies a [protoreflect.MethodDescriptor] into a // google.protobuf.MethodDescriptorProto message. func ToMethodDescriptorProto(method protoreflect.MethodDescriptor) *descriptorpb.MethodDescriptorProto { p := &descriptorpb.MethodDescriptorProto{ diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/proto.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/proto.go index 55aa14922..00b01fbd8 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/proto.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/proto.go @@ -10,46 +10,46 @@ // // # Protocol Buffer Descriptors // -// Protobuf descriptors (e.g., EnumDescriptor or MessageDescriptor) +// Protobuf descriptors (e.g., [EnumDescriptor] or [MessageDescriptor]) // are immutable objects that represent protobuf type information. // They are wrappers around the messages declared in descriptor.proto. // Protobuf descriptors alone lack any information regarding Go types. // -// Enums and messages generated by this module implement Enum and ProtoMessage, +// Enums and messages generated by this module implement [Enum] and [ProtoMessage], // where the Descriptor and ProtoReflect.Descriptor accessors respectively // return the protobuf descriptor for the values. // // The protobuf descriptor interfaces are not meant to be implemented by // user code since they might need to be extended in the future to support // additions to the protobuf language. -// The "google.golang.org/protobuf/reflect/protodesc" package converts between +// The [google.golang.org/protobuf/reflect/protodesc] package converts between // google.protobuf.DescriptorProto messages and protobuf descriptors. // // # Go Type Descriptors // -// A type descriptor (e.g., EnumType or MessageType) is a constructor for +// A type descriptor (e.g., [EnumType] or [MessageType]) is a constructor for // a concrete Go type that represents the associated protobuf descriptor. // There is commonly a one-to-one relationship between protobuf descriptors and // Go type descriptors, but it can potentially be a one-to-many relationship. // -// Enums and messages generated by this module implement Enum and ProtoMessage, +// Enums and messages generated by this module implement [Enum] and [ProtoMessage], // where the Type and ProtoReflect.Type accessors respectively // return the protobuf descriptor for the values. // -// The "google.golang.org/protobuf/types/dynamicpb" package can be used to +// The [google.golang.org/protobuf/types/dynamicpb] package can be used to // create Go type descriptors from protobuf descriptors. // // # Value Interfaces // -// The Enum and Message interfaces provide a reflective view over an +// The [Enum] and [Message] interfaces provide a reflective view over an // enum or message instance. For enums, it provides the ability to retrieve // the enum value number for any concrete enum type. For messages, it provides // the ability to access or manipulate fields of the message. // -// To convert a proto.Message to a protoreflect.Message, use the +// To convert a [google.golang.org/protobuf/proto.Message] to a [protoreflect.Message], use the // former's ProtoReflect method. Since the ProtoReflect method is new to the // v2 message interface, it may not be present on older message implementations. -// The "github.com/golang/protobuf/proto".MessageReflect function can be used +// The [github.com/golang/protobuf/proto.MessageReflect] function can be used // to obtain a reflective view on older messages. // // # Relationships @@ -71,12 +71,12 @@ // │ │ // └────────────────── Type() ───────┘ // -// • An EnumType describes a concrete Go enum type. +// • An [EnumType] describes a concrete Go enum type. // It has an EnumDescriptor and can construct an Enum instance. // -// • An EnumDescriptor describes an abstract protobuf enum type. +// • An [EnumDescriptor] describes an abstract protobuf enum type. // -// • An Enum is a concrete enum instance. Generated enums implement Enum. +// • An [Enum] is a concrete enum instance. Generated enums implement Enum. // // ┌──────────────── New() ─────────────────┐ // │ │ @@ -90,24 +90,26 @@ // │ │ // └─────────────────── Type() ─────────┘ // -// • A MessageType describes a concrete Go message type. -// It has a MessageDescriptor and can construct a Message instance. -// Just as how Go's reflect.Type is a reflective description of a Go type, -// a MessageType is a reflective description of a Go type for a protobuf message. +// • A [MessageType] describes a concrete Go message type. +// It has a [MessageDescriptor] and can construct a [Message] instance. +// Just as how Go's [reflect.Type] is a reflective description of a Go type, +// a [MessageType] is a reflective description of a Go type for a protobuf message. // -// • A MessageDescriptor describes an abstract protobuf message type. -// It has no understanding of Go types. In order to construct a MessageType -// from just a MessageDescriptor, you can consider looking up the message type -// in the global registry using protoregistry.GlobalTypes.FindMessageByName -// or constructing a dynamic MessageType using dynamicpb.NewMessageType. +// • A [MessageDescriptor] describes an abstract protobuf message type. +// It has no understanding of Go types. In order to construct a [MessageType] +// from just a [MessageDescriptor], you can consider looking up the message type +// in the global registry using the FindMessageByName method on +// [google.golang.org/protobuf/reflect/protoregistry.GlobalTypes] +// or constructing a dynamic [MessageType] using +// [google.golang.org/protobuf/types/dynamicpb.NewMessageType]. // -// • A Message is a reflective view over a concrete message instance. -// Generated messages implement ProtoMessage, which can convert to a Message. -// Just as how Go's reflect.Value is a reflective view over a Go value, -// a Message is a reflective view over a concrete protobuf message instance. -// Using Go reflection as an analogy, the ProtoReflect method is similar to -// calling reflect.ValueOf, and the Message.Interface method is similar to -// calling reflect.Value.Interface. +// • A [Message] is a reflective view over a concrete message instance. +// Generated messages implement [ProtoMessage], which can convert to a [Message]. +// Just as how Go's [reflect.Value] is a reflective view over a Go value, +// a [Message] is a reflective view over a concrete protobuf message instance. +// Using Go reflection as an analogy, the [ProtoMessage.ProtoReflect] method is similar to +// calling [reflect.ValueOf], and the [Message.Interface] method is similar to +// calling [reflect.Value.Interface]. // // ┌── TypeDescriptor() ──┐ ┌───── Descriptor() ─────┐ // │ V │ V @@ -119,15 +121,15 @@ // │ │ // └────── implements ────────┘ // -// • An ExtensionType describes a concrete Go implementation of an extension. -// It has an ExtensionTypeDescriptor and can convert to/from -// abstract Values and Go values. +// • An [ExtensionType] describes a concrete Go implementation of an extension. +// It has an [ExtensionTypeDescriptor] and can convert to/from +// an abstract [Value] and a Go value. // -// • An ExtensionTypeDescriptor is an ExtensionDescriptor -// which also has an ExtensionType. +// • An [ExtensionTypeDescriptor] is an [ExtensionDescriptor] +// which also has an [ExtensionType]. // -// • An ExtensionDescriptor describes an abstract protobuf extension field and -// may not always be an ExtensionTypeDescriptor. +// • An [ExtensionDescriptor] describes an abstract protobuf extension field and +// may not always be an [ExtensionTypeDescriptor]. package protoreflect import ( @@ -142,7 +144,7 @@ type doNotImplement pragma.DoNotImplement // ProtoMessage is the top-level interface that all proto messages implement. // This is declared in the protoreflect package to avoid a cyclic dependency; -// use the proto.Message type instead, which aliases this type. +// use the [google.golang.org/protobuf/proto.Message] type instead, which aliases this type. type ProtoMessage interface{ ProtoReflect() Message } // Syntax is the language version of the proto file. @@ -151,8 +153,9 @@ type Syntax syntax type syntax int8 // keep exact type opaque as the int type may change const ( - Proto2 Syntax = 2 - Proto3 Syntax = 3 + Proto2 Syntax = 2 + Proto3 Syntax = 3 + Editions Syntax = 4 ) // IsValid reports whether the syntax is valid. @@ -172,6 +175,8 @@ func (s Syntax) String() string { return "proto2" case Proto3: return "proto3" + case Editions: + return "editions" default: return fmt.Sprintf("", s) } @@ -436,7 +441,7 @@ type Names interface { // FullName is a qualified name that uniquely identifies a proto declaration. // A qualified name is the concatenation of the proto package along with the // fully-declared name (i.e., name of parent preceding the name of the child), -// with a '.' delimiter placed between each Name. +// with a '.' delimiter placed between each [Name]. // // This should not have any leading or trailing dots. type FullName string // e.g., "google.protobuf.Field.Kind" @@ -480,7 +485,7 @@ func isLetterDigit(c byte) bool { } // Name returns the short name, which is the last identifier segment. -// A single segment FullName is the Name itself. +// A single segment FullName is the [Name] itself. func (n FullName) Name() Name { if i := strings.LastIndexByte(string(n), '.'); i >= 0 { return Name(n[i+1:]) diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/source_gen.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/source_gen.go index 717b106f3..7dcc2ff09 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/source_gen.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/source_gen.go @@ -35,7 +35,7 @@ func (p *SourcePath) appendFileDescriptorProto(b []byte) []byte { b = p.appendSingularField(b, "source_code_info", (*SourcePath).appendSourceCodeInfo) case 12: b = p.appendSingularField(b, "syntax", nil) - case 13: + case 14: b = p.appendSingularField(b, "edition", nil) } return b @@ -160,8 +160,6 @@ func (p *SourcePath) appendFileOptions(b []byte) []byte { b = p.appendSingularField(b, "java_generic_services", nil) case 18: b = p.appendSingularField(b, "py_generic_services", nil) - case 42: - b = p.appendSingularField(b, "php_generic_services", nil) case 23: b = p.appendSingularField(b, "deprecated", nil) case 31: @@ -180,6 +178,8 @@ func (p *SourcePath) appendFileOptions(b []byte) []byte { b = p.appendSingularField(b, "php_metadata_namespace", nil) case 45: b = p.appendSingularField(b, "ruby_package", nil) + case 50: + b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet) case 999: b = p.appendRepeatedField(b, "uninterpreted_option", (*SourcePath).appendUninterpretedOption) } @@ -240,6 +240,8 @@ func (p *SourcePath) appendMessageOptions(b []byte) []byte { b = p.appendSingularField(b, "map_entry", nil) case 11: b = p.appendSingularField(b, "deprecated_legacy_json_field_conflicts", nil) + case 12: + b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet) case 999: b = p.appendRepeatedField(b, "uninterpreted_option", (*SourcePath).appendUninterpretedOption) } @@ -285,6 +287,8 @@ func (p *SourcePath) appendEnumOptions(b []byte) []byte { b = p.appendSingularField(b, "deprecated", nil) case 6: b = p.appendSingularField(b, "deprecated_legacy_json_field_conflicts", nil) + case 7: + b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet) case 999: b = p.appendRepeatedField(b, "uninterpreted_option", (*SourcePath).appendUninterpretedOption) } @@ -330,6 +334,8 @@ func (p *SourcePath) appendServiceOptions(b []byte) []byte { return b } switch (*p)[0] { + case 34: + b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet) case 33: b = p.appendSingularField(b, "deprecated", nil) case 999: @@ -361,16 +367,39 @@ func (p *SourcePath) appendFieldOptions(b []byte) []byte { b = p.appendSingularField(b, "debug_redact", nil) case 17: b = p.appendSingularField(b, "retention", nil) - case 18: - b = p.appendSingularField(b, "target", nil) case 19: b = p.appendRepeatedField(b, "targets", nil) + case 20: + b = p.appendRepeatedField(b, "edition_defaults", (*SourcePath).appendFieldOptions_EditionDefault) + case 21: + b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet) case 999: b = p.appendRepeatedField(b, "uninterpreted_option", (*SourcePath).appendUninterpretedOption) } return b } +func (p *SourcePath) appendFeatureSet(b []byte) []byte { + if len(*p) == 0 { + return b + } + switch (*p)[0] { + case 1: + b = p.appendSingularField(b, "field_presence", nil) + case 2: + b = p.appendSingularField(b, "enum_type", nil) + case 3: + b = p.appendSingularField(b, "repeated_field_encoding", nil) + case 4: + b = p.appendSingularField(b, "utf8_validation", nil) + case 5: + b = p.appendSingularField(b, "message_encoding", nil) + case 6: + b = p.appendSingularField(b, "json_format", nil) + } + return b +} + func (p *SourcePath) appendUninterpretedOption(b []byte) []byte { if len(*p) == 0 { return b @@ -422,6 +451,8 @@ func (p *SourcePath) appendExtensionRangeOptions(b []byte) []byte { b = p.appendRepeatedField(b, "uninterpreted_option", (*SourcePath).appendUninterpretedOption) case 2: b = p.appendRepeatedField(b, "declaration", (*SourcePath).appendExtensionRangeOptions_Declaration) + case 50: + b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet) case 3: b = p.appendSingularField(b, "verification", nil) } @@ -433,6 +464,8 @@ func (p *SourcePath) appendOneofOptions(b []byte) []byte { return b } switch (*p)[0] { + case 1: + b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet) case 999: b = p.appendRepeatedField(b, "uninterpreted_option", (*SourcePath).appendUninterpretedOption) } @@ -446,6 +479,10 @@ func (p *SourcePath) appendEnumValueOptions(b []byte) []byte { switch (*p)[0] { case 1: b = p.appendSingularField(b, "deprecated", nil) + case 2: + b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet) + case 3: + b = p.appendSingularField(b, "debug_redact", nil) case 999: b = p.appendRepeatedField(b, "uninterpreted_option", (*SourcePath).appendUninterpretedOption) } @@ -461,12 +498,27 @@ func (p *SourcePath) appendMethodOptions(b []byte) []byte { b = p.appendSingularField(b, "deprecated", nil) case 34: b = p.appendSingularField(b, "idempotency_level", nil) + case 35: + b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet) case 999: b = p.appendRepeatedField(b, "uninterpreted_option", (*SourcePath).appendUninterpretedOption) } return b } +func (p *SourcePath) appendFieldOptions_EditionDefault(b []byte) []byte { + if len(*p) == 0 { + return b + } + switch (*p)[0] { + case 3: + b = p.appendSingularField(b, "edition", nil) + case 2: + b = p.appendSingularField(b, "value", nil) + } + return b +} + func (p *SourcePath) appendUninterpretedOption_NamePart(b []byte) []byte { if len(*p) == 0 { return b @@ -491,8 +543,6 @@ func (p *SourcePath) appendExtensionRangeOptions_Declaration(b []byte) []byte { b = p.appendSingularField(b, "full_name", nil) case 3: b = p.appendSingularField(b, "type", nil) - case 4: - b = p.appendSingularField(b, "is_repeated", nil) case 5: b = p.appendSingularField(b, "reserved", nil) case 6: diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go index 3867470d3..60ff62b4c 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go @@ -12,7 +12,7 @@ package protoreflect // exactly identical. However, it is possible for the same semantically // identical proto type to be represented by multiple type descriptors. // -// For example, suppose we have t1 and t2 which are both MessageDescriptors. +// For example, suppose we have t1 and t2 which are both an [MessageDescriptor]. // If t1 == t2, then the types are definitely equal and all accessors return // the same information. However, if t1 != t2, then it is still possible that // they still represent the same proto type (e.g., t1.FullName == t2.FullName). @@ -115,7 +115,7 @@ type Descriptor interface { // corresponds with the google.protobuf.FileDescriptorProto message. // // Top-level declarations: -// EnumDescriptor, MessageDescriptor, FieldDescriptor, and/or ServiceDescriptor. +// [EnumDescriptor], [MessageDescriptor], [FieldDescriptor], and/or [ServiceDescriptor]. type FileDescriptor interface { Descriptor // Descriptor.FullName is identical to Package @@ -180,8 +180,8 @@ type FileImport struct { // corresponds with the google.protobuf.DescriptorProto message. // // Nested declarations: -// FieldDescriptor, OneofDescriptor, FieldDescriptor, EnumDescriptor, -// and/or MessageDescriptor. +// [FieldDescriptor], [OneofDescriptor], [FieldDescriptor], [EnumDescriptor], +// and/or [MessageDescriptor]. type MessageDescriptor interface { Descriptor @@ -214,7 +214,7 @@ type MessageDescriptor interface { ExtensionRanges() FieldRanges // ExtensionRangeOptions returns the ith extension range options. // - // To avoid a dependency cycle, this method returns a proto.Message value, + // To avoid a dependency cycle, this method returns a proto.Message] value, // which always contains a google.protobuf.ExtensionRangeOptions message. // This method returns a typed nil-pointer if no options are present. // The caller must import the descriptorpb package to use this. @@ -231,9 +231,9 @@ type MessageDescriptor interface { } type isMessageDescriptor interface{ ProtoType(MessageDescriptor) } -// MessageType encapsulates a MessageDescriptor with a concrete Go implementation. +// MessageType encapsulates a [MessageDescriptor] with a concrete Go implementation. // It is recommended that implementations of this interface also implement the -// MessageFieldTypes interface. +// [MessageFieldTypes] interface. type MessageType interface { // New returns a newly allocated empty message. // It may return nil for synthetic messages representing a map entry. @@ -249,19 +249,19 @@ type MessageType interface { Descriptor() MessageDescriptor } -// MessageFieldTypes extends a MessageType by providing type information +// MessageFieldTypes extends a [MessageType] by providing type information // regarding enums and messages referenced by the message fields. type MessageFieldTypes interface { MessageType - // Enum returns the EnumType for the ith field in Descriptor.Fields. + // Enum returns the EnumType for the ith field in MessageDescriptor.Fields. // It returns nil if the ith field is not an enum kind. // It panics if out of bounds. // // Invariant: mt.Enum(i).Descriptor() == mt.Descriptor().Fields(i).Enum() Enum(i int) EnumType - // Message returns the MessageType for the ith field in Descriptor.Fields. + // Message returns the MessageType for the ith field in MessageDescriptor.Fields. // It returns nil if the ith field is not a message or group kind. // It panics if out of bounds. // @@ -286,8 +286,8 @@ type MessageDescriptors interface { // corresponds with the google.protobuf.FieldDescriptorProto message. // // It is used for both normal fields defined within the parent message -// (e.g., MessageDescriptor.Fields) and fields that extend some remote message -// (e.g., FileDescriptor.Extensions or MessageDescriptor.Extensions). +// (e.g., [MessageDescriptor.Fields]) and fields that extend some remote message +// (e.g., [FileDescriptor.Extensions] or [MessageDescriptor.Extensions]). type FieldDescriptor interface { Descriptor @@ -344,7 +344,7 @@ type FieldDescriptor interface { // IsMap reports whether this field represents a map, // where the value type for the associated field is a Map. // It is equivalent to checking whether Cardinality is Repeated, - // that the Kind is MessageKind, and that Message.IsMapEntry reports true. + // that the Kind is MessageKind, and that MessageDescriptor.IsMapEntry reports true. IsMap() bool // MapKey returns the field descriptor for the key in the map entry. @@ -419,7 +419,7 @@ type OneofDescriptor interface { // IsSynthetic reports whether this is a synthetic oneof created to support // proto3 optional semantics. If true, Fields contains exactly one field - // with HasOptionalKeyword specified. + // with FieldDescriptor.HasOptionalKeyword specified. IsSynthetic() bool // Fields is a list of fields belonging to this oneof. @@ -442,10 +442,10 @@ type OneofDescriptors interface { doNotImplement } -// ExtensionDescriptor is an alias of FieldDescriptor for documentation. +// ExtensionDescriptor is an alias of [FieldDescriptor] for documentation. type ExtensionDescriptor = FieldDescriptor -// ExtensionTypeDescriptor is an ExtensionDescriptor with an associated ExtensionType. +// ExtensionTypeDescriptor is an [ExtensionDescriptor] with an associated [ExtensionType]. type ExtensionTypeDescriptor interface { ExtensionDescriptor @@ -470,12 +470,12 @@ type ExtensionDescriptors interface { doNotImplement } -// ExtensionType encapsulates an ExtensionDescriptor with a concrete +// ExtensionType encapsulates an [ExtensionDescriptor] with a concrete // Go implementation. The nested field descriptor must be for a extension field. // // While a normal field is a member of the parent message that it is declared -// within (see Descriptor.Parent), an extension field is a member of some other -// target message (see ExtensionDescriptor.Extendee) and may have no +// within (see [Descriptor.Parent]), an extension field is a member of some other +// target message (see [FieldDescriptor.ContainingMessage]) and may have no // relationship with the parent. However, the full name of an extension field is // relative to the parent that it is declared within. // @@ -532,7 +532,7 @@ type ExtensionType interface { // corresponds with the google.protobuf.EnumDescriptorProto message. // // Nested declarations: -// EnumValueDescriptor. +// [EnumValueDescriptor]. type EnumDescriptor interface { Descriptor @@ -548,7 +548,7 @@ type EnumDescriptor interface { } type isEnumDescriptor interface{ ProtoType(EnumDescriptor) } -// EnumType encapsulates an EnumDescriptor with a concrete Go implementation. +// EnumType encapsulates an [EnumDescriptor] with a concrete Go implementation. type EnumType interface { // New returns an instance of this enum type with its value set to n. New(n EnumNumber) Enum @@ -610,7 +610,7 @@ type EnumValueDescriptors interface { // ServiceDescriptor describes a service and // corresponds with the google.protobuf.ServiceDescriptorProto message. // -// Nested declarations: MethodDescriptor. +// Nested declarations: [MethodDescriptor]. type ServiceDescriptor interface { Descriptor diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/value.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/value.go index 37601b781..a7b0d06ff 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/value.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/value.go @@ -27,16 +27,16 @@ type Enum interface { // Message is a reflective interface for a concrete message value, // encapsulating both type and value information for the message. // -// Accessor/mutators for individual fields are keyed by FieldDescriptor. +// Accessor/mutators for individual fields are keyed by [FieldDescriptor]. // For non-extension fields, the descriptor must exactly match the // field known by the parent message. -// For extension fields, the descriptor must implement ExtensionTypeDescriptor, -// extend the parent message (i.e., have the same message FullName), and +// For extension fields, the descriptor must implement [ExtensionTypeDescriptor], +// extend the parent message (i.e., have the same message [FullName]), and // be within the parent's extension range. // -// Each field Value can be a scalar or a composite type (Message, List, or Map). -// See Value for the Go types associated with a FieldDescriptor. -// Providing a Value that is invalid or of an incorrect type panics. +// Each field [Value] can be a scalar or a composite type ([Message], [List], or [Map]). +// See [Value] for the Go types associated with a [FieldDescriptor]. +// Providing a [Value] that is invalid or of an incorrect type panics. type Message interface { // Descriptor returns message descriptor, which contains only the protobuf // type information for the message. @@ -152,7 +152,7 @@ type Message interface { // This method may return nil. // // The returned methods type is identical to - // "google.golang.org/protobuf/runtime/protoiface".Methods. + // google.golang.org/protobuf/runtime/protoiface.Methods. // Consult the protoiface package documentation for details. ProtoMethods() *methods } @@ -175,8 +175,8 @@ func (b RawFields) IsValid() bool { } // List is a zero-indexed, ordered list. -// The element Value type is determined by FieldDescriptor.Kind. -// Providing a Value that is invalid or of an incorrect type panics. +// The element [Value] type is determined by [FieldDescriptor.Kind]. +// Providing a [Value] that is invalid or of an incorrect type panics. type List interface { // Len reports the number of entries in the List. // Get, Set, and Truncate panic with out of bound indexes. @@ -226,9 +226,9 @@ type List interface { } // Map is an unordered, associative map. -// The entry MapKey type is determined by FieldDescriptor.MapKey.Kind. -// The entry Value type is determined by FieldDescriptor.MapValue.Kind. -// Providing a MapKey or Value that is invalid or of an incorrect type panics. +// The entry [MapKey] type is determined by [FieldDescriptor.MapKey].Kind. +// The entry [Value] type is determined by [FieldDescriptor.MapValue].Kind. +// Providing a [MapKey] or [Value] that is invalid or of an incorrect type panics. type Map interface { // Len reports the number of elements in the map. Len() int diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_equal.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_equal.go index 591652541..654599d44 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_equal.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_equal.go @@ -24,19 +24,19 @@ import ( // Unlike the == operator, a NaN is equal to another NaN. // // - Enums are equal if they contain the same number. -// Since Value does not contain an enum descriptor, +// Since [Value] does not contain an enum descriptor, // enum values do not consider the type of the enum. // // - Other scalar values are equal if they contain the same value. // -// - Message values are equal if they belong to the same message descriptor, +// - [Message] values are equal if they belong to the same message descriptor, // have the same set of populated known and extension field values, // and the same set of unknown fields values. // -// - Lists are equal if they are the same length and +// - [List] values are equal if they are the same length and // each corresponding element is equal. // -// - Maps are equal if they have the same set of keys and +// - [Map] values are equal if they have the same set of keys and // the corresponding value for each key is equal. func (v1 Value) Equal(v2 Value) bool { return equalValue(v1, v2) diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_union.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_union.go index 08e5ef73f..160309731 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_union.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_union.go @@ -11,7 +11,7 @@ import ( // Value is a union where only one Go type may be set at a time. // The Value is used to represent all possible values a field may take. -// The following shows which Go type is used to represent each proto Kind: +// The following shows which Go type is used to represent each proto [Kind]: // // ╔════════════╤═════════════════════════════════════╗ // ║ Go type │ Protobuf kind ║ @@ -31,22 +31,22 @@ import ( // // Multiple protobuf Kinds may be represented by a single Go type if the type // can losslessly represent the information for the proto kind. For example, -// Int64Kind, Sint64Kind, and Sfixed64Kind are all represented by int64, +// [Int64Kind], [Sint64Kind], and [Sfixed64Kind] are all represented by int64, // but use different integer encoding methods. // -// The List or Map types are used if the field cardinality is repeated. -// A field is a List if FieldDescriptor.IsList reports true. -// A field is a Map if FieldDescriptor.IsMap reports true. +// The [List] or [Map] types are used if the field cardinality is repeated. +// A field is a [List] if [FieldDescriptor.IsList] reports true. +// A field is a [Map] if [FieldDescriptor.IsMap] reports true. // // Converting to/from a Value and a concrete Go value panics on type mismatch. -// For example, ValueOf("hello").Int() panics because this attempts to +// For example, [ValueOf]("hello").Int() panics because this attempts to // retrieve an int64 from a string. // -// List, Map, and Message Values are called "composite" values. +// [List], [Map], and [Message] Values are called "composite" values. // // A composite Value may alias (reference) memory at some location, // such that changes to the Value updates the that location. -// A composite value acquired with a Mutable method, such as Message.Mutable, +// A composite value acquired with a Mutable method, such as [Message.Mutable], // always references the source object. // // For example: @@ -65,7 +65,7 @@ import ( // // appending to the List here may or may not modify the message. // list.Append(protoreflect.ValueOfInt32(0)) // -// Some operations, such as Message.Get, may return an "empty, read-only" +// Some operations, such as [Message.Get], may return an "empty, read-only" // composite Value. Modifying an empty, read-only value panics. type Value value @@ -306,7 +306,7 @@ func (v Value) Float() float64 { } } -// String returns v as a string. Since this method implements fmt.Stringer, +// String returns v as a string. Since this method implements [fmt.Stringer], // this returns the formatted string value for any non-string type. func (v Value) String() string { switch v.typ { @@ -327,7 +327,7 @@ func (v Value) Bytes() []byte { } } -// Enum returns v as a EnumNumber and panics if the type is not a EnumNumber. +// Enum returns v as a [EnumNumber] and panics if the type is not a [EnumNumber]. func (v Value) Enum() EnumNumber { switch v.typ { case enumType: @@ -337,7 +337,7 @@ func (v Value) Enum() EnumNumber { } } -// Message returns v as a Message and panics if the type is not a Message. +// Message returns v as a [Message] and panics if the type is not a [Message]. func (v Value) Message() Message { switch vi := v.getIface().(type) { case Message: @@ -347,7 +347,7 @@ func (v Value) Message() Message { } } -// List returns v as a List and panics if the type is not a List. +// List returns v as a [List] and panics if the type is not a [List]. func (v Value) List() List { switch vi := v.getIface().(type) { case List: @@ -357,7 +357,7 @@ func (v Value) List() List { } } -// Map returns v as a Map and panics if the type is not a Map. +// Map returns v as a [Map] and panics if the type is not a [Map]. func (v Value) Map() Map { switch vi := v.getIface().(type) { case Map: @@ -367,7 +367,7 @@ func (v Value) Map() Map { } } -// MapKey returns v as a MapKey and panics for invalid MapKey types. +// MapKey returns v as a [MapKey] and panics for invalid [MapKey] types. func (v Value) MapKey() MapKey { switch v.typ { case boolType, int32Type, int64Type, uint32Type, uint64Type, stringType: @@ -378,8 +378,8 @@ func (v Value) MapKey() MapKey { } // MapKey is used to index maps, where the Go type of the MapKey must match -// the specified key Kind (see MessageDescriptor.IsMapEntry). -// The following shows what Go type is used to represent each proto Kind: +// the specified key [Kind] (see [MessageDescriptor.IsMapEntry]). +// The following shows what Go type is used to represent each proto [Kind]: // // ╔═════════╤═════════════════════════════════════╗ // ║ Go type │ Protobuf kind ║ @@ -392,13 +392,13 @@ func (v Value) MapKey() MapKey { // ║ string │ StringKind ║ // ╚═════════╧═════════════════════════════════════╝ // -// A MapKey is constructed and accessed through a Value: +// A MapKey is constructed and accessed through a [Value]: // // k := ValueOf("hash").MapKey() // convert string to MapKey // s := k.String() // convert MapKey to string // -// The MapKey is a strict subset of valid types used in Value; -// converting a Value to a MapKey with an invalid type panics. +// The MapKey is a strict subset of valid types used in [Value]; +// converting a [Value] to a MapKey with an invalid type panics. type MapKey value // IsValid reports whether k is populated with a value. @@ -426,13 +426,13 @@ func (k MapKey) Uint() uint64 { return Value(k).Uint() } -// String returns k as a string. Since this method implements fmt.Stringer, +// String returns k as a string. Since this method implements [fmt.Stringer], // this returns the formatted string value for any non-string type. func (k MapKey) String() string { return Value(k).String() } -// Value returns k as a Value. +// Value returns k as a [Value]. func (k MapKey) Value() Value { return Value(k) } diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe.go deleted file mode 100644 index 702ddf22a..000000000 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe.go +++ /dev/null @@ -1,99 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !purego && !appengine -// +build !purego,!appengine - -package protoreflect - -import ( - "unsafe" - - "google.golang.org/protobuf/internal/pragma" -) - -type ( - stringHeader struct { - Data unsafe.Pointer - Len int - } - sliceHeader struct { - Data unsafe.Pointer - Len int - Cap int - } - ifaceHeader struct { - Type unsafe.Pointer - Data unsafe.Pointer - } -) - -var ( - nilType = typeOf(nil) - boolType = typeOf(*new(bool)) - int32Type = typeOf(*new(int32)) - int64Type = typeOf(*new(int64)) - uint32Type = typeOf(*new(uint32)) - uint64Type = typeOf(*new(uint64)) - float32Type = typeOf(*new(float32)) - float64Type = typeOf(*new(float64)) - stringType = typeOf(*new(string)) - bytesType = typeOf(*new([]byte)) - enumType = typeOf(*new(EnumNumber)) -) - -// typeOf returns a pointer to the Go type information. -// The pointer is comparable and equal if and only if the types are identical. -func typeOf(t interface{}) unsafe.Pointer { - return (*ifaceHeader)(unsafe.Pointer(&t)).Type -} - -// value is a union where only one type can be represented at a time. -// The struct is 24B large on 64-bit systems and requires the minimum storage -// necessary to represent each possible type. -// -// The Go GC needs to be able to scan variables containing pointers. -// As such, pointers and non-pointers cannot be intermixed. -type value struct { - pragma.DoNotCompare // 0B - - // typ stores the type of the value as a pointer to the Go type. - typ unsafe.Pointer // 8B - - // ptr stores the data pointer for a String, Bytes, or interface value. - ptr unsafe.Pointer // 8B - - // num stores a Bool, Int32, Int64, Uint32, Uint64, Float32, Float64, or - // Enum value as a raw uint64. - // - // It is also used to store the length of a String or Bytes value; - // the capacity is ignored. - num uint64 // 8B -} - -func valueOfString(v string) Value { - p := (*stringHeader)(unsafe.Pointer(&v)) - return Value{typ: stringType, ptr: p.Data, num: uint64(len(v))} -} -func valueOfBytes(v []byte) Value { - p := (*sliceHeader)(unsafe.Pointer(&v)) - return Value{typ: bytesType, ptr: p.Data, num: uint64(len(v))} -} -func valueOfIface(v interface{}) Value { - p := (*ifaceHeader)(unsafe.Pointer(&v)) - return Value{typ: p.Type, ptr: p.Data} -} - -func (v Value) getString() (x string) { - *(*stringHeader)(unsafe.Pointer(&x)) = stringHeader{Data: v.ptr, Len: int(v.num)} - return x -} -func (v Value) getBytes() (x []byte) { - *(*sliceHeader)(unsafe.Pointer(&x)) = sliceHeader{Data: v.ptr, Len: int(v.num), Cap: int(v.num)} - return x -} -func (v Value) getIface() (x interface{}) { - *(*ifaceHeader)(unsafe.Pointer(&x)) = ifaceHeader{Type: v.typ, Data: v.ptr} - return x -} diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go120.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go120.go new file mode 100644 index 000000000..b1fdbe3e8 --- /dev/null +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go120.go @@ -0,0 +1,99 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !purego && !appengine && !go1.21 +// +build !purego,!appengine,!go1.21 + +package protoreflect + +import ( + "unsafe" + + "google.golang.org/protobuf/internal/pragma" +) + +type ( + stringHeader struct { + Data unsafe.Pointer + Len int + } + sliceHeader struct { + Data unsafe.Pointer + Len int + Cap int + } + ifaceHeader struct { + Type unsafe.Pointer + Data unsafe.Pointer + } +) + +var ( + nilType = typeOf(nil) + boolType = typeOf(*new(bool)) + int32Type = typeOf(*new(int32)) + int64Type = typeOf(*new(int64)) + uint32Type = typeOf(*new(uint32)) + uint64Type = typeOf(*new(uint64)) + float32Type = typeOf(*new(float32)) + float64Type = typeOf(*new(float64)) + stringType = typeOf(*new(string)) + bytesType = typeOf(*new([]byte)) + enumType = typeOf(*new(EnumNumber)) +) + +// typeOf returns a pointer to the Go type information. +// The pointer is comparable and equal if and only if the types are identical. +func typeOf(t interface{}) unsafe.Pointer { + return (*ifaceHeader)(unsafe.Pointer(&t)).Type +} + +// value is a union where only one type can be represented at a time. +// The struct is 24B large on 64-bit systems and requires the minimum storage +// necessary to represent each possible type. +// +// The Go GC needs to be able to scan variables containing pointers. +// As such, pointers and non-pointers cannot be intermixed. +type value struct { + pragma.DoNotCompare // 0B + + // typ stores the type of the value as a pointer to the Go type. + typ unsafe.Pointer // 8B + + // ptr stores the data pointer for a String, Bytes, or interface value. + ptr unsafe.Pointer // 8B + + // num stores a Bool, Int32, Int64, Uint32, Uint64, Float32, Float64, or + // Enum value as a raw uint64. + // + // It is also used to store the length of a String or Bytes value; + // the capacity is ignored. + num uint64 // 8B +} + +func valueOfString(v string) Value { + p := (*stringHeader)(unsafe.Pointer(&v)) + return Value{typ: stringType, ptr: p.Data, num: uint64(len(v))} +} +func valueOfBytes(v []byte) Value { + p := (*sliceHeader)(unsafe.Pointer(&v)) + return Value{typ: bytesType, ptr: p.Data, num: uint64(len(v))} +} +func valueOfIface(v interface{}) Value { + p := (*ifaceHeader)(unsafe.Pointer(&v)) + return Value{typ: p.Type, ptr: p.Data} +} + +func (v Value) getString() (x string) { + *(*stringHeader)(unsafe.Pointer(&x)) = stringHeader{Data: v.ptr, Len: int(v.num)} + return x +} +func (v Value) getBytes() (x []byte) { + *(*sliceHeader)(unsafe.Pointer(&x)) = sliceHeader{Data: v.ptr, Len: int(v.num), Cap: int(v.num)} + return x +} +func (v Value) getIface() (x interface{}) { + *(*ifaceHeader)(unsafe.Pointer(&x)) = ifaceHeader{Type: v.typ, Data: v.ptr} + return x +} diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go121.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go121.go new file mode 100644 index 000000000..435470111 --- /dev/null +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go121.go @@ -0,0 +1,87 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !purego && !appengine && go1.21 +// +build !purego,!appengine,go1.21 + +package protoreflect + +import ( + "unsafe" + + "google.golang.org/protobuf/internal/pragma" +) + +type ( + ifaceHeader struct { + _ [0]interface{} // if interfaces have greater alignment than unsafe.Pointer, this will enforce it. + Type unsafe.Pointer + Data unsafe.Pointer + } +) + +var ( + nilType = typeOf(nil) + boolType = typeOf(*new(bool)) + int32Type = typeOf(*new(int32)) + int64Type = typeOf(*new(int64)) + uint32Type = typeOf(*new(uint32)) + uint64Type = typeOf(*new(uint64)) + float32Type = typeOf(*new(float32)) + float64Type = typeOf(*new(float64)) + stringType = typeOf(*new(string)) + bytesType = typeOf(*new([]byte)) + enumType = typeOf(*new(EnumNumber)) +) + +// typeOf returns a pointer to the Go type information. +// The pointer is comparable and equal if and only if the types are identical. +func typeOf(t interface{}) unsafe.Pointer { + return (*ifaceHeader)(unsafe.Pointer(&t)).Type +} + +// value is a union where only one type can be represented at a time. +// The struct is 24B large on 64-bit systems and requires the minimum storage +// necessary to represent each possible type. +// +// The Go GC needs to be able to scan variables containing pointers. +// As such, pointers and non-pointers cannot be intermixed. +type value struct { + pragma.DoNotCompare // 0B + + // typ stores the type of the value as a pointer to the Go type. + typ unsafe.Pointer // 8B + + // ptr stores the data pointer for a String, Bytes, or interface value. + ptr unsafe.Pointer // 8B + + // num stores a Bool, Int32, Int64, Uint32, Uint64, Float32, Float64, or + // Enum value as a raw uint64. + // + // It is also used to store the length of a String or Bytes value; + // the capacity is ignored. + num uint64 // 8B +} + +func valueOfString(v string) Value { + return Value{typ: stringType, ptr: unsafe.Pointer(unsafe.StringData(v)), num: uint64(len(v))} +} +func valueOfBytes(v []byte) Value { + return Value{typ: bytesType, ptr: unsafe.Pointer(unsafe.SliceData(v)), num: uint64(len(v))} +} +func valueOfIface(v interface{}) Value { + p := (*ifaceHeader)(unsafe.Pointer(&v)) + return Value{typ: p.Type, ptr: p.Data} +} + +func (v Value) getString() string { + return unsafe.String((*byte)(v.ptr), v.num) +} +func (v Value) getBytes() []byte { + return unsafe.Slice((*byte)(v.ptr), v.num) +} +func (v Value) getIface() (x interface{}) { + *(*ifaceHeader)(unsafe.Pointer(&x)) = ifaceHeader{Type: v.typ, Data: v.ptr} + return x +} diff --git a/vendor/google.golang.org/protobuf/reflect/protoregistry/registry.go b/vendor/google.golang.org/protobuf/reflect/protoregistry/registry.go index aeb559774..6267dc52a 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoregistry/registry.go +++ b/vendor/google.golang.org/protobuf/reflect/protoregistry/registry.go @@ -5,12 +5,12 @@ // Package protoregistry provides data structures to register and lookup // protobuf descriptor types. // -// The Files registry contains file descriptors and provides the ability +// The [Files] registry contains file descriptors and provides the ability // to iterate over the files or lookup a specific descriptor within the files. -// Files only contains protobuf descriptors and has no understanding of Go +// [Files] only contains protobuf descriptors and has no understanding of Go // type information that may be associated with each descriptor. // -// The Types registry contains descriptor types for which there is a known +// The [Types] registry contains descriptor types for which there is a known // Go type associated with that descriptor. It provides the ability to iterate // over the registered types or lookup a type by name. package protoregistry @@ -218,7 +218,7 @@ func (r *Files) checkGenProtoConflict(path string) { // FindDescriptorByName looks up a descriptor by the full name. // -// This returns (nil, NotFound) if not found. +// This returns (nil, [NotFound]) if not found. func (r *Files) FindDescriptorByName(name protoreflect.FullName) (protoreflect.Descriptor, error) { if r == nil { return nil, NotFound @@ -310,7 +310,7 @@ func (s *nameSuffix) Pop() (name protoreflect.Name) { // FindFileByPath looks up a file by the path. // -// This returns (nil, NotFound) if not found. +// This returns (nil, [NotFound]) if not found. // This returns an error if multiple files have the same path. func (r *Files) FindFileByPath(path string) (protoreflect.FileDescriptor, error) { if r == nil { @@ -431,7 +431,7 @@ func rangeTopLevelDescriptors(fd protoreflect.FileDescriptor, f func(protoreflec // A compliant implementation must deterministically return the same type // if no error is encountered. // -// The Types type implements this interface. +// The [Types] type implements this interface. type MessageTypeResolver interface { // FindMessageByName looks up a message by its full name. // E.g., "google.protobuf.Any" @@ -451,7 +451,7 @@ type MessageTypeResolver interface { // A compliant implementation must deterministically return the same type // if no error is encountered. // -// The Types type implements this interface. +// The [Types] type implements this interface. type ExtensionTypeResolver interface { // FindExtensionByName looks up a extension field by the field's full name. // Note that this is the full name of the field as determined by @@ -590,7 +590,7 @@ func (r *Types) register(kind string, desc protoreflect.Descriptor, typ interfac // FindEnumByName looks up an enum by its full name. // E.g., "google.protobuf.Field.Kind". // -// This returns (nil, NotFound) if not found. +// This returns (nil, [NotFound]) if not found. func (r *Types) FindEnumByName(enum protoreflect.FullName) (protoreflect.EnumType, error) { if r == nil { return nil, NotFound @@ -611,7 +611,7 @@ func (r *Types) FindEnumByName(enum protoreflect.FullName) (protoreflect.EnumTyp // FindMessageByName looks up a message by its full name, // e.g. "google.protobuf.Any". // -// This returns (nil, NotFound) if not found. +// This returns (nil, [NotFound]) if not found. func (r *Types) FindMessageByName(message protoreflect.FullName) (protoreflect.MessageType, error) { if r == nil { return nil, NotFound @@ -632,7 +632,7 @@ func (r *Types) FindMessageByName(message protoreflect.FullName) (protoreflect.M // FindMessageByURL looks up a message by a URL identifier. // See documentation on google.protobuf.Any.type_url for the URL format. // -// This returns (nil, NotFound) if not found. +// This returns (nil, [NotFound]) if not found. func (r *Types) FindMessageByURL(url string) (protoreflect.MessageType, error) { // This function is similar to FindMessageByName but // truncates anything before and including '/' in the URL. @@ -662,7 +662,7 @@ func (r *Types) FindMessageByURL(url string) (protoreflect.MessageType, error) { // where the extension is declared and is unrelated to the full name of the // message being extended. // -// This returns (nil, NotFound) if not found. +// This returns (nil, [NotFound]) if not found. func (r *Types) FindExtensionByName(field protoreflect.FullName) (protoreflect.ExtensionType, error) { if r == nil { return nil, NotFound @@ -703,7 +703,7 @@ func (r *Types) FindExtensionByName(field protoreflect.FullName) (protoreflect.E // FindExtensionByNumber looks up a extension field by the field number // within some parent message, identified by full name. // -// This returns (nil, NotFound) if not found. +// This returns (nil, [NotFound]) if not found. func (r *Types) FindExtensionByNumber(message protoreflect.FullName, field protoreflect.FieldNumber) (protoreflect.ExtensionType, error) { if r == nil { return nil, NotFound diff --git a/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go b/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go index 04c00f737..78624cf60 100644 --- a/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go +++ b/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go @@ -48,6 +48,103 @@ import ( sync "sync" ) +// The full set of known editions. +type Edition int32 + +const ( + // A placeholder for an unknown edition value. + Edition_EDITION_UNKNOWN Edition = 0 + // Legacy syntax "editions". These pre-date editions, but behave much like + // distinct editions. These can't be used to specify the edition of proto + // files, but feature definitions must supply proto2/proto3 defaults for + // backwards compatibility. + Edition_EDITION_PROTO2 Edition = 998 + Edition_EDITION_PROTO3 Edition = 999 + // Editions that have been released. The specific values are arbitrary and + // should not be depended on, but they will always be time-ordered for easy + // comparison. + Edition_EDITION_2023 Edition = 1000 + Edition_EDITION_2024 Edition = 1001 + // Placeholder editions for testing feature resolution. These should not be + // used or relyed on outside of tests. + Edition_EDITION_1_TEST_ONLY Edition = 1 + Edition_EDITION_2_TEST_ONLY Edition = 2 + Edition_EDITION_99997_TEST_ONLY Edition = 99997 + Edition_EDITION_99998_TEST_ONLY Edition = 99998 + Edition_EDITION_99999_TEST_ONLY Edition = 99999 + // Placeholder for specifying unbounded edition support. This should only + // ever be used by plugins that can expect to never require any changes to + // support a new edition. + Edition_EDITION_MAX Edition = 2147483647 +) + +// Enum value maps for Edition. +var ( + Edition_name = map[int32]string{ + 0: "EDITION_UNKNOWN", + 998: "EDITION_PROTO2", + 999: "EDITION_PROTO3", + 1000: "EDITION_2023", + 1001: "EDITION_2024", + 1: "EDITION_1_TEST_ONLY", + 2: "EDITION_2_TEST_ONLY", + 99997: "EDITION_99997_TEST_ONLY", + 99998: "EDITION_99998_TEST_ONLY", + 99999: "EDITION_99999_TEST_ONLY", + 2147483647: "EDITION_MAX", + } + Edition_value = map[string]int32{ + "EDITION_UNKNOWN": 0, + "EDITION_PROTO2": 998, + "EDITION_PROTO3": 999, + "EDITION_2023": 1000, + "EDITION_2024": 1001, + "EDITION_1_TEST_ONLY": 1, + "EDITION_2_TEST_ONLY": 2, + "EDITION_99997_TEST_ONLY": 99997, + "EDITION_99998_TEST_ONLY": 99998, + "EDITION_99999_TEST_ONLY": 99999, + "EDITION_MAX": 2147483647, + } +) + +func (x Edition) Enum() *Edition { + p := new(Edition) + *p = x + return p +} + +func (x Edition) String() string { + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) +} + +func (Edition) Descriptor() protoreflect.EnumDescriptor { + return file_google_protobuf_descriptor_proto_enumTypes[0].Descriptor() +} + +func (Edition) Type() protoreflect.EnumType { + return &file_google_protobuf_descriptor_proto_enumTypes[0] +} + +func (x Edition) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Do not use. +func (x *Edition) UnmarshalJSON(b []byte) error { + num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b) + if err != nil { + return err + } + *x = Edition(num) + return nil +} + +// Deprecated: Use Edition.Descriptor instead. +func (Edition) EnumDescriptor() ([]byte, []int) { + return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{0} +} + // The verification state of the extension range. type ExtensionRangeOptions_VerificationState int32 @@ -80,11 +177,11 @@ func (x ExtensionRangeOptions_VerificationState) String() string { } func (ExtensionRangeOptions_VerificationState) Descriptor() protoreflect.EnumDescriptor { - return file_google_protobuf_descriptor_proto_enumTypes[0].Descriptor() + return file_google_protobuf_descriptor_proto_enumTypes[1].Descriptor() } func (ExtensionRangeOptions_VerificationState) Type() protoreflect.EnumType { - return &file_google_protobuf_descriptor_proto_enumTypes[0] + return &file_google_protobuf_descriptor_proto_enumTypes[1] } func (x ExtensionRangeOptions_VerificationState) Number() protoreflect.EnumNumber { @@ -125,9 +222,10 @@ const ( FieldDescriptorProto_TYPE_BOOL FieldDescriptorProto_Type = 8 FieldDescriptorProto_TYPE_STRING FieldDescriptorProto_Type = 9 // Tag-delimited aggregate. - // Group type is deprecated and not supported in proto3. However, Proto3 + // Group type is deprecated and not supported after google.protobuf. However, Proto3 // implementations should still be able to parse the group wire format and - // treat group fields as unknown fields. + // treat group fields as unknown fields. In Editions, the group wire format + // can be enabled via the `message_encoding` feature. FieldDescriptorProto_TYPE_GROUP FieldDescriptorProto_Type = 10 FieldDescriptorProto_TYPE_MESSAGE FieldDescriptorProto_Type = 11 // Length-delimited aggregate. // New in version 2. @@ -195,11 +293,11 @@ func (x FieldDescriptorProto_Type) String() string { } func (FieldDescriptorProto_Type) Descriptor() protoreflect.EnumDescriptor { - return file_google_protobuf_descriptor_proto_enumTypes[1].Descriptor() + return file_google_protobuf_descriptor_proto_enumTypes[2].Descriptor() } func (FieldDescriptorProto_Type) Type() protoreflect.EnumType { - return &file_google_protobuf_descriptor_proto_enumTypes[1] + return &file_google_protobuf_descriptor_proto_enumTypes[2] } func (x FieldDescriptorProto_Type) Number() protoreflect.EnumNumber { @@ -226,21 +324,24 @@ type FieldDescriptorProto_Label int32 const ( // 0 is reserved for errors FieldDescriptorProto_LABEL_OPTIONAL FieldDescriptorProto_Label = 1 - FieldDescriptorProto_LABEL_REQUIRED FieldDescriptorProto_Label = 2 FieldDescriptorProto_LABEL_REPEATED FieldDescriptorProto_Label = 3 + // The required label is only allowed in google.protobuf. In proto3 and Editions + // it's explicitly prohibited. In Editions, the `field_presence` feature + // can be used to get this behavior. + FieldDescriptorProto_LABEL_REQUIRED FieldDescriptorProto_Label = 2 ) // Enum value maps for FieldDescriptorProto_Label. var ( FieldDescriptorProto_Label_name = map[int32]string{ 1: "LABEL_OPTIONAL", - 2: "LABEL_REQUIRED", 3: "LABEL_REPEATED", + 2: "LABEL_REQUIRED", } FieldDescriptorProto_Label_value = map[string]int32{ "LABEL_OPTIONAL": 1, - "LABEL_REQUIRED": 2, "LABEL_REPEATED": 3, + "LABEL_REQUIRED": 2, } ) @@ -255,11 +356,11 @@ func (x FieldDescriptorProto_Label) String() string { } func (FieldDescriptorProto_Label) Descriptor() protoreflect.EnumDescriptor { - return file_google_protobuf_descriptor_proto_enumTypes[2].Descriptor() + return file_google_protobuf_descriptor_proto_enumTypes[3].Descriptor() } func (FieldDescriptorProto_Label) Type() protoreflect.EnumType { - return &file_google_protobuf_descriptor_proto_enumTypes[2] + return &file_google_protobuf_descriptor_proto_enumTypes[3] } func (x FieldDescriptorProto_Label) Number() protoreflect.EnumNumber { @@ -316,11 +417,11 @@ func (x FileOptions_OptimizeMode) String() string { } func (FileOptions_OptimizeMode) Descriptor() protoreflect.EnumDescriptor { - return file_google_protobuf_descriptor_proto_enumTypes[3].Descriptor() + return file_google_protobuf_descriptor_proto_enumTypes[4].Descriptor() } func (FileOptions_OptimizeMode) Type() protoreflect.EnumType { - return &file_google_protobuf_descriptor_proto_enumTypes[3] + return &file_google_protobuf_descriptor_proto_enumTypes[4] } func (x FileOptions_OptimizeMode) Number() protoreflect.EnumNumber { @@ -382,11 +483,11 @@ func (x FieldOptions_CType) String() string { } func (FieldOptions_CType) Descriptor() protoreflect.EnumDescriptor { - return file_google_protobuf_descriptor_proto_enumTypes[4].Descriptor() + return file_google_protobuf_descriptor_proto_enumTypes[5].Descriptor() } func (FieldOptions_CType) Type() protoreflect.EnumType { - return &file_google_protobuf_descriptor_proto_enumTypes[4] + return &file_google_protobuf_descriptor_proto_enumTypes[5] } func (x FieldOptions_CType) Number() protoreflect.EnumNumber { @@ -444,11 +545,11 @@ func (x FieldOptions_JSType) String() string { } func (FieldOptions_JSType) Descriptor() protoreflect.EnumDescriptor { - return file_google_protobuf_descriptor_proto_enumTypes[5].Descriptor() + return file_google_protobuf_descriptor_proto_enumTypes[6].Descriptor() } func (FieldOptions_JSType) Type() protoreflect.EnumType { - return &file_google_protobuf_descriptor_proto_enumTypes[5] + return &file_google_protobuf_descriptor_proto_enumTypes[6] } func (x FieldOptions_JSType) Number() protoreflect.EnumNumber { @@ -506,11 +607,11 @@ func (x FieldOptions_OptionRetention) String() string { } func (FieldOptions_OptionRetention) Descriptor() protoreflect.EnumDescriptor { - return file_google_protobuf_descriptor_proto_enumTypes[6].Descriptor() + return file_google_protobuf_descriptor_proto_enumTypes[7].Descriptor() } func (FieldOptions_OptionRetention) Type() protoreflect.EnumType { - return &file_google_protobuf_descriptor_proto_enumTypes[6] + return &file_google_protobuf_descriptor_proto_enumTypes[7] } func (x FieldOptions_OptionRetention) Number() protoreflect.EnumNumber { @@ -590,11 +691,11 @@ func (x FieldOptions_OptionTargetType) String() string { } func (FieldOptions_OptionTargetType) Descriptor() protoreflect.EnumDescriptor { - return file_google_protobuf_descriptor_proto_enumTypes[7].Descriptor() + return file_google_protobuf_descriptor_proto_enumTypes[8].Descriptor() } func (FieldOptions_OptionTargetType) Type() protoreflect.EnumType { - return &file_google_protobuf_descriptor_proto_enumTypes[7] + return &file_google_protobuf_descriptor_proto_enumTypes[8] } func (x FieldOptions_OptionTargetType) Number() protoreflect.EnumNumber { @@ -652,11 +753,11 @@ func (x MethodOptions_IdempotencyLevel) String() string { } func (MethodOptions_IdempotencyLevel) Descriptor() protoreflect.EnumDescriptor { - return file_google_protobuf_descriptor_proto_enumTypes[8].Descriptor() + return file_google_protobuf_descriptor_proto_enumTypes[9].Descriptor() } func (MethodOptions_IdempotencyLevel) Type() protoreflect.EnumType { - return &file_google_protobuf_descriptor_proto_enumTypes[8] + return &file_google_protobuf_descriptor_proto_enumTypes[9] } func (x MethodOptions_IdempotencyLevel) Number() protoreflect.EnumNumber { @@ -678,6 +779,363 @@ func (MethodOptions_IdempotencyLevel) EnumDescriptor() ([]byte, []int) { return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{17, 0} } +type FeatureSet_FieldPresence int32 + +const ( + FeatureSet_FIELD_PRESENCE_UNKNOWN FeatureSet_FieldPresence = 0 + FeatureSet_EXPLICIT FeatureSet_FieldPresence = 1 + FeatureSet_IMPLICIT FeatureSet_FieldPresence = 2 + FeatureSet_LEGACY_REQUIRED FeatureSet_FieldPresence = 3 +) + +// Enum value maps for FeatureSet_FieldPresence. +var ( + FeatureSet_FieldPresence_name = map[int32]string{ + 0: "FIELD_PRESENCE_UNKNOWN", + 1: "EXPLICIT", + 2: "IMPLICIT", + 3: "LEGACY_REQUIRED", + } + FeatureSet_FieldPresence_value = map[string]int32{ + "FIELD_PRESENCE_UNKNOWN": 0, + "EXPLICIT": 1, + "IMPLICIT": 2, + "LEGACY_REQUIRED": 3, + } +) + +func (x FeatureSet_FieldPresence) Enum() *FeatureSet_FieldPresence { + p := new(FeatureSet_FieldPresence) + *p = x + return p +} + +func (x FeatureSet_FieldPresence) String() string { + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) +} + +func (FeatureSet_FieldPresence) Descriptor() protoreflect.EnumDescriptor { + return file_google_protobuf_descriptor_proto_enumTypes[10].Descriptor() +} + +func (FeatureSet_FieldPresence) Type() protoreflect.EnumType { + return &file_google_protobuf_descriptor_proto_enumTypes[10] +} + +func (x FeatureSet_FieldPresence) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Do not use. +func (x *FeatureSet_FieldPresence) UnmarshalJSON(b []byte) error { + num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b) + if err != nil { + return err + } + *x = FeatureSet_FieldPresence(num) + return nil +} + +// Deprecated: Use FeatureSet_FieldPresence.Descriptor instead. +func (FeatureSet_FieldPresence) EnumDescriptor() ([]byte, []int) { + return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19, 0} +} + +type FeatureSet_EnumType int32 + +const ( + FeatureSet_ENUM_TYPE_UNKNOWN FeatureSet_EnumType = 0 + FeatureSet_OPEN FeatureSet_EnumType = 1 + FeatureSet_CLOSED FeatureSet_EnumType = 2 +) + +// Enum value maps for FeatureSet_EnumType. +var ( + FeatureSet_EnumType_name = map[int32]string{ + 0: "ENUM_TYPE_UNKNOWN", + 1: "OPEN", + 2: "CLOSED", + } + FeatureSet_EnumType_value = map[string]int32{ + "ENUM_TYPE_UNKNOWN": 0, + "OPEN": 1, + "CLOSED": 2, + } +) + +func (x FeatureSet_EnumType) Enum() *FeatureSet_EnumType { + p := new(FeatureSet_EnumType) + *p = x + return p +} + +func (x FeatureSet_EnumType) String() string { + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) +} + +func (FeatureSet_EnumType) Descriptor() protoreflect.EnumDescriptor { + return file_google_protobuf_descriptor_proto_enumTypes[11].Descriptor() +} + +func (FeatureSet_EnumType) Type() protoreflect.EnumType { + return &file_google_protobuf_descriptor_proto_enumTypes[11] +} + +func (x FeatureSet_EnumType) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Do not use. +func (x *FeatureSet_EnumType) UnmarshalJSON(b []byte) error { + num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b) + if err != nil { + return err + } + *x = FeatureSet_EnumType(num) + return nil +} + +// Deprecated: Use FeatureSet_EnumType.Descriptor instead. +func (FeatureSet_EnumType) EnumDescriptor() ([]byte, []int) { + return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19, 1} +} + +type FeatureSet_RepeatedFieldEncoding int32 + +const ( + FeatureSet_REPEATED_FIELD_ENCODING_UNKNOWN FeatureSet_RepeatedFieldEncoding = 0 + FeatureSet_PACKED FeatureSet_RepeatedFieldEncoding = 1 + FeatureSet_EXPANDED FeatureSet_RepeatedFieldEncoding = 2 +) + +// Enum value maps for FeatureSet_RepeatedFieldEncoding. +var ( + FeatureSet_RepeatedFieldEncoding_name = map[int32]string{ + 0: "REPEATED_FIELD_ENCODING_UNKNOWN", + 1: "PACKED", + 2: "EXPANDED", + } + FeatureSet_RepeatedFieldEncoding_value = map[string]int32{ + "REPEATED_FIELD_ENCODING_UNKNOWN": 0, + "PACKED": 1, + "EXPANDED": 2, + } +) + +func (x FeatureSet_RepeatedFieldEncoding) Enum() *FeatureSet_RepeatedFieldEncoding { + p := new(FeatureSet_RepeatedFieldEncoding) + *p = x + return p +} + +func (x FeatureSet_RepeatedFieldEncoding) String() string { + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) +} + +func (FeatureSet_RepeatedFieldEncoding) Descriptor() protoreflect.EnumDescriptor { + return file_google_protobuf_descriptor_proto_enumTypes[12].Descriptor() +} + +func (FeatureSet_RepeatedFieldEncoding) Type() protoreflect.EnumType { + return &file_google_protobuf_descriptor_proto_enumTypes[12] +} + +func (x FeatureSet_RepeatedFieldEncoding) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Do not use. +func (x *FeatureSet_RepeatedFieldEncoding) UnmarshalJSON(b []byte) error { + num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b) + if err != nil { + return err + } + *x = FeatureSet_RepeatedFieldEncoding(num) + return nil +} + +// Deprecated: Use FeatureSet_RepeatedFieldEncoding.Descriptor instead. +func (FeatureSet_RepeatedFieldEncoding) EnumDescriptor() ([]byte, []int) { + return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19, 2} +} + +type FeatureSet_Utf8Validation int32 + +const ( + FeatureSet_UTF8_VALIDATION_UNKNOWN FeatureSet_Utf8Validation = 0 + FeatureSet_VERIFY FeatureSet_Utf8Validation = 2 + FeatureSet_NONE FeatureSet_Utf8Validation = 3 +) + +// Enum value maps for FeatureSet_Utf8Validation. +var ( + FeatureSet_Utf8Validation_name = map[int32]string{ + 0: "UTF8_VALIDATION_UNKNOWN", + 2: "VERIFY", + 3: "NONE", + } + FeatureSet_Utf8Validation_value = map[string]int32{ + "UTF8_VALIDATION_UNKNOWN": 0, + "VERIFY": 2, + "NONE": 3, + } +) + +func (x FeatureSet_Utf8Validation) Enum() *FeatureSet_Utf8Validation { + p := new(FeatureSet_Utf8Validation) + *p = x + return p +} + +func (x FeatureSet_Utf8Validation) String() string { + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) +} + +func (FeatureSet_Utf8Validation) Descriptor() protoreflect.EnumDescriptor { + return file_google_protobuf_descriptor_proto_enumTypes[13].Descriptor() +} + +func (FeatureSet_Utf8Validation) Type() protoreflect.EnumType { + return &file_google_protobuf_descriptor_proto_enumTypes[13] +} + +func (x FeatureSet_Utf8Validation) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Do not use. +func (x *FeatureSet_Utf8Validation) UnmarshalJSON(b []byte) error { + num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b) + if err != nil { + return err + } + *x = FeatureSet_Utf8Validation(num) + return nil +} + +// Deprecated: Use FeatureSet_Utf8Validation.Descriptor instead. +func (FeatureSet_Utf8Validation) EnumDescriptor() ([]byte, []int) { + return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19, 3} +} + +type FeatureSet_MessageEncoding int32 + +const ( + FeatureSet_MESSAGE_ENCODING_UNKNOWN FeatureSet_MessageEncoding = 0 + FeatureSet_LENGTH_PREFIXED FeatureSet_MessageEncoding = 1 + FeatureSet_DELIMITED FeatureSet_MessageEncoding = 2 +) + +// Enum value maps for FeatureSet_MessageEncoding. +var ( + FeatureSet_MessageEncoding_name = map[int32]string{ + 0: "MESSAGE_ENCODING_UNKNOWN", + 1: "LENGTH_PREFIXED", + 2: "DELIMITED", + } + FeatureSet_MessageEncoding_value = map[string]int32{ + "MESSAGE_ENCODING_UNKNOWN": 0, + "LENGTH_PREFIXED": 1, + "DELIMITED": 2, + } +) + +func (x FeatureSet_MessageEncoding) Enum() *FeatureSet_MessageEncoding { + p := new(FeatureSet_MessageEncoding) + *p = x + return p +} + +func (x FeatureSet_MessageEncoding) String() string { + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) +} + +func (FeatureSet_MessageEncoding) Descriptor() protoreflect.EnumDescriptor { + return file_google_protobuf_descriptor_proto_enumTypes[14].Descriptor() +} + +func (FeatureSet_MessageEncoding) Type() protoreflect.EnumType { + return &file_google_protobuf_descriptor_proto_enumTypes[14] +} + +func (x FeatureSet_MessageEncoding) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Do not use. +func (x *FeatureSet_MessageEncoding) UnmarshalJSON(b []byte) error { + num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b) + if err != nil { + return err + } + *x = FeatureSet_MessageEncoding(num) + return nil +} + +// Deprecated: Use FeatureSet_MessageEncoding.Descriptor instead. +func (FeatureSet_MessageEncoding) EnumDescriptor() ([]byte, []int) { + return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19, 4} +} + +type FeatureSet_JsonFormat int32 + +const ( + FeatureSet_JSON_FORMAT_UNKNOWN FeatureSet_JsonFormat = 0 + FeatureSet_ALLOW FeatureSet_JsonFormat = 1 + FeatureSet_LEGACY_BEST_EFFORT FeatureSet_JsonFormat = 2 +) + +// Enum value maps for FeatureSet_JsonFormat. +var ( + FeatureSet_JsonFormat_name = map[int32]string{ + 0: "JSON_FORMAT_UNKNOWN", + 1: "ALLOW", + 2: "LEGACY_BEST_EFFORT", + } + FeatureSet_JsonFormat_value = map[string]int32{ + "JSON_FORMAT_UNKNOWN": 0, + "ALLOW": 1, + "LEGACY_BEST_EFFORT": 2, + } +) + +func (x FeatureSet_JsonFormat) Enum() *FeatureSet_JsonFormat { + p := new(FeatureSet_JsonFormat) + *p = x + return p +} + +func (x FeatureSet_JsonFormat) String() string { + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) +} + +func (FeatureSet_JsonFormat) Descriptor() protoreflect.EnumDescriptor { + return file_google_protobuf_descriptor_proto_enumTypes[15].Descriptor() +} + +func (FeatureSet_JsonFormat) Type() protoreflect.EnumType { + return &file_google_protobuf_descriptor_proto_enumTypes[15] +} + +func (x FeatureSet_JsonFormat) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Do not use. +func (x *FeatureSet_JsonFormat) UnmarshalJSON(b []byte) error { + num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b) + if err != nil { + return err + } + *x = FeatureSet_JsonFormat(num) + return nil +} + +// Deprecated: Use FeatureSet_JsonFormat.Descriptor instead. +func (FeatureSet_JsonFormat) EnumDescriptor() ([]byte, []int) { + return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19, 5} +} + // Represents the identified object's effect on the element in the original // .proto file. type GeneratedCodeInfo_Annotation_Semantic int32 @@ -716,11 +1174,11 @@ func (x GeneratedCodeInfo_Annotation_Semantic) String() string { } func (GeneratedCodeInfo_Annotation_Semantic) Descriptor() protoreflect.EnumDescriptor { - return file_google_protobuf_descriptor_proto_enumTypes[9].Descriptor() + return file_google_protobuf_descriptor_proto_enumTypes[16].Descriptor() } func (GeneratedCodeInfo_Annotation_Semantic) Type() protoreflect.EnumType { - return &file_google_protobuf_descriptor_proto_enumTypes[9] + return &file_google_protobuf_descriptor_proto_enumTypes[16] } func (x GeneratedCodeInfo_Annotation_Semantic) Number() protoreflect.EnumNumber { @@ -739,7 +1197,7 @@ func (x *GeneratedCodeInfo_Annotation_Semantic) UnmarshalJSON(b []byte) error { // Deprecated: Use GeneratedCodeInfo_Annotation_Semantic.Descriptor instead. func (GeneratedCodeInfo_Annotation_Semantic) EnumDescriptor() ([]byte, []int) { - return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{20, 0, 0} + return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{22, 0, 0} } // The protocol compiler can output a FileDescriptorSet containing the .proto @@ -822,8 +1280,8 @@ type FileDescriptorProto struct { // // If `edition` is present, this value must be "editions". Syntax *string `protobuf:"bytes,12,opt,name=syntax" json:"syntax,omitempty"` - // The edition of the proto file, which is an opaque string. - Edition *string `protobuf:"bytes,13,opt,name=edition" json:"edition,omitempty"` + // The edition of the proto file. + Edition *Edition `protobuf:"varint,14,opt,name=edition,enum=google.protobuf.Edition" json:"edition,omitempty"` } func (x *FileDescriptorProto) Reset() { @@ -942,11 +1400,11 @@ func (x *FileDescriptorProto) GetSyntax() string { return "" } -func (x *FileDescriptorProto) GetEdition() string { +func (x *FileDescriptorProto) GetEdition() Edition { if x != nil && x.Edition != nil { return *x.Edition } - return "" + return Edition_EDITION_UNKNOWN } // Describes a message type. @@ -1079,13 +1537,14 @@ type ExtensionRangeOptions struct { // The parser stores options it doesn't recognize here. See above. UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"` - // go/protobuf-stripping-extension-declarations - // Like Metadata, but we use a repeated field to hold all extension - // declarations. This should avoid the size increases of transforming a large - // extension range into small ranges in generated binaries. + // For external users: DO NOT USE. We are in the process of open sourcing + // extension declaration and executing internal cleanups before it can be + // used externally. Declaration []*ExtensionRangeOptions_Declaration `protobuf:"bytes,2,rep,name=declaration" json:"declaration,omitempty"` + // Any features defined in the specific edition. + Features *FeatureSet `protobuf:"bytes,50,opt,name=features" json:"features,omitempty"` // The verification state of the range. - // TODO(b/278783756): flip the default to DECLARATION once all empty ranges + // TODO: flip the default to DECLARATION once all empty ranges // are marked as UNVERIFIED. Verification *ExtensionRangeOptions_VerificationState `protobuf:"varint,3,opt,name=verification,enum=google.protobuf.ExtensionRangeOptions_VerificationState,def=1" json:"verification,omitempty"` } @@ -1141,6 +1600,13 @@ func (x *ExtensionRangeOptions) GetDeclaration() []*ExtensionRangeOptions_Declar return nil } +func (x *ExtensionRangeOptions) GetFeatures() *FeatureSet { + if x != nil { + return x.Features + } + return nil +} + func (x *ExtensionRangeOptions) GetVerification() ExtensionRangeOptions_VerificationState { if x != nil && x.Verification != nil { return *x.Verification @@ -1186,12 +1652,12 @@ type FieldDescriptorProto struct { // If true, this is a proto3 "optional". When a proto3 field is optional, it // tracks presence regardless of field type. // - // When proto3_optional is true, this field must be belong to a oneof to - // signal to old proto3 clients that presence is tracked for this field. This - // oneof is known as a "synthetic" oneof, and this field must be its sole - // member (each proto3 optional field gets its own synthetic oneof). Synthetic - // oneofs exist in the descriptor only, and do not generate any API. Synthetic - // oneofs must be ordered after all "real" oneofs. + // When proto3_optional is true, this field must belong to a oneof to signal + // to old proto3 clients that presence is tracked for this field. This oneof + // is known as a "synthetic" oneof, and this field must be its sole member + // (each proto3 optional field gets its own synthetic oneof). Synthetic oneofs + // exist in the descriptor only, and do not generate any API. Synthetic oneofs + // must be ordered after all "real" oneofs. // // For message fields, proto3_optional doesn't create any semantic change, // since non-repeated message fields always track presence. However it still @@ -1738,7 +2204,6 @@ type FileOptions struct { CcGenericServices *bool `protobuf:"varint,16,opt,name=cc_generic_services,json=ccGenericServices,def=0" json:"cc_generic_services,omitempty"` JavaGenericServices *bool `protobuf:"varint,17,opt,name=java_generic_services,json=javaGenericServices,def=0" json:"java_generic_services,omitempty"` PyGenericServices *bool `protobuf:"varint,18,opt,name=py_generic_services,json=pyGenericServices,def=0" json:"py_generic_services,omitempty"` - PhpGenericServices *bool `protobuf:"varint,42,opt,name=php_generic_services,json=phpGenericServices,def=0" json:"php_generic_services,omitempty"` // Is this file deprecated? // Depending on the target platform, this can emit Deprecated annotations // for everything in the file, or it will be completely ignored; in the very @@ -1772,6 +2237,8 @@ type FileOptions struct { // is empty. When this option is not set, the package name will be used for // determining the ruby package. RubyPackage *string `protobuf:"bytes,45,opt,name=ruby_package,json=rubyPackage" json:"ruby_package,omitempty"` + // Any features defined in the specific edition. + Features *FeatureSet `protobuf:"bytes,50,opt,name=features" json:"features,omitempty"` // The parser stores options it doesn't recognize here. // See the documentation for the "Options" section above. UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"` @@ -1785,7 +2252,6 @@ const ( Default_FileOptions_CcGenericServices = bool(false) Default_FileOptions_JavaGenericServices = bool(false) Default_FileOptions_PyGenericServices = bool(false) - Default_FileOptions_PhpGenericServices = bool(false) Default_FileOptions_Deprecated = bool(false) Default_FileOptions_CcEnableArenas = bool(true) ) @@ -1893,13 +2359,6 @@ func (x *FileOptions) GetPyGenericServices() bool { return Default_FileOptions_PyGenericServices } -func (x *FileOptions) GetPhpGenericServices() bool { - if x != nil && x.PhpGenericServices != nil { - return *x.PhpGenericServices - } - return Default_FileOptions_PhpGenericServices -} - func (x *FileOptions) GetDeprecated() bool { if x != nil && x.Deprecated != nil { return *x.Deprecated @@ -1963,6 +2422,13 @@ func (x *FileOptions) GetRubyPackage() string { return "" } +func (x *FileOptions) GetFeatures() *FeatureSet { + if x != nil { + return x.Features + } + return nil +} + func (x *FileOptions) GetUninterpretedOption() []*UninterpretedOption { if x != nil { return x.UninterpretedOption @@ -2006,10 +2472,6 @@ type MessageOptions struct { // for the message, or it will be completely ignored; in the very least, // this is a formalization for deprecating messages. Deprecated *bool `protobuf:"varint,3,opt,name=deprecated,def=0" json:"deprecated,omitempty"` - // NOTE: Do not set the option in .proto files. Always use the maps syntax - // instead. The option should only be implicitly set by the proto compiler - // parser. - // // Whether the message is an automatically generated map entry type for the // maps field. // @@ -2030,6 +2492,10 @@ type MessageOptions struct { // use a native map in the target language to hold the keys and values. // The reflection APIs in such implementations still need to work as // if the field is a repeated message field. + // + // NOTE: Do not set the option in .proto files. Always use the maps syntax + // instead. The option should only be implicitly set by the proto compiler + // parser. MapEntry *bool `protobuf:"varint,7,opt,name=map_entry,json=mapEntry" json:"map_entry,omitempty"` // Enable the legacy handling of JSON field name conflicts. This lowercases // and strips underscored from the fields before comparison in proto3 only. @@ -2039,11 +2505,13 @@ type MessageOptions struct { // This should only be used as a temporary measure against broken builds due // to the change in behavior for JSON field name conflicts. // - // TODO(b/261750190) This is legacy behavior we plan to remove once downstream + // TODO This is legacy behavior we plan to remove once downstream // teams have had time to migrate. // // Deprecated: Marked as deprecated in google/protobuf/descriptor.proto. DeprecatedLegacyJsonFieldConflicts *bool `protobuf:"varint,11,opt,name=deprecated_legacy_json_field_conflicts,json=deprecatedLegacyJsonFieldConflicts" json:"deprecated_legacy_json_field_conflicts,omitempty"` + // Any features defined in the specific edition. + Features *FeatureSet `protobuf:"bytes,12,opt,name=features" json:"features,omitempty"` // The parser stores options it doesn't recognize here. See above. UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"` } @@ -2123,6 +2591,13 @@ func (x *MessageOptions) GetDeprecatedLegacyJsonFieldConflicts() bool { return false } +func (x *MessageOptions) GetFeatures() *FeatureSet { + if x != nil { + return x.Features + } + return nil +} + func (x *MessageOptions) GetUninterpretedOption() []*UninterpretedOption { if x != nil { return x.UninterpretedOption @@ -2147,7 +2622,9 @@ type FieldOptions struct { // a more efficient representation on the wire. Rather than repeatedly // writing the tag and type for each element, the entire array is encoded as // a single length-delimited blob. In proto3, only explicit setting it to - // false will avoid using packed encoding. + // false will avoid using packed encoding. This option is prohibited in + // Editions, but the `repeated_field_encoding` feature can be used to control + // the behavior. Packed *bool `protobuf:"varint,2,opt,name=packed" json:"packed,omitempty"` // The jstype option determines the JavaScript type used for values of the // field. The option is permitted only for 64 bit integral and fixed types @@ -2178,19 +2655,11 @@ type FieldOptions struct { // call from multiple threads concurrently, while non-const methods continue // to require exclusive access. // - // Note that implementations may choose not to check required fields within - // a lazy sub-message. That is, calling IsInitialized() on the outer message - // may return true even if the inner message has missing required fields. - // This is necessary because otherwise the inner message would have to be - // parsed in order to perform the check, defeating the purpose of lazy - // parsing. An implementation which chooses not to check required fields - // must be consistent about it. That is, for any particular sub-message, the - // implementation must either *always* check its required fields, or *never* - // check its required fields, regardless of whether or not the message has - // been parsed. - // - // As of May 2022, lazy verifies the contents of the byte stream during - // parsing. An invalid byte stream will cause the overall parsing to fail. + // Note that lazy message fields are still eagerly verified to check + // ill-formed wireformat or missing required fields. Calling IsInitialized() + // on the outer message would fail if the inner message has missing required + // fields. Failed verification would result in parsing failure (except when + // uninitialized messages are acceptable). Lazy *bool `protobuf:"varint,5,opt,name=lazy,def=0" json:"lazy,omitempty"` // unverified_lazy does no correctness checks on the byte stream. This should // only be used where lazy with verification is prohibitive for performance @@ -2205,11 +2674,12 @@ type FieldOptions struct { Weak *bool `protobuf:"varint,10,opt,name=weak,def=0" json:"weak,omitempty"` // Indicate that the field value should not be printed out when using debug // formats, e.g. when the field contains sensitive credentials. - DebugRedact *bool `protobuf:"varint,16,opt,name=debug_redact,json=debugRedact,def=0" json:"debug_redact,omitempty"` - Retention *FieldOptions_OptionRetention `protobuf:"varint,17,opt,name=retention,enum=google.protobuf.FieldOptions_OptionRetention" json:"retention,omitempty"` - // Deprecated: Marked as deprecated in google/protobuf/descriptor.proto. - Target *FieldOptions_OptionTargetType `protobuf:"varint,18,opt,name=target,enum=google.protobuf.FieldOptions_OptionTargetType" json:"target,omitempty"` - Targets []FieldOptions_OptionTargetType `protobuf:"varint,19,rep,name=targets,enum=google.protobuf.FieldOptions_OptionTargetType" json:"targets,omitempty"` + DebugRedact *bool `protobuf:"varint,16,opt,name=debug_redact,json=debugRedact,def=0" json:"debug_redact,omitempty"` + Retention *FieldOptions_OptionRetention `protobuf:"varint,17,opt,name=retention,enum=google.protobuf.FieldOptions_OptionRetention" json:"retention,omitempty"` + Targets []FieldOptions_OptionTargetType `protobuf:"varint,19,rep,name=targets,enum=google.protobuf.FieldOptions_OptionTargetType" json:"targets,omitempty"` + EditionDefaults []*FieldOptions_EditionDefault `protobuf:"bytes,20,rep,name=edition_defaults,json=editionDefaults" json:"edition_defaults,omitempty"` + // Any features defined in the specific edition. + Features *FeatureSet `protobuf:"bytes,21,opt,name=features" json:"features,omitempty"` // The parser stores options it doesn't recognize here. See above. UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"` } @@ -2320,17 +2790,23 @@ func (x *FieldOptions) GetRetention() FieldOptions_OptionRetention { return FieldOptions_RETENTION_UNKNOWN } -// Deprecated: Marked as deprecated in google/protobuf/descriptor.proto. -func (x *FieldOptions) GetTarget() FieldOptions_OptionTargetType { - if x != nil && x.Target != nil { - return *x.Target +func (x *FieldOptions) GetTargets() []FieldOptions_OptionTargetType { + if x != nil { + return x.Targets } - return FieldOptions_TARGET_TYPE_UNKNOWN + return nil } -func (x *FieldOptions) GetTargets() []FieldOptions_OptionTargetType { +func (x *FieldOptions) GetEditionDefaults() []*FieldOptions_EditionDefault { if x != nil { - return x.Targets + return x.EditionDefaults + } + return nil +} + +func (x *FieldOptions) GetFeatures() *FeatureSet { + if x != nil { + return x.Features } return nil } @@ -2348,6 +2824,8 @@ type OneofOptions struct { unknownFields protoimpl.UnknownFields extensionFields protoimpl.ExtensionFields + // Any features defined in the specific edition. + Features *FeatureSet `protobuf:"bytes,1,opt,name=features" json:"features,omitempty"` // The parser stores options it doesn't recognize here. See above. UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"` } @@ -2384,6 +2862,13 @@ func (*OneofOptions) Descriptor() ([]byte, []int) { return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{13} } +func (x *OneofOptions) GetFeatures() *FeatureSet { + if x != nil { + return x.Features + } + return nil +} + func (x *OneofOptions) GetUninterpretedOption() []*UninterpretedOption { if x != nil { return x.UninterpretedOption @@ -2409,11 +2894,13 @@ type EnumOptions struct { // and strips underscored from the fields before comparison in proto3 only. // The new behavior takes `json_name` into account and applies to proto2 as // well. - // TODO(b/261750190) Remove this legacy behavior once downstream teams have + // TODO Remove this legacy behavior once downstream teams have // had time to migrate. // // Deprecated: Marked as deprecated in google/protobuf/descriptor.proto. DeprecatedLegacyJsonFieldConflicts *bool `protobuf:"varint,6,opt,name=deprecated_legacy_json_field_conflicts,json=deprecatedLegacyJsonFieldConflicts" json:"deprecated_legacy_json_field_conflicts,omitempty"` + // Any features defined in the specific edition. + Features *FeatureSet `protobuf:"bytes,7,opt,name=features" json:"features,omitempty"` // The parser stores options it doesn't recognize here. See above. UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"` } @@ -2477,6 +2964,13 @@ func (x *EnumOptions) GetDeprecatedLegacyJsonFieldConflicts() bool { return false } +func (x *EnumOptions) GetFeatures() *FeatureSet { + if x != nil { + return x.Features + } + return nil +} + func (x *EnumOptions) GetUninterpretedOption() []*UninterpretedOption { if x != nil { return x.UninterpretedOption @@ -2495,13 +2989,20 @@ type EnumValueOptions struct { // for the enum value, or it will be completely ignored; in the very least, // this is a formalization for deprecating enum values. Deprecated *bool `protobuf:"varint,1,opt,name=deprecated,def=0" json:"deprecated,omitempty"` + // Any features defined in the specific edition. + Features *FeatureSet `protobuf:"bytes,2,opt,name=features" json:"features,omitempty"` + // Indicate that fields annotated with this enum value should not be printed + // out when using debug formats, e.g. when the field contains sensitive + // credentials. + DebugRedact *bool `protobuf:"varint,3,opt,name=debug_redact,json=debugRedact,def=0" json:"debug_redact,omitempty"` // The parser stores options it doesn't recognize here. See above. UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"` } // Default values for EnumValueOptions fields. const ( - Default_EnumValueOptions_Deprecated = bool(false) + Default_EnumValueOptions_Deprecated = bool(false) + Default_EnumValueOptions_DebugRedact = bool(false) ) func (x *EnumValueOptions) Reset() { @@ -2543,6 +3044,20 @@ func (x *EnumValueOptions) GetDeprecated() bool { return Default_EnumValueOptions_Deprecated } +func (x *EnumValueOptions) GetFeatures() *FeatureSet { + if x != nil { + return x.Features + } + return nil +} + +func (x *EnumValueOptions) GetDebugRedact() bool { + if x != nil && x.DebugRedact != nil { + return *x.DebugRedact + } + return Default_EnumValueOptions_DebugRedact +} + func (x *EnumValueOptions) GetUninterpretedOption() []*UninterpretedOption { if x != nil { return x.UninterpretedOption @@ -2556,6 +3071,8 @@ type ServiceOptions struct { unknownFields protoimpl.UnknownFields extensionFields protoimpl.ExtensionFields + // Any features defined in the specific edition. + Features *FeatureSet `protobuf:"bytes,34,opt,name=features" json:"features,omitempty"` // Is this service deprecated? // Depending on the target platform, this can emit Deprecated annotations // for the service, or it will be completely ignored; in the very least, @@ -2602,6 +3119,13 @@ func (*ServiceOptions) Descriptor() ([]byte, []int) { return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{16} } +func (x *ServiceOptions) GetFeatures() *FeatureSet { + if x != nil { + return x.Features + } + return nil +} + func (x *ServiceOptions) GetDeprecated() bool { if x != nil && x.Deprecated != nil { return *x.Deprecated @@ -2628,6 +3152,8 @@ type MethodOptions struct { // this is a formalization for deprecating methods. Deprecated *bool `protobuf:"varint,33,opt,name=deprecated,def=0" json:"deprecated,omitempty"` IdempotencyLevel *MethodOptions_IdempotencyLevel `protobuf:"varint,34,opt,name=idempotency_level,json=idempotencyLevel,enum=google.protobuf.MethodOptions_IdempotencyLevel,def=0" json:"idempotency_level,omitempty"` + // Any features defined in the specific edition. + Features *FeatureSet `protobuf:"bytes,35,opt,name=features" json:"features,omitempty"` // The parser stores options it doesn't recognize here. See above. UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"` } @@ -2684,6 +3210,13 @@ func (x *MethodOptions) GetIdempotencyLevel() MethodOptions_IdempotencyLevel { return Default_MethodOptions_IdempotencyLevel } +func (x *MethodOptions) GetFeatures() *FeatureSet { + if x != nil { + return x.Features + } + return nil +} + func (x *MethodOptions) GetUninterpretedOption() []*UninterpretedOption { if x != nil { return x.UninterpretedOption @@ -2770,28 +3303,193 @@ func (x *UninterpretedOption) GetNegativeIntValue() int64 { if x != nil && x.NegativeIntValue != nil { return *x.NegativeIntValue } - return 0 + return 0 +} + +func (x *UninterpretedOption) GetDoubleValue() float64 { + if x != nil && x.DoubleValue != nil { + return *x.DoubleValue + } + return 0 +} + +func (x *UninterpretedOption) GetStringValue() []byte { + if x != nil { + return x.StringValue + } + return nil +} + +func (x *UninterpretedOption) GetAggregateValue() string { + if x != nil && x.AggregateValue != nil { + return *x.AggregateValue + } + return "" +} + +// TODO Enums in C++ gencode (and potentially other languages) are +// not well scoped. This means that each of the feature enums below can clash +// with each other. The short names we've chosen maximize call-site +// readability, but leave us very open to this scenario. A future feature will +// be designed and implemented to handle this, hopefully before we ever hit a +// conflict here. +type FeatureSet struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + extensionFields protoimpl.ExtensionFields + + FieldPresence *FeatureSet_FieldPresence `protobuf:"varint,1,opt,name=field_presence,json=fieldPresence,enum=google.protobuf.FeatureSet_FieldPresence" json:"field_presence,omitempty"` + EnumType *FeatureSet_EnumType `protobuf:"varint,2,opt,name=enum_type,json=enumType,enum=google.protobuf.FeatureSet_EnumType" json:"enum_type,omitempty"` + RepeatedFieldEncoding *FeatureSet_RepeatedFieldEncoding `protobuf:"varint,3,opt,name=repeated_field_encoding,json=repeatedFieldEncoding,enum=google.protobuf.FeatureSet_RepeatedFieldEncoding" json:"repeated_field_encoding,omitempty"` + Utf8Validation *FeatureSet_Utf8Validation `protobuf:"varint,4,opt,name=utf8_validation,json=utf8Validation,enum=google.protobuf.FeatureSet_Utf8Validation" json:"utf8_validation,omitempty"` + MessageEncoding *FeatureSet_MessageEncoding `protobuf:"varint,5,opt,name=message_encoding,json=messageEncoding,enum=google.protobuf.FeatureSet_MessageEncoding" json:"message_encoding,omitempty"` + JsonFormat *FeatureSet_JsonFormat `protobuf:"varint,6,opt,name=json_format,json=jsonFormat,enum=google.protobuf.FeatureSet_JsonFormat" json:"json_format,omitempty"` +} + +func (x *FeatureSet) Reset() { + *x = FeatureSet{} + if protoimpl.UnsafeEnabled { + mi := &file_google_protobuf_descriptor_proto_msgTypes[19] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *FeatureSet) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*FeatureSet) ProtoMessage() {} + +func (x *FeatureSet) ProtoReflect() protoreflect.Message { + mi := &file_google_protobuf_descriptor_proto_msgTypes[19] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use FeatureSet.ProtoReflect.Descriptor instead. +func (*FeatureSet) Descriptor() ([]byte, []int) { + return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19} +} + +func (x *FeatureSet) GetFieldPresence() FeatureSet_FieldPresence { + if x != nil && x.FieldPresence != nil { + return *x.FieldPresence + } + return FeatureSet_FIELD_PRESENCE_UNKNOWN +} + +func (x *FeatureSet) GetEnumType() FeatureSet_EnumType { + if x != nil && x.EnumType != nil { + return *x.EnumType + } + return FeatureSet_ENUM_TYPE_UNKNOWN +} + +func (x *FeatureSet) GetRepeatedFieldEncoding() FeatureSet_RepeatedFieldEncoding { + if x != nil && x.RepeatedFieldEncoding != nil { + return *x.RepeatedFieldEncoding + } + return FeatureSet_REPEATED_FIELD_ENCODING_UNKNOWN +} + +func (x *FeatureSet) GetUtf8Validation() FeatureSet_Utf8Validation { + if x != nil && x.Utf8Validation != nil { + return *x.Utf8Validation + } + return FeatureSet_UTF8_VALIDATION_UNKNOWN +} + +func (x *FeatureSet) GetMessageEncoding() FeatureSet_MessageEncoding { + if x != nil && x.MessageEncoding != nil { + return *x.MessageEncoding + } + return FeatureSet_MESSAGE_ENCODING_UNKNOWN +} + +func (x *FeatureSet) GetJsonFormat() FeatureSet_JsonFormat { + if x != nil && x.JsonFormat != nil { + return *x.JsonFormat + } + return FeatureSet_JSON_FORMAT_UNKNOWN +} + +// A compiled specification for the defaults of a set of features. These +// messages are generated from FeatureSet extensions and can be used to seed +// feature resolution. The resolution with this object becomes a simple search +// for the closest matching edition, followed by proto merges. +type FeatureSetDefaults struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + Defaults []*FeatureSetDefaults_FeatureSetEditionDefault `protobuf:"bytes,1,rep,name=defaults" json:"defaults,omitempty"` + // The minimum supported edition (inclusive) when this was constructed. + // Editions before this will not have defaults. + MinimumEdition *Edition `protobuf:"varint,4,opt,name=minimum_edition,json=minimumEdition,enum=google.protobuf.Edition" json:"minimum_edition,omitempty"` + // The maximum known edition (inclusive) when this was constructed. Editions + // after this will not have reliable defaults. + MaximumEdition *Edition `protobuf:"varint,5,opt,name=maximum_edition,json=maximumEdition,enum=google.protobuf.Edition" json:"maximum_edition,omitempty"` +} + +func (x *FeatureSetDefaults) Reset() { + *x = FeatureSetDefaults{} + if protoimpl.UnsafeEnabled { + mi := &file_google_protobuf_descriptor_proto_msgTypes[20] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *FeatureSetDefaults) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*FeatureSetDefaults) ProtoMessage() {} + +func (x *FeatureSetDefaults) ProtoReflect() protoreflect.Message { + mi := &file_google_protobuf_descriptor_proto_msgTypes[20] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) } -func (x *UninterpretedOption) GetDoubleValue() float64 { - if x != nil && x.DoubleValue != nil { - return *x.DoubleValue - } - return 0 +// Deprecated: Use FeatureSetDefaults.ProtoReflect.Descriptor instead. +func (*FeatureSetDefaults) Descriptor() ([]byte, []int) { + return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{20} } -func (x *UninterpretedOption) GetStringValue() []byte { +func (x *FeatureSetDefaults) GetDefaults() []*FeatureSetDefaults_FeatureSetEditionDefault { if x != nil { - return x.StringValue + return x.Defaults } return nil } -func (x *UninterpretedOption) GetAggregateValue() string { - if x != nil && x.AggregateValue != nil { - return *x.AggregateValue +func (x *FeatureSetDefaults) GetMinimumEdition() Edition { + if x != nil && x.MinimumEdition != nil { + return *x.MinimumEdition } - return "" + return Edition_EDITION_UNKNOWN +} + +func (x *FeatureSetDefaults) GetMaximumEdition() Edition { + if x != nil && x.MaximumEdition != nil { + return *x.MaximumEdition + } + return Edition_EDITION_UNKNOWN } // Encapsulates information about the original source file from which a @@ -2855,7 +3553,7 @@ type SourceCodeInfo struct { func (x *SourceCodeInfo) Reset() { *x = SourceCodeInfo{} if protoimpl.UnsafeEnabled { - mi := &file_google_protobuf_descriptor_proto_msgTypes[19] + mi := &file_google_protobuf_descriptor_proto_msgTypes[21] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -2868,7 +3566,7 @@ func (x *SourceCodeInfo) String() string { func (*SourceCodeInfo) ProtoMessage() {} func (x *SourceCodeInfo) ProtoReflect() protoreflect.Message { - mi := &file_google_protobuf_descriptor_proto_msgTypes[19] + mi := &file_google_protobuf_descriptor_proto_msgTypes[21] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -2881,7 +3579,7 @@ func (x *SourceCodeInfo) ProtoReflect() protoreflect.Message { // Deprecated: Use SourceCodeInfo.ProtoReflect.Descriptor instead. func (*SourceCodeInfo) Descriptor() ([]byte, []int) { - return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19} + return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{21} } func (x *SourceCodeInfo) GetLocation() []*SourceCodeInfo_Location { @@ -2907,7 +3605,7 @@ type GeneratedCodeInfo struct { func (x *GeneratedCodeInfo) Reset() { *x = GeneratedCodeInfo{} if protoimpl.UnsafeEnabled { - mi := &file_google_protobuf_descriptor_proto_msgTypes[20] + mi := &file_google_protobuf_descriptor_proto_msgTypes[22] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -2920,7 +3618,7 @@ func (x *GeneratedCodeInfo) String() string { func (*GeneratedCodeInfo) ProtoMessage() {} func (x *GeneratedCodeInfo) ProtoReflect() protoreflect.Message { - mi := &file_google_protobuf_descriptor_proto_msgTypes[20] + mi := &file_google_protobuf_descriptor_proto_msgTypes[22] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -2933,7 +3631,7 @@ func (x *GeneratedCodeInfo) ProtoReflect() protoreflect.Message { // Deprecated: Use GeneratedCodeInfo.ProtoReflect.Descriptor instead. func (*GeneratedCodeInfo) Descriptor() ([]byte, []int) { - return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{20} + return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{22} } func (x *GeneratedCodeInfo) GetAnnotation() []*GeneratedCodeInfo_Annotation { @@ -2956,7 +3654,7 @@ type DescriptorProto_ExtensionRange struct { func (x *DescriptorProto_ExtensionRange) Reset() { *x = DescriptorProto_ExtensionRange{} if protoimpl.UnsafeEnabled { - mi := &file_google_protobuf_descriptor_proto_msgTypes[21] + mi := &file_google_protobuf_descriptor_proto_msgTypes[23] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -2969,7 +3667,7 @@ func (x *DescriptorProto_ExtensionRange) String() string { func (*DescriptorProto_ExtensionRange) ProtoMessage() {} func (x *DescriptorProto_ExtensionRange) ProtoReflect() protoreflect.Message { - mi := &file_google_protobuf_descriptor_proto_msgTypes[21] + mi := &file_google_protobuf_descriptor_proto_msgTypes[23] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -3021,7 +3719,7 @@ type DescriptorProto_ReservedRange struct { func (x *DescriptorProto_ReservedRange) Reset() { *x = DescriptorProto_ReservedRange{} if protoimpl.UnsafeEnabled { - mi := &file_google_protobuf_descriptor_proto_msgTypes[22] + mi := &file_google_protobuf_descriptor_proto_msgTypes[24] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -3034,7 +3732,7 @@ func (x *DescriptorProto_ReservedRange) String() string { func (*DescriptorProto_ReservedRange) ProtoMessage() {} func (x *DescriptorProto_ReservedRange) ProtoReflect() protoreflect.Message { - mi := &file_google_protobuf_descriptor_proto_msgTypes[22] + mi := &file_google_protobuf_descriptor_proto_msgTypes[24] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -3078,10 +3776,6 @@ type ExtensionRangeOptions_Declaration struct { // Metadata.type, Declaration.type must have a leading dot for messages // and enums. Type *string `protobuf:"bytes,3,opt,name=type" json:"type,omitempty"` - // Deprecated. Please use "repeated". - // - // Deprecated: Marked as deprecated in google/protobuf/descriptor.proto. - IsRepeated *bool `protobuf:"varint,4,opt,name=is_repeated,json=isRepeated" json:"is_repeated,omitempty"` // If true, indicates that the number is reserved in the extension range, // and any extension field with the number will fail to compile. Set this // when a declared extension field is deleted. @@ -3094,7 +3788,7 @@ type ExtensionRangeOptions_Declaration struct { func (x *ExtensionRangeOptions_Declaration) Reset() { *x = ExtensionRangeOptions_Declaration{} if protoimpl.UnsafeEnabled { - mi := &file_google_protobuf_descriptor_proto_msgTypes[23] + mi := &file_google_protobuf_descriptor_proto_msgTypes[25] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -3107,7 +3801,7 @@ func (x *ExtensionRangeOptions_Declaration) String() string { func (*ExtensionRangeOptions_Declaration) ProtoMessage() {} func (x *ExtensionRangeOptions_Declaration) ProtoReflect() protoreflect.Message { - mi := &file_google_protobuf_descriptor_proto_msgTypes[23] + mi := &file_google_protobuf_descriptor_proto_msgTypes[25] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -3144,14 +3838,6 @@ func (x *ExtensionRangeOptions_Declaration) GetType() string { return "" } -// Deprecated: Marked as deprecated in google/protobuf/descriptor.proto. -func (x *ExtensionRangeOptions_Declaration) GetIsRepeated() bool { - if x != nil && x.IsRepeated != nil { - return *x.IsRepeated - } - return false -} - func (x *ExtensionRangeOptions_Declaration) GetReserved() bool { if x != nil && x.Reserved != nil { return *x.Reserved @@ -3184,7 +3870,7 @@ type EnumDescriptorProto_EnumReservedRange struct { func (x *EnumDescriptorProto_EnumReservedRange) Reset() { *x = EnumDescriptorProto_EnumReservedRange{} if protoimpl.UnsafeEnabled { - mi := &file_google_protobuf_descriptor_proto_msgTypes[24] + mi := &file_google_protobuf_descriptor_proto_msgTypes[26] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -3197,7 +3883,7 @@ func (x *EnumDescriptorProto_EnumReservedRange) String() string { func (*EnumDescriptorProto_EnumReservedRange) ProtoMessage() {} func (x *EnumDescriptorProto_EnumReservedRange) ProtoReflect() protoreflect.Message { - mi := &file_google_protobuf_descriptor_proto_msgTypes[24] + mi := &file_google_protobuf_descriptor_proto_msgTypes[26] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -3227,6 +3913,61 @@ func (x *EnumDescriptorProto_EnumReservedRange) GetEnd() int32 { return 0 } +type FieldOptions_EditionDefault struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + Edition *Edition `protobuf:"varint,3,opt,name=edition,enum=google.protobuf.Edition" json:"edition,omitempty"` + Value *string `protobuf:"bytes,2,opt,name=value" json:"value,omitempty"` // Textproto value. +} + +func (x *FieldOptions_EditionDefault) Reset() { + *x = FieldOptions_EditionDefault{} + if protoimpl.UnsafeEnabled { + mi := &file_google_protobuf_descriptor_proto_msgTypes[27] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *FieldOptions_EditionDefault) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*FieldOptions_EditionDefault) ProtoMessage() {} + +func (x *FieldOptions_EditionDefault) ProtoReflect() protoreflect.Message { + mi := &file_google_protobuf_descriptor_proto_msgTypes[27] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use FieldOptions_EditionDefault.ProtoReflect.Descriptor instead. +func (*FieldOptions_EditionDefault) Descriptor() ([]byte, []int) { + return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{12, 0} +} + +func (x *FieldOptions_EditionDefault) GetEdition() Edition { + if x != nil && x.Edition != nil { + return *x.Edition + } + return Edition_EDITION_UNKNOWN +} + +func (x *FieldOptions_EditionDefault) GetValue() string { + if x != nil && x.Value != nil { + return *x.Value + } + return "" +} + // The name of the uninterpreted option. Each string represents a segment in // a dot-separated name. is_extension is true iff a segment represents an // extension (denoted with parentheses in options specs in .proto files). @@ -3244,7 +3985,7 @@ type UninterpretedOption_NamePart struct { func (x *UninterpretedOption_NamePart) Reset() { *x = UninterpretedOption_NamePart{} if protoimpl.UnsafeEnabled { - mi := &file_google_protobuf_descriptor_proto_msgTypes[25] + mi := &file_google_protobuf_descriptor_proto_msgTypes[28] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -3257,7 +3998,7 @@ func (x *UninterpretedOption_NamePart) String() string { func (*UninterpretedOption_NamePart) ProtoMessage() {} func (x *UninterpretedOption_NamePart) ProtoReflect() protoreflect.Message { - mi := &file_google_protobuf_descriptor_proto_msgTypes[25] + mi := &file_google_protobuf_descriptor_proto_msgTypes[28] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -3287,6 +4028,65 @@ func (x *UninterpretedOption_NamePart) GetIsExtension() bool { return false } +// A map from every known edition with a unique set of defaults to its +// defaults. Not all editions may be contained here. For a given edition, +// the defaults at the closest matching edition ordered at or before it should +// be used. This field must be in strict ascending order by edition. +type FeatureSetDefaults_FeatureSetEditionDefault struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + Edition *Edition `protobuf:"varint,3,opt,name=edition,enum=google.protobuf.Edition" json:"edition,omitempty"` + Features *FeatureSet `protobuf:"bytes,2,opt,name=features" json:"features,omitempty"` +} + +func (x *FeatureSetDefaults_FeatureSetEditionDefault) Reset() { + *x = FeatureSetDefaults_FeatureSetEditionDefault{} + if protoimpl.UnsafeEnabled { + mi := &file_google_protobuf_descriptor_proto_msgTypes[29] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *FeatureSetDefaults_FeatureSetEditionDefault) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*FeatureSetDefaults_FeatureSetEditionDefault) ProtoMessage() {} + +func (x *FeatureSetDefaults_FeatureSetEditionDefault) ProtoReflect() protoreflect.Message { + mi := &file_google_protobuf_descriptor_proto_msgTypes[29] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use FeatureSetDefaults_FeatureSetEditionDefault.ProtoReflect.Descriptor instead. +func (*FeatureSetDefaults_FeatureSetEditionDefault) Descriptor() ([]byte, []int) { + return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{20, 0} +} + +func (x *FeatureSetDefaults_FeatureSetEditionDefault) GetEdition() Edition { + if x != nil && x.Edition != nil { + return *x.Edition + } + return Edition_EDITION_UNKNOWN +} + +func (x *FeatureSetDefaults_FeatureSetEditionDefault) GetFeatures() *FeatureSet { + if x != nil { + return x.Features + } + return nil +} + type SourceCodeInfo_Location struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -3296,7 +4096,7 @@ type SourceCodeInfo_Location struct { // location. // // Each element is a field number or an index. They form a path from - // the root FileDescriptorProto to the place where the definition occurs. + // the root FileDescriptorProto to the place where the definition appears. // For example, this path: // // [ 4, 3, 2, 7, 1 ] @@ -3388,7 +4188,7 @@ type SourceCodeInfo_Location struct { func (x *SourceCodeInfo_Location) Reset() { *x = SourceCodeInfo_Location{} if protoimpl.UnsafeEnabled { - mi := &file_google_protobuf_descriptor_proto_msgTypes[26] + mi := &file_google_protobuf_descriptor_proto_msgTypes[30] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -3401,7 +4201,7 @@ func (x *SourceCodeInfo_Location) String() string { func (*SourceCodeInfo_Location) ProtoMessage() {} func (x *SourceCodeInfo_Location) ProtoReflect() protoreflect.Message { - mi := &file_google_protobuf_descriptor_proto_msgTypes[26] + mi := &file_google_protobuf_descriptor_proto_msgTypes[30] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -3414,7 +4214,7 @@ func (x *SourceCodeInfo_Location) ProtoReflect() protoreflect.Message { // Deprecated: Use SourceCodeInfo_Location.ProtoReflect.Descriptor instead. func (*SourceCodeInfo_Location) Descriptor() ([]byte, []int) { - return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19, 0} + return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{21, 0} } func (x *SourceCodeInfo_Location) GetPath() []int32 { @@ -3475,7 +4275,7 @@ type GeneratedCodeInfo_Annotation struct { func (x *GeneratedCodeInfo_Annotation) Reset() { *x = GeneratedCodeInfo_Annotation{} if protoimpl.UnsafeEnabled { - mi := &file_google_protobuf_descriptor_proto_msgTypes[27] + mi := &file_google_protobuf_descriptor_proto_msgTypes[31] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -3488,7 +4288,7 @@ func (x *GeneratedCodeInfo_Annotation) String() string { func (*GeneratedCodeInfo_Annotation) ProtoMessage() {} func (x *GeneratedCodeInfo_Annotation) ProtoReflect() protoreflect.Message { - mi := &file_google_protobuf_descriptor_proto_msgTypes[27] + mi := &file_google_protobuf_descriptor_proto_msgTypes[31] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -3501,7 +4301,7 @@ func (x *GeneratedCodeInfo_Annotation) ProtoReflect() protoreflect.Message { // Deprecated: Use GeneratedCodeInfo_Annotation.ProtoReflect.Descriptor instead. func (*GeneratedCodeInfo_Annotation) Descriptor() ([]byte, []int) { - return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{20, 0} + return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{22, 0} } func (x *GeneratedCodeInfo_Annotation) GetPath() []int32 { @@ -3550,7 +4350,7 @@ var file_google_protobuf_descriptor_proto_rawDesc = []byte{ 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x6c, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x04, 0x66, 0x69, - 0x6c, 0x65, 0x22, 0xfe, 0x04, 0x0a, 0x13, 0x46, 0x69, 0x6c, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, + 0x6c, 0x65, 0x22, 0x98, 0x05, 0x0a, 0x13, 0x46, 0x69, 0x6c, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x18, 0x0a, 0x07, 0x70, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, @@ -3588,250 +4388,250 @@ var file_google_protobuf_descriptor_proto_rawDesc = []byte{ 0x75, 0x66, 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x52, 0x0e, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x16, 0x0a, 0x06, 0x73, 0x79, 0x6e, 0x74, 0x61, 0x78, 0x18, 0x0c, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x06, 0x73, 0x79, 0x6e, 0x74, 0x61, 0x78, 0x12, 0x18, 0x0a, 0x07, 0x65, 0x64, 0x69, - 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x0d, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x65, 0x64, 0x69, 0x74, - 0x69, 0x6f, 0x6e, 0x22, 0xb9, 0x06, 0x0a, 0x0f, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, - 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3b, 0x0a, 0x05, 0x66, - 0x69, 0x65, 0x6c, 0x64, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, - 0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, - 0x6f, 0x52, 0x05, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x12, 0x43, 0x0a, 0x09, 0x65, 0x78, 0x74, 0x65, - 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x06, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, - 0x65, 0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, - 0x74, 0x6f, 0x52, 0x09, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x41, 0x0a, - 0x0b, 0x6e, 0x65, 0x73, 0x74, 0x65, 0x64, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x03, 0x20, 0x03, - 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, - 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x0a, 0x6e, 0x65, 0x73, 0x74, 0x65, 0x64, 0x54, 0x79, 0x70, 0x65, - 0x12, 0x41, 0x0a, 0x09, 0x65, 0x6e, 0x75, 0x6d, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x04, 0x20, - 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, - 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x08, 0x65, 0x6e, 0x75, 0x6d, 0x54, - 0x79, 0x70, 0x65, 0x12, 0x58, 0x0a, 0x0f, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, - 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18, 0x05, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, + 0x09, 0x52, 0x06, 0x73, 0x79, 0x6e, 0x74, 0x61, 0x78, 0x12, 0x32, 0x0a, 0x07, 0x65, 0x64, 0x69, + 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x0e, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, + 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x07, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0xb9, 0x06, + 0x0a, 0x0f, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, + 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3b, 0x0a, 0x05, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x18, 0x02, + 0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, + 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x05, 0x66, 0x69, 0x65, + 0x6c, 0x64, 0x12, 0x43, 0x0a, 0x09, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x18, + 0x06, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, + 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x44, 0x65, 0x73, + 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x09, 0x65, 0x78, + 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x41, 0x0a, 0x0b, 0x6e, 0x65, 0x73, 0x74, 0x65, + 0x64, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, - 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x45, - 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x52, 0x0e, 0x65, - 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x44, 0x0a, - 0x0a, 0x6f, 0x6e, 0x65, 0x6f, 0x66, 0x5f, 0x64, 0x65, 0x63, 0x6c, 0x18, 0x08, 0x20, 0x03, 0x28, - 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2e, 0x4f, 0x6e, 0x65, 0x6f, 0x66, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, - 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x09, 0x6f, 0x6e, 0x65, 0x6f, 0x66, 0x44, - 0x65, 0x63, 0x6c, 0x12, 0x39, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x07, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x4f, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x55, - 0x0a, 0x0e, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, - 0x18, 0x09, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x0a, + 0x6e, 0x65, 0x73, 0x74, 0x65, 0x64, 0x54, 0x79, 0x70, 0x65, 0x12, 0x41, 0x0a, 0x09, 0x65, 0x6e, + 0x75, 0x6d, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, + 0x45, 0x6e, 0x75, 0x6d, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, + 0x6f, 0x74, 0x6f, 0x52, 0x08, 0x65, 0x6e, 0x75, 0x6d, 0x54, 0x79, 0x70, 0x65, 0x12, 0x58, 0x0a, + 0x0f, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, + 0x18, 0x05, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, - 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x52, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, + 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, + 0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x52, 0x0e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, + 0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x44, 0x0a, 0x0a, 0x6f, 0x6e, 0x65, 0x6f, 0x66, + 0x5f, 0x64, 0x65, 0x63, 0x6c, 0x18, 0x08, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4f, 0x6e, + 0x65, 0x6f, 0x66, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, + 0x74, 0x6f, 0x52, 0x09, 0x6f, 0x6e, 0x65, 0x6f, 0x66, 0x44, 0x65, 0x63, 0x6c, 0x12, 0x39, 0x0a, + 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, + 0x2e, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, + 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x55, 0x0a, 0x0e, 0x72, 0x65, 0x73, 0x65, + 0x72, 0x76, 0x65, 0x64, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18, 0x09, 0x20, 0x03, 0x28, 0x0b, + 0x32, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2e, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, + 0x74, 0x6f, 0x2e, 0x52, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, + 0x52, 0x0d, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, + 0x23, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x5f, 0x6e, 0x61, 0x6d, 0x65, + 0x18, 0x0a, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, + 0x4e, 0x61, 0x6d, 0x65, 0x1a, 0x7a, 0x0a, 0x0e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, + 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x12, 0x10, 0x0a, 0x03, + 0x65, 0x6e, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x03, 0x65, 0x6e, 0x64, 0x12, 0x40, + 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, + 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, + 0x1a, 0x37, 0x0a, 0x0d, 0x52, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, 0x61, 0x6e, 0x67, + 0x65, 0x12, 0x14, 0x0a, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, + 0x52, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x12, 0x10, 0x0a, 0x03, 0x65, 0x6e, 0x64, 0x18, 0x02, + 0x20, 0x01, 0x28, 0x05, 0x52, 0x03, 0x65, 0x6e, 0x64, 0x22, 0xcc, 0x04, 0x0a, 0x15, 0x45, 0x78, + 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, + 0x6f, 0x6e, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, + 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, + 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, + 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, + 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x59, 0x0a, + 0x0b, 0x64, 0x65, 0x63, 0x6c, 0x61, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x03, + 0x28, 0x0b, 0x32, 0x32, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x61, + 0x6e, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x44, 0x65, 0x63, 0x6c, 0x61, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x03, 0x88, 0x01, 0x02, 0x52, 0x0b, 0x64, 0x65, 0x63, + 0x6c, 0x61, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, + 0x75, 0x72, 0x65, 0x73, 0x18, 0x32, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, + 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, + 0x73, 0x12, 0x6d, 0x0a, 0x0c, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x38, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, + 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, + 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x74, 0x61, 0x74, + 0x65, 0x3a, 0x0a, 0x55, 0x4e, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49, 0x45, 0x44, 0x42, 0x03, 0x88, + 0x01, 0x02, 0x52, 0x0c, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x1a, 0x94, 0x01, 0x0a, 0x0b, 0x44, 0x65, 0x63, 0x6c, 0x61, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x12, 0x16, 0x0a, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, + 0x52, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x12, 0x1b, 0x0a, 0x09, 0x66, 0x75, 0x6c, 0x6c, + 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x66, 0x75, 0x6c, + 0x6c, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x12, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x03, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x1a, 0x0a, 0x08, 0x72, 0x65, 0x73, + 0x65, 0x72, 0x76, 0x65, 0x64, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x72, 0x65, 0x73, + 0x65, 0x72, 0x76, 0x65, 0x64, 0x12, 0x1a, 0x0a, 0x08, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, + 0x64, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, + 0x64, 0x4a, 0x04, 0x08, 0x04, 0x10, 0x05, 0x22, 0x34, 0x0a, 0x11, 0x56, 0x65, 0x72, 0x69, 0x66, + 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x74, 0x61, 0x74, 0x65, 0x12, 0x0f, 0x0a, 0x0b, + 0x44, 0x45, 0x43, 0x4c, 0x41, 0x52, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x10, 0x00, 0x12, 0x0e, 0x0a, + 0x0a, 0x55, 0x4e, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x01, 0x2a, 0x09, 0x08, + 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, 0xc1, 0x06, 0x0a, 0x14, 0x46, 0x69, 0x65, + 0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, + 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x18, + 0x03, 0x20, 0x01, 0x28, 0x05, 0x52, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x12, 0x41, 0x0a, + 0x05, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2b, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, + 0x69, 0x65, 0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, + 0x6f, 0x74, 0x6f, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x52, 0x05, 0x6c, 0x61, 0x62, 0x65, 0x6c, + 0x12, 0x3e, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2a, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, + 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, + 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, + 0x12, 0x1b, 0x0a, 0x09, 0x74, 0x79, 0x70, 0x65, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x06, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x08, 0x74, 0x79, 0x70, 0x65, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x1a, 0x0a, + 0x08, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x64, 0x65, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x08, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x64, 0x65, 0x65, 0x12, 0x23, 0x0a, 0x0d, 0x64, 0x65, 0x66, + 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, + 0x52, 0x0c, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x1f, + 0x0a, 0x0b, 0x6f, 0x6e, 0x65, 0x6f, 0x66, 0x5f, 0x69, 0x6e, 0x64, 0x65, 0x78, 0x18, 0x09, 0x20, + 0x01, 0x28, 0x05, 0x52, 0x0a, 0x6f, 0x6e, 0x65, 0x6f, 0x66, 0x49, 0x6e, 0x64, 0x65, 0x78, 0x12, + 0x1b, 0x0a, 0x09, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x0a, 0x20, 0x01, + 0x28, 0x09, 0x52, 0x08, 0x6a, 0x73, 0x6f, 0x6e, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x37, 0x0a, 0x07, + 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, + 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, + 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x27, 0x0a, 0x0f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, 0x5f, + 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x18, 0x11, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0e, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x22, 0xb6, + 0x02, 0x0a, 0x04, 0x54, 0x79, 0x70, 0x65, 0x12, 0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, + 0x44, 0x4f, 0x55, 0x42, 0x4c, 0x45, 0x10, 0x01, 0x12, 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, + 0x5f, 0x46, 0x4c, 0x4f, 0x41, 0x54, 0x10, 0x02, 0x12, 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, + 0x5f, 0x49, 0x4e, 0x54, 0x36, 0x34, 0x10, 0x03, 0x12, 0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, + 0x5f, 0x55, 0x49, 0x4e, 0x54, 0x36, 0x34, 0x10, 0x04, 0x12, 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, + 0x45, 0x5f, 0x49, 0x4e, 0x54, 0x33, 0x32, 0x10, 0x05, 0x12, 0x10, 0x0a, 0x0c, 0x54, 0x59, 0x50, + 0x45, 0x5f, 0x46, 0x49, 0x58, 0x45, 0x44, 0x36, 0x34, 0x10, 0x06, 0x12, 0x10, 0x0a, 0x0c, 0x54, + 0x59, 0x50, 0x45, 0x5f, 0x46, 0x49, 0x58, 0x45, 0x44, 0x33, 0x32, 0x10, 0x07, 0x12, 0x0d, 0x0a, + 0x09, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x42, 0x4f, 0x4f, 0x4c, 0x10, 0x08, 0x12, 0x0f, 0x0a, 0x0b, + 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x09, 0x12, 0x0e, 0x0a, + 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x47, 0x52, 0x4f, 0x55, 0x50, 0x10, 0x0a, 0x12, 0x10, 0x0a, + 0x0c, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4d, 0x45, 0x53, 0x53, 0x41, 0x47, 0x45, 0x10, 0x0b, 0x12, + 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x42, 0x59, 0x54, 0x45, 0x53, 0x10, 0x0c, 0x12, + 0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x49, 0x4e, 0x54, 0x33, 0x32, 0x10, 0x0d, + 0x12, 0x0d, 0x0a, 0x09, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x45, 0x4e, 0x55, 0x4d, 0x10, 0x0e, 0x12, + 0x11, 0x0a, 0x0d, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x46, 0x49, 0x58, 0x45, 0x44, 0x33, 0x32, + 0x10, 0x0f, 0x12, 0x11, 0x0a, 0x0d, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x46, 0x49, 0x58, 0x45, + 0x44, 0x36, 0x34, 0x10, 0x10, 0x12, 0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x49, + 0x4e, 0x54, 0x33, 0x32, 0x10, 0x11, 0x12, 0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, + 0x49, 0x4e, 0x54, 0x36, 0x34, 0x10, 0x12, 0x22, 0x43, 0x0a, 0x05, 0x4c, 0x61, 0x62, 0x65, 0x6c, + 0x12, 0x12, 0x0a, 0x0e, 0x4c, 0x41, 0x42, 0x45, 0x4c, 0x5f, 0x4f, 0x50, 0x54, 0x49, 0x4f, 0x4e, + 0x41, 0x4c, 0x10, 0x01, 0x12, 0x12, 0x0a, 0x0e, 0x4c, 0x41, 0x42, 0x45, 0x4c, 0x5f, 0x52, 0x45, + 0x50, 0x45, 0x41, 0x54, 0x45, 0x44, 0x10, 0x03, 0x12, 0x12, 0x0a, 0x0e, 0x4c, 0x41, 0x42, 0x45, + 0x4c, 0x5f, 0x52, 0x45, 0x51, 0x55, 0x49, 0x52, 0x45, 0x44, 0x10, 0x02, 0x22, 0x63, 0x0a, 0x14, + 0x4f, 0x6e, 0x65, 0x6f, 0x66, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, + 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x37, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, + 0x6f, 0x6e, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4f, 0x6e, 0x65, 0x6f, + 0x66, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, + 0x73, 0x22, 0xe3, 0x02, 0x0a, 0x13, 0x45, 0x6e, 0x75, 0x6d, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, + 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, + 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3f, 0x0a, + 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, + 0x6e, 0x75, 0x6d, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x36, + 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, + 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x5d, 0x0a, 0x0e, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, + 0x65, 0x64, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x36, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, + 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, + 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x52, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x52, 0x0d, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x23, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, - 0x64, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x0a, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, - 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x4e, 0x61, 0x6d, 0x65, 0x1a, 0x7a, 0x0a, 0x0e, 0x45, 0x78, - 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x14, 0x0a, 0x05, - 0x73, 0x74, 0x61, 0x72, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05, 0x73, 0x74, 0x61, - 0x72, 0x74, 0x12, 0x10, 0x0a, 0x03, 0x65, 0x6e, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, - 0x03, 0x65, 0x6e, 0x64, 0x12, 0x40, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, - 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, - 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x1a, 0x37, 0x0a, 0x0d, 0x52, 0x65, 0x73, 0x65, 0x72, 0x76, - 0x65, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x12, 0x10, 0x0a, - 0x03, 0x65, 0x6e, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x03, 0x65, 0x6e, 0x64, 0x22, - 0xad, 0x04, 0x0a, 0x15, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x6e, - 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, - 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, - 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, - 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x12, 0x59, 0x0a, 0x0b, 0x64, 0x65, 0x63, 0x6c, 0x61, 0x72, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x32, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x6e, - 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0x2e, 0x44, 0x65, 0x63, 0x6c, 0x61, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x03, 0x88, 0x01, - 0x02, 0x52, 0x0b, 0x64, 0x65, 0x63, 0x6c, 0x61, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x68, - 0x0a, 0x0c, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, - 0x20, 0x01, 0x28, 0x0e, 0x32, 0x38, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, - 0x52, 0x61, 0x6e, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x56, 0x65, 0x72, - 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x74, 0x61, 0x74, 0x65, 0x3a, 0x0a, - 0x55, 0x4e, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49, 0x45, 0x44, 0x52, 0x0c, 0x76, 0x65, 0x72, 0x69, - 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xb3, 0x01, 0x0a, 0x0b, 0x44, 0x65, 0x63, - 0x6c, 0x61, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x16, 0x0a, 0x06, 0x6e, 0x75, 0x6d, 0x62, - 0x65, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, - 0x12, 0x1b, 0x0a, 0x09, 0x66, 0x75, 0x6c, 0x6c, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x08, 0x66, 0x75, 0x6c, 0x6c, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x12, 0x0a, - 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, - 0x65, 0x12, 0x23, 0x0a, 0x0b, 0x69, 0x73, 0x5f, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, - 0x18, 0x04, 0x20, 0x01, 0x28, 0x08, 0x42, 0x02, 0x18, 0x01, 0x52, 0x0a, 0x69, 0x73, 0x52, 0x65, - 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x12, 0x1a, 0x0a, 0x08, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, - 0x65, 0x64, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, - 0x65, 0x64, 0x12, 0x1a, 0x0a, 0x08, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x18, 0x06, - 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x22, 0x34, - 0x0a, 0x11, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x74, - 0x61, 0x74, 0x65, 0x12, 0x0f, 0x0a, 0x0b, 0x44, 0x45, 0x43, 0x4c, 0x41, 0x52, 0x41, 0x54, 0x49, - 0x4f, 0x4e, 0x10, 0x00, 0x12, 0x0e, 0x0a, 0x0a, 0x55, 0x4e, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49, - 0x45, 0x44, 0x10, 0x01, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, - 0xc1, 0x06, 0x0a, 0x14, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, - 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x16, 0x0a, 0x06, - 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x18, 0x03, 0x20, 0x01, 0x28, 0x05, 0x52, 0x06, 0x6e, 0x75, - 0x6d, 0x62, 0x65, 0x72, 0x12, 0x41, 0x0a, 0x05, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x18, 0x04, 0x20, - 0x01, 0x28, 0x0e, 0x32, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, - 0x52, 0x05, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x12, 0x3e, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, - 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x44, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x54, 0x79, 0x70, - 0x65, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x1b, 0x0a, 0x09, 0x74, 0x79, 0x70, 0x65, 0x5f, - 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x74, 0x79, 0x70, 0x65, - 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x1a, 0x0a, 0x08, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x64, 0x65, 0x65, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x64, 0x65, 0x65, - 0x12, 0x23, 0x0a, 0x0d, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, - 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x1f, 0x0a, 0x0b, 0x6f, 0x6e, 0x65, 0x6f, 0x66, 0x5f, 0x69, - 0x6e, 0x64, 0x65, 0x78, 0x18, 0x09, 0x20, 0x01, 0x28, 0x05, 0x52, 0x0a, 0x6f, 0x6e, 0x65, 0x6f, - 0x66, 0x49, 0x6e, 0x64, 0x65, 0x78, 0x12, 0x1b, 0x0a, 0x09, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x6e, - 0x61, 0x6d, 0x65, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x6a, 0x73, 0x6f, 0x6e, 0x4e, - 0x61, 0x6d, 0x65, 0x12, 0x37, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x08, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, - 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x27, 0x0a, 0x0f, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x18, - 0x11, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x22, 0xb6, 0x02, 0x0a, 0x04, 0x54, 0x79, 0x70, 0x65, 0x12, 0x0f, - 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x44, 0x4f, 0x55, 0x42, 0x4c, 0x45, 0x10, 0x01, 0x12, - 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x46, 0x4c, 0x4f, 0x41, 0x54, 0x10, 0x02, 0x12, - 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x49, 0x4e, 0x54, 0x36, 0x34, 0x10, 0x03, 0x12, - 0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x49, 0x4e, 0x54, 0x36, 0x34, 0x10, 0x04, - 0x12, 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x49, 0x4e, 0x54, 0x33, 0x32, 0x10, 0x05, - 0x12, 0x10, 0x0a, 0x0c, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x46, 0x49, 0x58, 0x45, 0x44, 0x36, 0x34, - 0x10, 0x06, 0x12, 0x10, 0x0a, 0x0c, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x46, 0x49, 0x58, 0x45, 0x44, - 0x33, 0x32, 0x10, 0x07, 0x12, 0x0d, 0x0a, 0x09, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x42, 0x4f, 0x4f, - 0x4c, 0x10, 0x08, 0x12, 0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x54, 0x52, 0x49, - 0x4e, 0x47, 0x10, 0x09, 0x12, 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x47, 0x52, 0x4f, - 0x55, 0x50, 0x10, 0x0a, 0x12, 0x10, 0x0a, 0x0c, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4d, 0x45, 0x53, - 0x53, 0x41, 0x47, 0x45, 0x10, 0x0b, 0x12, 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x42, - 0x59, 0x54, 0x45, 0x53, 0x10, 0x0c, 0x12, 0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, - 0x49, 0x4e, 0x54, 0x33, 0x32, 0x10, 0x0d, 0x12, 0x0d, 0x0a, 0x09, 0x54, 0x59, 0x50, 0x45, 0x5f, - 0x45, 0x4e, 0x55, 0x4d, 0x10, 0x0e, 0x12, 0x11, 0x0a, 0x0d, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, - 0x46, 0x49, 0x58, 0x45, 0x44, 0x33, 0x32, 0x10, 0x0f, 0x12, 0x11, 0x0a, 0x0d, 0x54, 0x59, 0x50, - 0x45, 0x5f, 0x53, 0x46, 0x49, 0x58, 0x45, 0x44, 0x36, 0x34, 0x10, 0x10, 0x12, 0x0f, 0x0a, 0x0b, - 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x49, 0x4e, 0x54, 0x33, 0x32, 0x10, 0x11, 0x12, 0x0f, 0x0a, - 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x49, 0x4e, 0x54, 0x36, 0x34, 0x10, 0x12, 0x22, 0x43, - 0x0a, 0x05, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x12, 0x12, 0x0a, 0x0e, 0x4c, 0x41, 0x42, 0x45, 0x4c, - 0x5f, 0x4f, 0x50, 0x54, 0x49, 0x4f, 0x4e, 0x41, 0x4c, 0x10, 0x01, 0x12, 0x12, 0x0a, 0x0e, 0x4c, - 0x41, 0x42, 0x45, 0x4c, 0x5f, 0x52, 0x45, 0x51, 0x55, 0x49, 0x52, 0x45, 0x44, 0x10, 0x02, 0x12, - 0x12, 0x0a, 0x0e, 0x4c, 0x41, 0x42, 0x45, 0x4c, 0x5f, 0x52, 0x45, 0x50, 0x45, 0x41, 0x54, 0x45, - 0x44, 0x10, 0x03, 0x22, 0x63, 0x0a, 0x14, 0x4f, 0x6e, 0x65, 0x6f, 0x66, 0x44, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, - 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, - 0x37, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x1d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x4f, 0x6e, 0x65, 0x6f, 0x66, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, - 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0xe3, 0x02, 0x0a, 0x13, 0x45, 0x6e, 0x75, - 0x6d, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, - 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, - 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3f, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, - 0x03, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x44, - 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x05, - 0x76, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x36, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x5d, 0x0a, - 0x0e, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18, - 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x44, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x45, 0x6e, 0x75, 0x6d, - 0x52, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x52, 0x0d, 0x72, - 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x23, 0x0a, 0x0d, - 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x05, 0x20, - 0x03, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x4e, 0x61, 0x6d, - 0x65, 0x1a, 0x3b, 0x0a, 0x11, 0x45, 0x6e, 0x75, 0x6d, 0x52, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, - 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x18, - 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x12, 0x10, 0x0a, 0x03, - 0x65, 0x6e, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x03, 0x65, 0x6e, 0x64, 0x22, 0x83, - 0x01, 0x0a, 0x18, 0x45, 0x6e, 0x75, 0x6d, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x44, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, - 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, - 0x16, 0x0a, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, - 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x12, 0x3b, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x56, - 0x61, 0x6c, 0x75, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x22, 0xa7, 0x01, 0x0a, 0x16, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, - 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, - 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, - 0x61, 0x6d, 0x65, 0x12, 0x3e, 0x0a, 0x06, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x18, 0x02, 0x20, - 0x03, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x44, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x06, 0x6d, 0x65, 0x74, - 0x68, 0x6f, 0x64, 0x12, 0x39, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x03, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0x89, - 0x02, 0x0a, 0x15, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x64, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x05, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, + 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x4e, 0x61, 0x6d, 0x65, 0x1a, 0x3b, 0x0a, 0x11, 0x45, 0x6e, + 0x75, 0x6d, 0x52, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, + 0x14, 0x0a, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05, + 0x73, 0x74, 0x61, 0x72, 0x74, 0x12, 0x10, 0x0a, 0x03, 0x65, 0x6e, 0x64, 0x18, 0x02, 0x20, 0x01, + 0x28, 0x05, 0x52, 0x03, 0x65, 0x6e, 0x64, 0x22, 0x83, 0x01, 0x0a, 0x18, 0x45, 0x6e, 0x75, 0x6d, + 0x56, 0x61, 0x6c, 0x75, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, + 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x6e, 0x75, 0x6d, 0x62, + 0x65, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, + 0x12, 0x3b, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4f, 0x70, 0x74, + 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0xa7, 0x01, + 0x0a, 0x16, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1d, 0x0a, 0x0a, - 0x69, 0x6e, 0x70, 0x75, 0x74, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x09, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x1f, 0x0a, 0x0b, 0x6f, - 0x75, 0x74, 0x70, 0x75, 0x74, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x0a, 0x6f, 0x75, 0x74, 0x70, 0x75, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x38, 0x0a, 0x07, - 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3e, 0x0a, 0x06, + 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, + 0x65, 0x74, 0x68, 0x6f, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, + 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x06, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x12, 0x39, 0x0a, 0x07, + 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x30, 0x0a, 0x10, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, - 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x69, 0x6e, 0x67, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, - 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0f, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x53, - 0x74, 0x72, 0x65, 0x61, 0x6d, 0x69, 0x6e, 0x67, 0x12, 0x30, 0x0a, 0x10, 0x73, 0x65, 0x72, 0x76, - 0x65, 0x72, 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x69, 0x6e, 0x67, 0x18, 0x06, 0x20, 0x01, - 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0f, 0x73, 0x65, 0x72, 0x76, 0x65, - 0x72, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x69, 0x6e, 0x67, 0x22, 0x91, 0x09, 0x0a, 0x0b, 0x46, - 0x69, 0x6c, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x21, 0x0a, 0x0c, 0x6a, 0x61, - 0x76, 0x61, 0x5f, 0x70, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x0b, 0x6a, 0x61, 0x76, 0x61, 0x50, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x12, 0x30, 0x0a, - 0x14, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x6f, 0x75, 0x74, 0x65, 0x72, 0x5f, 0x63, 0x6c, 0x61, 0x73, - 0x73, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x12, 0x6a, 0x61, 0x76, - 0x61, 0x4f, 0x75, 0x74, 0x65, 0x72, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x6e, 0x61, 0x6d, 0x65, 0x12, - 0x35, 0x0a, 0x13, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x6d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x65, - 0x5f, 0x66, 0x69, 0x6c, 0x65, 0x73, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, - 0x6c, 0x73, 0x65, 0x52, 0x11, 0x6a, 0x61, 0x76, 0x61, 0x4d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, - 0x65, 0x46, 0x69, 0x6c, 0x65, 0x73, 0x12, 0x44, 0x0a, 0x1d, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x67, - 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x5f, 0x65, 0x71, 0x75, 0x61, 0x6c, 0x73, 0x5f, 0x61, - 0x6e, 0x64, 0x5f, 0x68, 0x61, 0x73, 0x68, 0x18, 0x14, 0x20, 0x01, 0x28, 0x08, 0x42, 0x02, 0x18, - 0x01, 0x52, 0x19, 0x6a, 0x61, 0x76, 0x61, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x45, - 0x71, 0x75, 0x61, 0x6c, 0x73, 0x41, 0x6e, 0x64, 0x48, 0x61, 0x73, 0x68, 0x12, 0x3a, 0x0a, 0x16, - 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x68, 0x65, 0x63, - 0x6b, 0x5f, 0x75, 0x74, 0x66, 0x38, 0x18, 0x1b, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, - 0x6c, 0x73, 0x65, 0x52, 0x13, 0x6a, 0x61, 0x76, 0x61, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x43, - 0x68, 0x65, 0x63, 0x6b, 0x55, 0x74, 0x66, 0x38, 0x12, 0x53, 0x0a, 0x0c, 0x6f, 0x70, 0x74, 0x69, - 0x6d, 0x69, 0x7a, 0x65, 0x5f, 0x66, 0x6f, 0x72, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x29, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, - 0x2e, 0x46, 0x69, 0x6c, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x4f, 0x70, 0x74, - 0x69, 0x6d, 0x69, 0x7a, 0x65, 0x4d, 0x6f, 0x64, 0x65, 0x3a, 0x05, 0x53, 0x50, 0x45, 0x45, 0x44, - 0x52, 0x0b, 0x6f, 0x70, 0x74, 0x69, 0x6d, 0x69, 0x7a, 0x65, 0x46, 0x6f, 0x72, 0x12, 0x1d, 0x0a, - 0x0a, 0x67, 0x6f, 0x5f, 0x70, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x18, 0x0b, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x09, 0x67, 0x6f, 0x50, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x12, 0x35, 0x0a, 0x13, - 0x63, 0x63, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, - 0x63, 0x65, 0x73, 0x18, 0x10, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, - 0x52, 0x11, 0x63, 0x63, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x53, 0x65, 0x72, 0x76, 0x69, - 0x63, 0x65, 0x73, 0x12, 0x39, 0x0a, 0x15, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x67, 0x65, 0x6e, 0x65, - 0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x11, 0x20, 0x01, - 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x13, 0x6a, 0x61, 0x76, 0x61, 0x47, - 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x12, 0x35, - 0x0a, 0x13, 0x70, 0x79, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72, - 0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x12, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, - 0x73, 0x65, 0x52, 0x11, 0x70, 0x79, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x53, 0x65, 0x72, - 0x76, 0x69, 0x63, 0x65, 0x73, 0x12, 0x37, 0x0a, 0x14, 0x70, 0x68, 0x70, 0x5f, 0x67, 0x65, 0x6e, - 0x65, 0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x2a, 0x20, - 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x12, 0x70, 0x68, 0x70, 0x47, + 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, + 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0x89, 0x02, 0x0a, 0x15, 0x4d, 0x65, 0x74, 0x68, + 0x6f, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, + 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1d, 0x0a, 0x0a, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x5f, 0x74, + 0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x69, 0x6e, 0x70, 0x75, 0x74, + 0x54, 0x79, 0x70, 0x65, 0x12, 0x1f, 0x0a, 0x0b, 0x6f, 0x75, 0x74, 0x70, 0x75, 0x74, 0x5f, 0x74, + 0x79, 0x70, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0a, 0x6f, 0x75, 0x74, 0x70, 0x75, + 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x38, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, + 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x4f, + 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, + 0x30, 0x0a, 0x10, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, + 0x69, 0x6e, 0x67, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, + 0x52, 0x0f, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x69, 0x6e, + 0x67, 0x12, 0x30, 0x0a, 0x10, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x5f, 0x73, 0x74, 0x72, 0x65, + 0x61, 0x6d, 0x69, 0x6e, 0x67, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, + 0x73, 0x65, 0x52, 0x0f, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, + 0x69, 0x6e, 0x67, 0x22, 0x97, 0x09, 0x0a, 0x0b, 0x46, 0x69, 0x6c, 0x65, 0x4f, 0x70, 0x74, 0x69, + 0x6f, 0x6e, 0x73, 0x12, 0x21, 0x0a, 0x0c, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x70, 0x61, 0x63, 0x6b, + 0x61, 0x67, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x6a, 0x61, 0x76, 0x61, 0x50, + 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x12, 0x30, 0x0a, 0x14, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x6f, + 0x75, 0x74, 0x65, 0x72, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x08, + 0x20, 0x01, 0x28, 0x09, 0x52, 0x12, 0x6a, 0x61, 0x76, 0x61, 0x4f, 0x75, 0x74, 0x65, 0x72, 0x43, + 0x6c, 0x61, 0x73, 0x73, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x35, 0x0a, 0x13, 0x6a, 0x61, 0x76, 0x61, + 0x5f, 0x6d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x65, 0x5f, 0x66, 0x69, 0x6c, 0x65, 0x73, 0x18, + 0x0a, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x11, 0x6a, 0x61, + 0x76, 0x61, 0x4d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x65, 0x46, 0x69, 0x6c, 0x65, 0x73, 0x12, + 0x44, 0x0a, 0x1d, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, + 0x5f, 0x65, 0x71, 0x75, 0x61, 0x6c, 0x73, 0x5f, 0x61, 0x6e, 0x64, 0x5f, 0x68, 0x61, 0x73, 0x68, + 0x18, 0x14, 0x20, 0x01, 0x28, 0x08, 0x42, 0x02, 0x18, 0x01, 0x52, 0x19, 0x6a, 0x61, 0x76, 0x61, + 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x45, 0x71, 0x75, 0x61, 0x6c, 0x73, 0x41, 0x6e, + 0x64, 0x48, 0x61, 0x73, 0x68, 0x12, 0x3a, 0x0a, 0x16, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x73, 0x74, + 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x5f, 0x75, 0x74, 0x66, 0x38, 0x18, + 0x1b, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x13, 0x6a, 0x61, + 0x76, 0x61, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x55, 0x74, 0x66, + 0x38, 0x12, 0x53, 0x0a, 0x0c, 0x6f, 0x70, 0x74, 0x69, 0x6d, 0x69, 0x7a, 0x65, 0x5f, 0x66, 0x6f, + 0x72, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x6c, 0x65, 0x4f, 0x70, + 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x4f, 0x70, 0x74, 0x69, 0x6d, 0x69, 0x7a, 0x65, 0x4d, 0x6f, + 0x64, 0x65, 0x3a, 0x05, 0x53, 0x50, 0x45, 0x45, 0x44, 0x52, 0x0b, 0x6f, 0x70, 0x74, 0x69, 0x6d, + 0x69, 0x7a, 0x65, 0x46, 0x6f, 0x72, 0x12, 0x1d, 0x0a, 0x0a, 0x67, 0x6f, 0x5f, 0x70, 0x61, 0x63, + 0x6b, 0x61, 0x67, 0x65, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x67, 0x6f, 0x50, 0x61, + 0x63, 0x6b, 0x61, 0x67, 0x65, 0x12, 0x35, 0x0a, 0x13, 0x63, 0x63, 0x5f, 0x67, 0x65, 0x6e, 0x65, + 0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x10, 0x20, 0x01, + 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x11, 0x63, 0x63, 0x47, 0x65, 0x6e, + 0x65, 0x72, 0x69, 0x63, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x12, 0x39, 0x0a, 0x15, + 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72, + 0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x11, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, + 0x73, 0x65, 0x52, 0x13, 0x6a, 0x61, 0x76, 0x61, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x53, + 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x12, 0x35, 0x0a, 0x13, 0x70, 0x79, 0x5f, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x12, + 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x11, 0x70, 0x79, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x17, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, @@ -3856,259 +4656,419 @@ var file_google_protobuf_descriptor_proto_rawDesc = []byte{ 0x70, 0x68, 0x70, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x70, 0x61, 0x63, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x72, 0x75, 0x62, 0x79, 0x5f, 0x70, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x18, 0x2d, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x72, 0x75, 0x62, 0x79, - 0x50, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, - 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, - 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, - 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, - 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x22, 0x3a, 0x0a, 0x0c, 0x4f, 0x70, 0x74, 0x69, 0x6d, 0x69, 0x7a, 0x65, 0x4d, 0x6f, 0x64, - 0x65, 0x12, 0x09, 0x0a, 0x05, 0x53, 0x50, 0x45, 0x45, 0x44, 0x10, 0x01, 0x12, 0x0d, 0x0a, 0x09, - 0x43, 0x4f, 0x44, 0x45, 0x5f, 0x53, 0x49, 0x5a, 0x45, 0x10, 0x02, 0x12, 0x10, 0x0a, 0x0c, 0x4c, - 0x49, 0x54, 0x45, 0x5f, 0x52, 0x55, 0x4e, 0x54, 0x49, 0x4d, 0x45, 0x10, 0x03, 0x2a, 0x09, 0x08, - 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04, 0x08, 0x26, 0x10, 0x27, 0x22, 0xbb, - 0x03, 0x0a, 0x0e, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, - 0x73, 0x12, 0x3c, 0x0a, 0x17, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x65, 0x74, - 0x5f, 0x77, 0x69, 0x72, 0x65, 0x5f, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x18, 0x01, 0x20, 0x01, - 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x14, 0x6d, 0x65, 0x73, 0x73, 0x61, - 0x67, 0x65, 0x53, 0x65, 0x74, 0x57, 0x69, 0x72, 0x65, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x12, - 0x4c, 0x0a, 0x1f, 0x6e, 0x6f, 0x5f, 0x73, 0x74, 0x61, 0x6e, 0x64, 0x61, 0x72, 0x64, 0x5f, 0x64, - 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73, - 0x6f, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, - 0x1c, 0x6e, 0x6f, 0x53, 0x74, 0x61, 0x6e, 0x64, 0x61, 0x72, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x6f, 0x72, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, 0x6f, 0x72, 0x12, 0x25, 0x0a, - 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, - 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, - 0x61, 0x74, 0x65, 0x64, 0x12, 0x1b, 0x0a, 0x09, 0x6d, 0x61, 0x70, 0x5f, 0x65, 0x6e, 0x74, 0x72, - 0x79, 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x6d, 0x61, 0x70, 0x45, 0x6e, 0x74, 0x72, - 0x79, 0x12, 0x56, 0x0a, 0x26, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x5f, - 0x6c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x5f, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x66, 0x69, 0x65, 0x6c, - 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x18, 0x0b, 0x20, 0x01, 0x28, - 0x08, 0x42, 0x02, 0x18, 0x01, 0x52, 0x22, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, - 0x64, 0x4c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x4a, 0x73, 0x6f, 0x6e, 0x46, 0x69, 0x65, 0x6c, 0x64, - 0x43, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, - 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, - 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, - 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04, - 0x08, 0x04, 0x10, 0x05, 0x4a, 0x04, 0x08, 0x05, 0x10, 0x06, 0x4a, 0x04, 0x08, 0x06, 0x10, 0x07, - 0x4a, 0x04, 0x08, 0x08, 0x10, 0x09, 0x4a, 0x04, 0x08, 0x09, 0x10, 0x0a, 0x22, 0x85, 0x09, 0x0a, - 0x0c, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x41, 0x0a, - 0x05, 0x63, 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x23, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, - 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x43, 0x54, 0x79, 0x70, - 0x65, 0x3a, 0x06, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x52, 0x05, 0x63, 0x74, 0x79, 0x70, 0x65, - 0x12, 0x16, 0x0a, 0x06, 0x70, 0x61, 0x63, 0x6b, 0x65, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, - 0x52, 0x06, 0x70, 0x61, 0x63, 0x6b, 0x65, 0x64, 0x12, 0x47, 0x0a, 0x06, 0x6a, 0x73, 0x74, 0x79, - 0x70, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, - 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x4a, 0x53, 0x54, 0x79, 0x70, 0x65, 0x3a, 0x09, - 0x4a, 0x53, 0x5f, 0x4e, 0x4f, 0x52, 0x4d, 0x41, 0x4c, 0x52, 0x06, 0x6a, 0x73, 0x74, 0x79, 0x70, - 0x65, 0x12, 0x19, 0x0a, 0x04, 0x6c, 0x61, 0x7a, 0x79, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x3a, - 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x04, 0x6c, 0x61, 0x7a, 0x79, 0x12, 0x2e, 0x0a, 0x0f, - 0x75, 0x6e, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x65, 0x64, 0x5f, 0x6c, 0x61, 0x7a, 0x79, 0x18, - 0x0f, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0e, 0x75, 0x6e, - 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x65, 0x64, 0x4c, 0x61, 0x7a, 0x79, 0x12, 0x25, 0x0a, 0x0a, + 0x50, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, + 0x72, 0x65, 0x73, 0x18, 0x32, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, + 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, + 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, + 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, + 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, + 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, + 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x3a, 0x0a, 0x0c, 0x4f, 0x70, + 0x74, 0x69, 0x6d, 0x69, 0x7a, 0x65, 0x4d, 0x6f, 0x64, 0x65, 0x12, 0x09, 0x0a, 0x05, 0x53, 0x50, + 0x45, 0x45, 0x44, 0x10, 0x01, 0x12, 0x0d, 0x0a, 0x09, 0x43, 0x4f, 0x44, 0x45, 0x5f, 0x53, 0x49, + 0x5a, 0x45, 0x10, 0x02, 0x12, 0x10, 0x0a, 0x0c, 0x4c, 0x49, 0x54, 0x45, 0x5f, 0x52, 0x55, 0x4e, + 0x54, 0x49, 0x4d, 0x45, 0x10, 0x03, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, + 0x02, 0x4a, 0x04, 0x08, 0x2a, 0x10, 0x2b, 0x4a, 0x04, 0x08, 0x26, 0x10, 0x27, 0x22, 0xf4, 0x03, + 0x0a, 0x0e, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, + 0x12, 0x3c, 0x0a, 0x17, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x65, 0x74, 0x5f, + 0x77, 0x69, 0x72, 0x65, 0x5f, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x14, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, + 0x65, 0x53, 0x65, 0x74, 0x57, 0x69, 0x72, 0x65, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x12, 0x4c, + 0x0a, 0x1f, 0x6e, 0x6f, 0x5f, 0x73, 0x74, 0x61, 0x6e, 0x64, 0x61, 0x72, 0x64, 0x5f, 0x64, 0x65, + 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73, 0x6f, + 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x1c, + 0x6e, 0x6f, 0x53, 0x74, 0x61, 0x6e, 0x64, 0x61, 0x72, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, + 0x70, 0x74, 0x6f, 0x72, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, 0x6f, 0x72, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, - 0x74, 0x65, 0x64, 0x12, 0x19, 0x0a, 0x04, 0x77, 0x65, 0x61, 0x6b, 0x18, 0x0a, 0x20, 0x01, 0x28, - 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x04, 0x77, 0x65, 0x61, 0x6b, 0x12, 0x28, - 0x0a, 0x0c, 0x64, 0x65, 0x62, 0x75, 0x67, 0x5f, 0x72, 0x65, 0x64, 0x61, 0x63, 0x74, 0x18, 0x10, - 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0b, 0x64, 0x65, 0x62, - 0x75, 0x67, 0x52, 0x65, 0x64, 0x61, 0x63, 0x74, 0x12, 0x4b, 0x0a, 0x09, 0x72, 0x65, 0x74, 0x65, - 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x11, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2d, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, - 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x4f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x09, 0x72, 0x65, 0x74, 0x65, - 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4a, 0x0a, 0x06, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x18, - 0x12, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x54, 0x61, 0x72, 0x67, 0x65, - 0x74, 0x54, 0x79, 0x70, 0x65, 0x42, 0x02, 0x18, 0x01, 0x52, 0x06, 0x74, 0x61, 0x72, 0x67, 0x65, - 0x74, 0x12, 0x48, 0x0a, 0x07, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x73, 0x18, 0x13, 0x20, 0x03, - 0x28, 0x0e, 0x32, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, - 0x73, 0x2e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x54, 0x79, - 0x70, 0x65, 0x52, 0x07, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, - 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, - 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, - 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x2f, 0x0a, 0x05, 0x43, 0x54, 0x79, 0x70, 0x65, 0x12, 0x0a, - 0x0a, 0x06, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x00, 0x12, 0x08, 0x0a, 0x04, 0x43, 0x4f, - 0x52, 0x44, 0x10, 0x01, 0x12, 0x10, 0x0a, 0x0c, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x5f, 0x50, - 0x49, 0x45, 0x43, 0x45, 0x10, 0x02, 0x22, 0x35, 0x0a, 0x06, 0x4a, 0x53, 0x54, 0x79, 0x70, 0x65, - 0x12, 0x0d, 0x0a, 0x09, 0x4a, 0x53, 0x5f, 0x4e, 0x4f, 0x52, 0x4d, 0x41, 0x4c, 0x10, 0x00, 0x12, - 0x0d, 0x0a, 0x09, 0x4a, 0x53, 0x5f, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x01, 0x12, 0x0d, - 0x0a, 0x09, 0x4a, 0x53, 0x5f, 0x4e, 0x55, 0x4d, 0x42, 0x45, 0x52, 0x10, 0x02, 0x22, 0x55, 0x0a, - 0x0f, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, - 0x12, 0x15, 0x0a, 0x11, 0x52, 0x45, 0x54, 0x45, 0x4e, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, - 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x15, 0x0a, 0x11, 0x52, 0x45, 0x54, 0x45, 0x4e, - 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x52, 0x55, 0x4e, 0x54, 0x49, 0x4d, 0x45, 0x10, 0x01, 0x12, 0x14, - 0x0a, 0x10, 0x52, 0x45, 0x54, 0x45, 0x4e, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x53, 0x4f, 0x55, 0x52, - 0x43, 0x45, 0x10, 0x02, 0x22, 0x8c, 0x02, 0x0a, 0x10, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x54, - 0x61, 0x72, 0x67, 0x65, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x17, 0x0a, 0x13, 0x54, 0x41, 0x52, - 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, - 0x10, 0x00, 0x12, 0x14, 0x0a, 0x10, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, - 0x45, 0x5f, 0x46, 0x49, 0x4c, 0x45, 0x10, 0x01, 0x12, 0x1f, 0x0a, 0x1b, 0x54, 0x41, 0x52, 0x47, - 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x45, 0x58, 0x54, 0x45, 0x4e, 0x53, 0x49, 0x4f, - 0x4e, 0x5f, 0x52, 0x41, 0x4e, 0x47, 0x45, 0x10, 0x02, 0x12, 0x17, 0x0a, 0x13, 0x54, 0x41, 0x52, - 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4d, 0x45, 0x53, 0x53, 0x41, 0x47, 0x45, - 0x10, 0x03, 0x12, 0x15, 0x0a, 0x11, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, - 0x45, 0x5f, 0x46, 0x49, 0x45, 0x4c, 0x44, 0x10, 0x04, 0x12, 0x15, 0x0a, 0x11, 0x54, 0x41, 0x52, - 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4f, 0x4e, 0x45, 0x4f, 0x46, 0x10, 0x05, - 0x12, 0x14, 0x0a, 0x10, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, - 0x45, 0x4e, 0x55, 0x4d, 0x10, 0x06, 0x12, 0x1a, 0x0a, 0x16, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, - 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x45, 0x4e, 0x55, 0x4d, 0x5f, 0x45, 0x4e, 0x54, 0x52, 0x59, - 0x10, 0x07, 0x12, 0x17, 0x0a, 0x13, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, - 0x45, 0x5f, 0x53, 0x45, 0x52, 0x56, 0x49, 0x43, 0x45, 0x10, 0x08, 0x12, 0x16, 0x0a, 0x12, 0x54, - 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4d, 0x45, 0x54, 0x48, 0x4f, - 0x44, 0x10, 0x09, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04, - 0x08, 0x04, 0x10, 0x05, 0x22, 0x73, 0x0a, 0x0c, 0x4f, 0x6e, 0x65, 0x6f, 0x66, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, - 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, - 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, - 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, - 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, - 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, 0x98, 0x02, 0x0a, 0x0b, 0x45, 0x6e, - 0x75, 0x6d, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x1f, 0x0a, 0x0b, 0x61, 0x6c, 0x6c, - 0x6f, 0x77, 0x5f, 0x61, 0x6c, 0x69, 0x61, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0a, - 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x41, 0x6c, 0x69, 0x61, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, - 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, - 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, - 0x64, 0x12, 0x56, 0x0a, 0x26, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x5f, - 0x6c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x5f, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x66, 0x69, 0x65, 0x6c, - 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x18, 0x06, 0x20, 0x01, 0x28, - 0x08, 0x42, 0x02, 0x18, 0x01, 0x52, 0x22, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, - 0x64, 0x4c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x4a, 0x73, 0x6f, 0x6e, 0x46, 0x69, 0x65, 0x6c, 0x64, - 0x43, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, + 0x74, 0x65, 0x64, 0x12, 0x1b, 0x0a, 0x09, 0x6d, 0x61, 0x70, 0x5f, 0x65, 0x6e, 0x74, 0x72, 0x79, + 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x6d, 0x61, 0x70, 0x45, 0x6e, 0x74, 0x72, 0x79, + 0x12, 0x56, 0x0a, 0x26, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x6c, + 0x65, 0x67, 0x61, 0x63, 0x79, 0x5f, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x66, 0x69, 0x65, 0x6c, 0x64, + 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x08, + 0x42, 0x02, 0x18, 0x01, 0x52, 0x22, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, + 0x4c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x4a, 0x73, 0x6f, 0x6e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x43, + 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, + 0x75, 0x72, 0x65, 0x73, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, + 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, + 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, + 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, + 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, + 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, + 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, + 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04, 0x08, 0x04, 0x10, 0x05, 0x4a, 0x04, 0x08, 0x05, + 0x10, 0x06, 0x4a, 0x04, 0x08, 0x06, 0x10, 0x07, 0x4a, 0x04, 0x08, 0x08, 0x10, 0x09, 0x4a, 0x04, + 0x08, 0x09, 0x10, 0x0a, 0x22, 0xad, 0x0a, 0x0a, 0x0c, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, + 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x41, 0x0a, 0x05, 0x63, 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x0e, 0x32, 0x23, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, + 0x6f, 0x6e, 0x73, 0x2e, 0x43, 0x54, 0x79, 0x70, 0x65, 0x3a, 0x06, 0x53, 0x54, 0x52, 0x49, 0x4e, + 0x47, 0x52, 0x05, 0x63, 0x74, 0x79, 0x70, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x70, 0x61, 0x63, 0x6b, + 0x65, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x06, 0x70, 0x61, 0x63, 0x6b, 0x65, 0x64, + 0x12, 0x47, 0x0a, 0x06, 0x6a, 0x73, 0x74, 0x79, 0x70, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0e, + 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, + 0x4a, 0x53, 0x54, 0x79, 0x70, 0x65, 0x3a, 0x09, 0x4a, 0x53, 0x5f, 0x4e, 0x4f, 0x52, 0x4d, 0x41, + 0x4c, 0x52, 0x06, 0x6a, 0x73, 0x74, 0x79, 0x70, 0x65, 0x12, 0x19, 0x0a, 0x04, 0x6c, 0x61, 0x7a, + 0x79, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x04, + 0x6c, 0x61, 0x7a, 0x79, 0x12, 0x2e, 0x0a, 0x0f, 0x75, 0x6e, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, + 0x65, 0x64, 0x5f, 0x6c, 0x61, 0x7a, 0x79, 0x18, 0x0f, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, + 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0e, 0x75, 0x6e, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x65, 0x64, + 0x4c, 0x61, 0x7a, 0x79, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, + 0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, + 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x19, 0x0a, 0x04, 0x77, + 0x65, 0x61, 0x6b, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, + 0x52, 0x04, 0x77, 0x65, 0x61, 0x6b, 0x12, 0x28, 0x0a, 0x0c, 0x64, 0x65, 0x62, 0x75, 0x67, 0x5f, + 0x72, 0x65, 0x64, 0x61, 0x63, 0x74, 0x18, 0x10, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, + 0x6c, 0x73, 0x65, 0x52, 0x0b, 0x64, 0x65, 0x62, 0x75, 0x67, 0x52, 0x65, 0x64, 0x61, 0x63, 0x74, + 0x12, 0x4b, 0x0a, 0x09, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x11, 0x20, + 0x01, 0x28, 0x0e, 0x32, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, + 0x6e, 0x73, 0x2e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, + 0x6f, 0x6e, 0x52, 0x09, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x48, 0x0a, + 0x07, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x73, 0x18, 0x13, 0x20, 0x03, 0x28, 0x0e, 0x32, 0x2e, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, + 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x4f, 0x70, + 0x74, 0x69, 0x6f, 0x6e, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x54, 0x79, 0x70, 0x65, 0x52, 0x07, + 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x73, 0x12, 0x57, 0x0a, 0x10, 0x65, 0x64, 0x69, 0x74, 0x69, + 0x6f, 0x6e, 0x5f, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, 0x18, 0x14, 0x20, 0x03, 0x28, + 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, + 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x52, + 0x0f, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, + 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x15, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, + 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04, - 0x08, 0x05, 0x10, 0x06, 0x22, 0x9e, 0x01, 0x0a, 0x10, 0x45, 0x6e, 0x75, 0x6d, 0x56, 0x61, 0x6c, - 0x75, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, - 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, - 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, - 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, - 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, - 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, - 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, 0x9c, 0x01, 0x0a, 0x0e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, - 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, - 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x21, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, - 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, - 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, - 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, - 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, - 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, - 0x80, 0x80, 0x80, 0x02, 0x22, 0xe0, 0x02, 0x0a, 0x0d, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x4f, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, - 0x61, 0x74, 0x65, 0x64, 0x18, 0x21, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, - 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x71, 0x0a, - 0x11, 0x69, 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x5f, 0x6c, 0x65, 0x76, - 0x65, 0x6c, 0x18, 0x22, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, - 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x49, 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, - 0x65, 0x6e, 0x63, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x3a, 0x13, 0x49, 0x44, 0x45, 0x4d, 0x50, - 0x4f, 0x54, 0x45, 0x4e, 0x43, 0x59, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x52, 0x10, - 0x69, 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, - 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, - 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, - 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x50, 0x0a, 0x10, 0x49, 0x64, - 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x12, 0x17, - 0x0a, 0x13, 0x49, 0x44, 0x45, 0x4d, 0x50, 0x4f, 0x54, 0x45, 0x4e, 0x43, 0x59, 0x5f, 0x55, 0x4e, - 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x13, 0x0a, 0x0f, 0x4e, 0x4f, 0x5f, 0x53, 0x49, - 0x44, 0x45, 0x5f, 0x45, 0x46, 0x46, 0x45, 0x43, 0x54, 0x53, 0x10, 0x01, 0x12, 0x0e, 0x0a, 0x0a, - 0x49, 0x44, 0x45, 0x4d, 0x50, 0x4f, 0x54, 0x45, 0x4e, 0x54, 0x10, 0x02, 0x2a, 0x09, 0x08, 0xe8, - 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, 0x9a, 0x03, 0x0a, 0x13, 0x55, 0x6e, 0x69, 0x6e, - 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, - 0x41, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2d, 0x2e, + 0x69, 0x6f, 0x6e, 0x1a, 0x5a, 0x0a, 0x0e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, + 0x66, 0x61, 0x75, 0x6c, 0x74, 0x12, 0x32, 0x0a, 0x07, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, + 0x18, 0x03, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, + 0x52, 0x07, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, + 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22, + 0x2f, 0x0a, 0x05, 0x43, 0x54, 0x79, 0x70, 0x65, 0x12, 0x0a, 0x0a, 0x06, 0x53, 0x54, 0x52, 0x49, + 0x4e, 0x47, 0x10, 0x00, 0x12, 0x08, 0x0a, 0x04, 0x43, 0x4f, 0x52, 0x44, 0x10, 0x01, 0x12, 0x10, + 0x0a, 0x0c, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x5f, 0x50, 0x49, 0x45, 0x43, 0x45, 0x10, 0x02, + 0x22, 0x35, 0x0a, 0x06, 0x4a, 0x53, 0x54, 0x79, 0x70, 0x65, 0x12, 0x0d, 0x0a, 0x09, 0x4a, 0x53, + 0x5f, 0x4e, 0x4f, 0x52, 0x4d, 0x41, 0x4c, 0x10, 0x00, 0x12, 0x0d, 0x0a, 0x09, 0x4a, 0x53, 0x5f, + 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x01, 0x12, 0x0d, 0x0a, 0x09, 0x4a, 0x53, 0x5f, 0x4e, + 0x55, 0x4d, 0x42, 0x45, 0x52, 0x10, 0x02, 0x22, 0x55, 0x0a, 0x0f, 0x4f, 0x70, 0x74, 0x69, 0x6f, + 0x6e, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x15, 0x0a, 0x11, 0x52, 0x45, + 0x54, 0x45, 0x4e, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, + 0x00, 0x12, 0x15, 0x0a, 0x11, 0x52, 0x45, 0x54, 0x45, 0x4e, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x52, + 0x55, 0x4e, 0x54, 0x49, 0x4d, 0x45, 0x10, 0x01, 0x12, 0x14, 0x0a, 0x10, 0x52, 0x45, 0x54, 0x45, + 0x4e, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x53, 0x4f, 0x55, 0x52, 0x43, 0x45, 0x10, 0x02, 0x22, 0x8c, + 0x02, 0x0a, 0x10, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x54, + 0x79, 0x70, 0x65, 0x12, 0x17, 0x0a, 0x13, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, + 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x14, 0x0a, 0x10, + 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x46, 0x49, 0x4c, 0x45, + 0x10, 0x01, 0x12, 0x1f, 0x0a, 0x1b, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, + 0x45, 0x5f, 0x45, 0x58, 0x54, 0x45, 0x4e, 0x53, 0x49, 0x4f, 0x4e, 0x5f, 0x52, 0x41, 0x4e, 0x47, + 0x45, 0x10, 0x02, 0x12, 0x17, 0x0a, 0x13, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, + 0x50, 0x45, 0x5f, 0x4d, 0x45, 0x53, 0x53, 0x41, 0x47, 0x45, 0x10, 0x03, 0x12, 0x15, 0x0a, 0x11, + 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x46, 0x49, 0x45, 0x4c, + 0x44, 0x10, 0x04, 0x12, 0x15, 0x0a, 0x11, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, + 0x50, 0x45, 0x5f, 0x4f, 0x4e, 0x45, 0x4f, 0x46, 0x10, 0x05, 0x12, 0x14, 0x0a, 0x10, 0x54, 0x41, + 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x45, 0x4e, 0x55, 0x4d, 0x10, 0x06, + 0x12, 0x1a, 0x0a, 0x16, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, + 0x45, 0x4e, 0x55, 0x4d, 0x5f, 0x45, 0x4e, 0x54, 0x52, 0x59, 0x10, 0x07, 0x12, 0x17, 0x0a, 0x13, + 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x45, 0x52, 0x56, + 0x49, 0x43, 0x45, 0x10, 0x08, 0x12, 0x16, 0x0a, 0x12, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, + 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4d, 0x45, 0x54, 0x48, 0x4f, 0x44, 0x10, 0x09, 0x2a, 0x09, 0x08, + 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04, 0x08, 0x04, 0x10, 0x05, 0x4a, 0x04, + 0x08, 0x12, 0x10, 0x13, 0x22, 0xac, 0x01, 0x0a, 0x0c, 0x4f, 0x6e, 0x65, 0x6f, 0x66, 0x4f, 0x70, + 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, + 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, + 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x58, + 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, + 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x2e, 0x4e, 0x61, 0x6d, 0x65, 0x50, 0x61, 0x72, 0x74, 0x52, 0x04, 0x6e, 0x61, - 0x6d, 0x65, 0x12, 0x29, 0x0a, 0x10, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x72, - 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, 0x69, 0x64, - 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x2c, 0x0a, - 0x12, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x69, 0x6e, 0x74, 0x5f, 0x76, 0x61, - 0x6c, 0x75, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x04, 0x52, 0x10, 0x70, 0x6f, 0x73, 0x69, 0x74, - 0x69, 0x76, 0x65, 0x49, 0x6e, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x2c, 0x0a, 0x12, 0x6e, - 0x65, 0x67, 0x61, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x69, 0x6e, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x52, 0x10, 0x6e, 0x65, 0x67, 0x61, 0x74, 0x69, 0x76, - 0x65, 0x49, 0x6e, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x6f, 0x75, - 0x62, 0x6c, 0x65, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x01, 0x52, - 0x0b, 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x21, 0x0a, 0x0c, - 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x07, 0x20, 0x01, - 0x28, 0x0c, 0x52, 0x0b, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, - 0x27, 0x0a, 0x0f, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x65, 0x5f, 0x76, 0x61, 0x6c, - 0x75, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0e, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, - 0x61, 0x74, 0x65, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x1a, 0x4a, 0x0a, 0x08, 0x4e, 0x61, 0x6d, 0x65, - 0x50, 0x61, 0x72, 0x74, 0x12, 0x1b, 0x0a, 0x09, 0x6e, 0x61, 0x6d, 0x65, 0x5f, 0x70, 0x61, 0x72, - 0x74, 0x18, 0x01, 0x20, 0x02, 0x28, 0x09, 0x52, 0x08, 0x6e, 0x61, 0x6d, 0x65, 0x50, 0x61, 0x72, - 0x74, 0x12, 0x21, 0x0a, 0x0c, 0x69, 0x73, 0x5f, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, - 0x6e, 0x18, 0x02, 0x20, 0x02, 0x28, 0x08, 0x52, 0x0b, 0x69, 0x73, 0x45, 0x78, 0x74, 0x65, 0x6e, - 0x73, 0x69, 0x6f, 0x6e, 0x22, 0xa7, 0x02, 0x0a, 0x0e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x43, - 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x44, 0x0a, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x28, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x4c, 0x6f, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x52, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xce, 0x01, - 0x0a, 0x08, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x16, 0x0a, 0x04, 0x70, 0x61, - 0x74, 0x68, 0x18, 0x01, 0x20, 0x03, 0x28, 0x05, 0x42, 0x02, 0x10, 0x01, 0x52, 0x04, 0x70, 0x61, - 0x74, 0x68, 0x12, 0x16, 0x0a, 0x04, 0x73, 0x70, 0x61, 0x6e, 0x18, 0x02, 0x20, 0x03, 0x28, 0x05, - 0x42, 0x02, 0x10, 0x01, 0x52, 0x04, 0x73, 0x70, 0x61, 0x6e, 0x12, 0x29, 0x0a, 0x10, 0x6c, 0x65, - 0x61, 0x64, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x18, 0x03, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6d, - 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x12, 0x2b, 0x0a, 0x11, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x69, 0x6e, - 0x67, 0x5f, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x10, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, - 0x74, 0x73, 0x12, 0x3a, 0x0a, 0x19, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x5f, 0x64, 0x65, - 0x74, 0x61, 0x63, 0x68, 0x65, 0x64, 0x5f, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x18, - 0x06, 0x20, 0x03, 0x28, 0x09, 0x52, 0x17, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x44, 0x65, - 0x74, 0x61, 0x63, 0x68, 0x65, 0x64, 0x43, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x22, 0xd0, - 0x02, 0x0a, 0x11, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x64, 0x43, 0x6f, 0x64, 0x65, - 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x4d, 0x0a, 0x0a, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x47, 0x65, 0x6e, 0x65, 0x72, - 0x61, 0x74, 0x65, 0x64, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x41, 0x6e, 0x6e, - 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0a, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x1a, 0xeb, 0x01, 0x0a, 0x0a, 0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, + 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, + 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, + 0x80, 0x80, 0x02, 0x22, 0xd1, 0x02, 0x0a, 0x0b, 0x45, 0x6e, 0x75, 0x6d, 0x4f, 0x70, 0x74, 0x69, + 0x6f, 0x6e, 0x73, 0x12, 0x1f, 0x0a, 0x0b, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x5f, 0x61, 0x6c, 0x69, + 0x61, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0a, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x41, + 0x6c, 0x69, 0x61, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, + 0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, + 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x56, 0x0a, 0x26, 0x64, + 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x6c, 0x65, 0x67, 0x61, 0x63, 0x79, + 0x5f, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66, + 0x6c, 0x69, 0x63, 0x74, 0x73, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x42, 0x02, 0x18, 0x01, 0x52, + 0x22, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x4c, 0x65, 0x67, 0x61, 0x63, + 0x79, 0x4a, 0x73, 0x6f, 0x6e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x6c, 0x69, + 0x63, 0x74, 0x73, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, + 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, + 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, + 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x58, 0x0a, 0x14, + 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, + 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, + 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, + 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, + 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, + 0x02, 0x4a, 0x04, 0x08, 0x05, 0x10, 0x06, 0x22, 0x81, 0x02, 0x0a, 0x10, 0x45, 0x6e, 0x75, 0x6d, + 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x25, 0x0a, 0x0a, + 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, + 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, + 0x74, 0x65, 0x64, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, + 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, + 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x28, 0x0a, 0x0c, + 0x64, 0x65, 0x62, 0x75, 0x67, 0x5f, 0x72, 0x65, 0x64, 0x61, 0x63, 0x74, 0x18, 0x03, 0x20, 0x01, + 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0b, 0x64, 0x65, 0x62, 0x75, 0x67, + 0x52, 0x65, 0x64, 0x61, 0x63, 0x74, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, + 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, + 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, + 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, + 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, + 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, + 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, 0xd5, 0x01, 0x0a, 0x0e, + 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x37, + 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x22, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, + 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, + 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x21, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, + 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x58, + 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, + 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, + 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, + 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, + 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, + 0x80, 0x80, 0x02, 0x22, 0x99, 0x03, 0x0a, 0x0d, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x4f, 0x70, + 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, + 0x74, 0x65, 0x64, 0x18, 0x21, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, + 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x71, 0x0a, 0x11, + 0x69, 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x5f, 0x6c, 0x65, 0x76, 0x65, + 0x6c, 0x18, 0x22, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, + 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x49, 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, + 0x6e, 0x63, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x3a, 0x13, 0x49, 0x44, 0x45, 0x4d, 0x50, 0x4f, + 0x54, 0x45, 0x4e, 0x43, 0x59, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x52, 0x10, 0x69, + 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x12, + 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x23, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, + 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, + 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, + 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, + 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, + 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, + 0x6f, 0x6e, 0x22, 0x50, 0x0a, 0x10, 0x49, 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, + 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x12, 0x17, 0x0a, 0x13, 0x49, 0x44, 0x45, 0x4d, 0x50, 0x4f, + 0x54, 0x45, 0x4e, 0x43, 0x59, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, + 0x13, 0x0a, 0x0f, 0x4e, 0x4f, 0x5f, 0x53, 0x49, 0x44, 0x45, 0x5f, 0x45, 0x46, 0x46, 0x45, 0x43, + 0x54, 0x53, 0x10, 0x01, 0x12, 0x0e, 0x0a, 0x0a, 0x49, 0x44, 0x45, 0x4d, 0x50, 0x4f, 0x54, 0x45, + 0x4e, 0x54, 0x10, 0x02, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, + 0x9a, 0x03, 0x0a, 0x13, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, + 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x41, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, + 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, + 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, + 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4e, 0x61, 0x6d, 0x65, + 0x50, 0x61, 0x72, 0x74, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x29, 0x0a, 0x10, 0x69, 0x64, + 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x72, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x03, + 0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x72, + 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x2c, 0x0a, 0x12, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x76, + 0x65, 0x5f, 0x69, 0x6e, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, + 0x04, 0x52, 0x10, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x76, 0x65, 0x49, 0x6e, 0x74, 0x56, 0x61, + 0x6c, 0x75, 0x65, 0x12, 0x2c, 0x0a, 0x12, 0x6e, 0x65, 0x67, 0x61, 0x74, 0x69, 0x76, 0x65, 0x5f, + 0x69, 0x6e, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x52, + 0x10, 0x6e, 0x65, 0x67, 0x61, 0x74, 0x69, 0x76, 0x65, 0x49, 0x6e, 0x74, 0x56, 0x61, 0x6c, 0x75, + 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x5f, 0x76, 0x61, 0x6c, 0x75, + 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x01, 0x52, 0x0b, 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x56, + 0x61, 0x6c, 0x75, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x76, + 0x61, 0x6c, 0x75, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x0b, 0x73, 0x74, 0x72, 0x69, + 0x6e, 0x67, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x27, 0x0a, 0x0f, 0x61, 0x67, 0x67, 0x72, 0x65, + 0x67, 0x61, 0x74, 0x65, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x09, + 0x52, 0x0e, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x65, 0x56, 0x61, 0x6c, 0x75, 0x65, + 0x1a, 0x4a, 0x0a, 0x08, 0x4e, 0x61, 0x6d, 0x65, 0x50, 0x61, 0x72, 0x74, 0x12, 0x1b, 0x0a, 0x09, + 0x6e, 0x61, 0x6d, 0x65, 0x5f, 0x70, 0x61, 0x72, 0x74, 0x18, 0x01, 0x20, 0x02, 0x28, 0x09, 0x52, + 0x08, 0x6e, 0x61, 0x6d, 0x65, 0x50, 0x61, 0x72, 0x74, 0x12, 0x21, 0x0a, 0x0c, 0x69, 0x73, 0x5f, + 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x02, 0x28, 0x08, 0x52, + 0x0b, 0x69, 0x73, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x22, 0x8c, 0x0a, 0x0a, + 0x0a, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x12, 0x8b, 0x01, 0x0a, 0x0e, + 0x66, 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x0e, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, + 0x74, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x50, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x42, + 0x39, 0x88, 0x01, 0x01, 0x98, 0x01, 0x04, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x45, + 0x58, 0x50, 0x4c, 0x49, 0x43, 0x49, 0x54, 0x18, 0xe6, 0x07, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x49, + 0x4d, 0x50, 0x4c, 0x49, 0x43, 0x49, 0x54, 0x18, 0xe7, 0x07, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x45, + 0x58, 0x50, 0x4c, 0x49, 0x43, 0x49, 0x54, 0x18, 0xe8, 0x07, 0x52, 0x0d, 0x66, 0x69, 0x65, 0x6c, + 0x64, 0x50, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x12, 0x66, 0x0a, 0x09, 0x65, 0x6e, 0x75, + 0x6d, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x24, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, + 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x54, 0x79, + 0x70, 0x65, 0x42, 0x23, 0x88, 0x01, 0x01, 0x98, 0x01, 0x06, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x0b, + 0x12, 0x06, 0x43, 0x4c, 0x4f, 0x53, 0x45, 0x44, 0x18, 0xe6, 0x07, 0xa2, 0x01, 0x09, 0x12, 0x04, + 0x4f, 0x50, 0x45, 0x4e, 0x18, 0xe7, 0x07, 0x52, 0x08, 0x65, 0x6e, 0x75, 0x6d, 0x54, 0x79, 0x70, + 0x65, 0x12, 0x92, 0x01, 0x0a, 0x17, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x66, + 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x65, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x18, 0x03, 0x20, + 0x01, 0x28, 0x0e, 0x32, 0x31, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, + 0x2e, 0x52, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x45, 0x6e, + 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x42, 0x27, 0x88, 0x01, 0x01, 0x98, 0x01, 0x04, 0x98, 0x01, + 0x01, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x45, 0x58, 0x50, 0x41, 0x4e, 0x44, 0x45, 0x44, 0x18, 0xe6, + 0x07, 0xa2, 0x01, 0x0b, 0x12, 0x06, 0x50, 0x41, 0x43, 0x4b, 0x45, 0x44, 0x18, 0xe7, 0x07, 0x52, + 0x15, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x45, 0x6e, + 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x12, 0x78, 0x0a, 0x0f, 0x75, 0x74, 0x66, 0x38, 0x5f, 0x76, + 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, + 0x2a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x55, 0x74, 0x66, + 0x38, 0x56, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x23, 0x88, 0x01, 0x01, + 0x98, 0x01, 0x04, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x09, 0x12, 0x04, 0x4e, 0x4f, 0x4e, 0x45, 0x18, + 0xe6, 0x07, 0xa2, 0x01, 0x0b, 0x12, 0x06, 0x56, 0x45, 0x52, 0x49, 0x46, 0x59, 0x18, 0xe7, 0x07, + 0x52, 0x0e, 0x75, 0x74, 0x66, 0x38, 0x56, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x12, 0x78, 0x0a, 0x10, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x5f, 0x65, 0x6e, 0x63, 0x6f, + 0x64, 0x69, 0x6e, 0x67, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, + 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x45, + 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x42, 0x20, 0x88, 0x01, 0x01, 0x98, 0x01, 0x04, 0x98, + 0x01, 0x01, 0xa2, 0x01, 0x14, 0x12, 0x0f, 0x4c, 0x45, 0x4e, 0x47, 0x54, 0x48, 0x5f, 0x50, 0x52, + 0x45, 0x46, 0x49, 0x58, 0x45, 0x44, 0x18, 0xe6, 0x07, 0x52, 0x0f, 0x6d, 0x65, 0x73, 0x73, 0x61, + 0x67, 0x65, 0x45, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x12, 0x7c, 0x0a, 0x0b, 0x6a, 0x73, + 0x6f, 0x6e, 0x5f, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0e, 0x32, + 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x4a, 0x73, 0x6f, + 0x6e, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x42, 0x33, 0x88, 0x01, 0x01, 0x98, 0x01, 0x03, 0x98, + 0x01, 0x06, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x17, 0x12, 0x12, 0x4c, 0x45, 0x47, 0x41, 0x43, 0x59, + 0x5f, 0x42, 0x45, 0x53, 0x54, 0x5f, 0x45, 0x46, 0x46, 0x4f, 0x52, 0x54, 0x18, 0xe6, 0x07, 0xa2, + 0x01, 0x0a, 0x12, 0x05, 0x41, 0x4c, 0x4c, 0x4f, 0x57, 0x18, 0xe7, 0x07, 0x52, 0x0a, 0x6a, 0x73, + 0x6f, 0x6e, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x22, 0x5c, 0x0a, 0x0d, 0x46, 0x69, 0x65, 0x6c, + 0x64, 0x50, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x12, 0x1a, 0x0a, 0x16, 0x46, 0x49, 0x45, + 0x4c, 0x44, 0x5f, 0x50, 0x52, 0x45, 0x53, 0x45, 0x4e, 0x43, 0x45, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, + 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x0c, 0x0a, 0x08, 0x45, 0x58, 0x50, 0x4c, 0x49, 0x43, 0x49, + 0x54, 0x10, 0x01, 0x12, 0x0c, 0x0a, 0x08, 0x49, 0x4d, 0x50, 0x4c, 0x49, 0x43, 0x49, 0x54, 0x10, + 0x02, 0x12, 0x13, 0x0a, 0x0f, 0x4c, 0x45, 0x47, 0x41, 0x43, 0x59, 0x5f, 0x52, 0x45, 0x51, 0x55, + 0x49, 0x52, 0x45, 0x44, 0x10, 0x03, 0x22, 0x37, 0x0a, 0x08, 0x45, 0x6e, 0x75, 0x6d, 0x54, 0x79, + 0x70, 0x65, 0x12, 0x15, 0x0a, 0x11, 0x45, 0x4e, 0x55, 0x4d, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, + 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x08, 0x0a, 0x04, 0x4f, 0x50, 0x45, + 0x4e, 0x10, 0x01, 0x12, 0x0a, 0x0a, 0x06, 0x43, 0x4c, 0x4f, 0x53, 0x45, 0x44, 0x10, 0x02, 0x22, + 0x56, 0x0a, 0x15, 0x52, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x46, 0x69, 0x65, 0x6c, 0x64, + 0x45, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x12, 0x23, 0x0a, 0x1f, 0x52, 0x45, 0x50, 0x45, + 0x41, 0x54, 0x45, 0x44, 0x5f, 0x46, 0x49, 0x45, 0x4c, 0x44, 0x5f, 0x45, 0x4e, 0x43, 0x4f, 0x44, + 0x49, 0x4e, 0x47, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x0a, 0x0a, + 0x06, 0x50, 0x41, 0x43, 0x4b, 0x45, 0x44, 0x10, 0x01, 0x12, 0x0c, 0x0a, 0x08, 0x45, 0x58, 0x50, + 0x41, 0x4e, 0x44, 0x45, 0x44, 0x10, 0x02, 0x22, 0x43, 0x0a, 0x0e, 0x55, 0x74, 0x66, 0x38, 0x56, + 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1b, 0x0a, 0x17, 0x55, 0x54, 0x46, + 0x38, 0x5f, 0x56, 0x41, 0x4c, 0x49, 0x44, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x4b, + 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x0a, 0x0a, 0x06, 0x56, 0x45, 0x52, 0x49, 0x46, 0x59, + 0x10, 0x02, 0x12, 0x08, 0x0a, 0x04, 0x4e, 0x4f, 0x4e, 0x45, 0x10, 0x03, 0x22, 0x53, 0x0a, 0x0f, + 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x45, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x12, + 0x1c, 0x0a, 0x18, 0x4d, 0x45, 0x53, 0x53, 0x41, 0x47, 0x45, 0x5f, 0x45, 0x4e, 0x43, 0x4f, 0x44, + 0x49, 0x4e, 0x47, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x13, 0x0a, + 0x0f, 0x4c, 0x45, 0x4e, 0x47, 0x54, 0x48, 0x5f, 0x50, 0x52, 0x45, 0x46, 0x49, 0x58, 0x45, 0x44, + 0x10, 0x01, 0x12, 0x0d, 0x0a, 0x09, 0x44, 0x45, 0x4c, 0x49, 0x4d, 0x49, 0x54, 0x45, 0x44, 0x10, + 0x02, 0x22, 0x48, 0x0a, 0x0a, 0x4a, 0x73, 0x6f, 0x6e, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x12, + 0x17, 0x0a, 0x13, 0x4a, 0x53, 0x4f, 0x4e, 0x5f, 0x46, 0x4f, 0x52, 0x4d, 0x41, 0x54, 0x5f, 0x55, + 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x09, 0x0a, 0x05, 0x41, 0x4c, 0x4c, 0x4f, + 0x57, 0x10, 0x01, 0x12, 0x16, 0x0a, 0x12, 0x4c, 0x45, 0x47, 0x41, 0x43, 0x59, 0x5f, 0x42, 0x45, + 0x53, 0x54, 0x5f, 0x45, 0x46, 0x46, 0x4f, 0x52, 0x54, 0x10, 0x02, 0x2a, 0x06, 0x08, 0xe8, 0x07, + 0x10, 0xe9, 0x07, 0x2a, 0x06, 0x08, 0xe9, 0x07, 0x10, 0xea, 0x07, 0x2a, 0x06, 0x08, 0xea, 0x07, + 0x10, 0xeb, 0x07, 0x2a, 0x06, 0x08, 0x8b, 0x4e, 0x10, 0x90, 0x4e, 0x2a, 0x06, 0x08, 0x90, 0x4e, + 0x10, 0x91, 0x4e, 0x4a, 0x06, 0x08, 0xe7, 0x07, 0x10, 0xe8, 0x07, 0x22, 0xfe, 0x02, 0x0a, 0x12, + 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, + 0x74, 0x73, 0x12, 0x58, 0x0a, 0x08, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, 0x18, 0x01, + 0x20, 0x03, 0x28, 0x0b, 0x32, 0x3c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, + 0x74, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, + 0x65, 0x53, 0x65, 0x74, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, 0x66, 0x61, 0x75, + 0x6c, 0x74, 0x52, 0x08, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, 0x12, 0x41, 0x0a, 0x0f, + 0x6d, 0x69, 0x6e, 0x69, 0x6d, 0x75, 0x6d, 0x5f, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18, + 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, + 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, + 0x0e, 0x6d, 0x69, 0x6e, 0x69, 0x6d, 0x75, 0x6d, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, + 0x41, 0x0a, 0x0f, 0x6d, 0x61, 0x78, 0x69, 0x6d, 0x75, 0x6d, 0x5f, 0x65, 0x64, 0x69, 0x74, 0x69, + 0x6f, 0x6e, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, + 0x6f, 0x6e, 0x52, 0x0e, 0x6d, 0x61, 0x78, 0x69, 0x6d, 0x75, 0x6d, 0x45, 0x64, 0x69, 0x74, 0x69, + 0x6f, 0x6e, 0x1a, 0x87, 0x01, 0x0a, 0x18, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, + 0x74, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x12, + 0x32, 0x0a, 0x07, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0e, + 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x07, 0x65, 0x64, 0x69, 0x74, + 0x69, 0x6f, 0x6e, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, + 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, + 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x22, 0xa7, 0x02, 0x0a, + 0x0e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, + 0x44, 0x0a, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x03, 0x28, + 0x0b, 0x32, 0x28, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x62, 0x75, 0x66, 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, + 0x66, 0x6f, 0x2e, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x08, 0x6c, 0x6f, 0x63, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xce, 0x01, 0x0a, 0x08, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x16, 0x0a, 0x04, 0x70, 0x61, 0x74, 0x68, 0x18, 0x01, 0x20, 0x03, 0x28, 0x05, - 0x42, 0x02, 0x10, 0x01, 0x52, 0x04, 0x70, 0x61, 0x74, 0x68, 0x12, 0x1f, 0x0a, 0x0b, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x5f, 0x66, 0x69, 0x6c, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x0a, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x46, 0x69, 0x6c, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x62, - 0x65, 0x67, 0x69, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05, 0x62, 0x65, 0x67, 0x69, - 0x6e, 0x12, 0x10, 0x0a, 0x03, 0x65, 0x6e, 0x64, 0x18, 0x04, 0x20, 0x01, 0x28, 0x05, 0x52, 0x03, - 0x65, 0x6e, 0x64, 0x12, 0x52, 0x0a, 0x08, 0x73, 0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, 0x18, - 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, - 0x64, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, 0x52, 0x08, 0x73, - 0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, 0x22, 0x28, 0x0a, 0x08, 0x53, 0x65, 0x6d, 0x61, 0x6e, - 0x74, 0x69, 0x63, 0x12, 0x08, 0x0a, 0x04, 0x4e, 0x4f, 0x4e, 0x45, 0x10, 0x00, 0x12, 0x07, 0x0a, - 0x03, 0x53, 0x45, 0x54, 0x10, 0x01, 0x12, 0x09, 0x0a, 0x05, 0x41, 0x4c, 0x49, 0x41, 0x53, 0x10, - 0x02, 0x42, 0x7e, 0x0a, 0x13, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x42, 0x10, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, - 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x73, 0x48, 0x01, 0x5a, 0x2d, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x74, 0x79, 0x70, 0x65, 0x73, 0x2f, 0x64, - 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x70, 0x62, 0xf8, 0x01, 0x01, 0xa2, 0x02, - 0x03, 0x47, 0x50, 0x42, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x50, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x52, 0x65, 0x66, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, - 0x6e, + 0x42, 0x02, 0x10, 0x01, 0x52, 0x04, 0x70, 0x61, 0x74, 0x68, 0x12, 0x16, 0x0a, 0x04, 0x73, 0x70, + 0x61, 0x6e, 0x18, 0x02, 0x20, 0x03, 0x28, 0x05, 0x42, 0x02, 0x10, 0x01, 0x52, 0x04, 0x73, 0x70, + 0x61, 0x6e, 0x12, 0x29, 0x0a, 0x10, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x6f, + 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, 0x6c, 0x65, + 0x61, 0x64, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x12, 0x2b, 0x0a, + 0x11, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, + 0x74, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x10, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x69, + 0x6e, 0x67, 0x43, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x12, 0x3a, 0x0a, 0x19, 0x6c, 0x65, + 0x61, 0x64, 0x69, 0x6e, 0x67, 0x5f, 0x64, 0x65, 0x74, 0x61, 0x63, 0x68, 0x65, 0x64, 0x5f, 0x63, + 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x18, 0x06, 0x20, 0x03, 0x28, 0x09, 0x52, 0x17, 0x6c, + 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x44, 0x65, 0x74, 0x61, 0x63, 0x68, 0x65, 0x64, 0x43, 0x6f, + 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x22, 0xd0, 0x02, 0x0a, 0x11, 0x47, 0x65, 0x6e, 0x65, 0x72, + 0x61, 0x74, 0x65, 0x64, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x4d, 0x0a, 0x0a, + 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, + 0x32, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2e, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x64, 0x43, 0x6f, 0x64, 0x65, + 0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, + 0x0a, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xeb, 0x01, 0x0a, 0x0a, + 0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x16, 0x0a, 0x04, 0x70, 0x61, + 0x74, 0x68, 0x18, 0x01, 0x20, 0x03, 0x28, 0x05, 0x42, 0x02, 0x10, 0x01, 0x52, 0x04, 0x70, 0x61, + 0x74, 0x68, 0x12, 0x1f, 0x0a, 0x0b, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x66, 0x69, 0x6c, + 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0a, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x46, + 0x69, 0x6c, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x62, 0x65, 0x67, 0x69, 0x6e, 0x18, 0x03, 0x20, 0x01, + 0x28, 0x05, 0x52, 0x05, 0x62, 0x65, 0x67, 0x69, 0x6e, 0x12, 0x10, 0x0a, 0x03, 0x65, 0x6e, 0x64, + 0x18, 0x04, 0x20, 0x01, 0x28, 0x05, 0x52, 0x03, 0x65, 0x6e, 0x64, 0x12, 0x52, 0x0a, 0x08, 0x73, + 0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x36, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, + 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x64, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, + 0x6f, 0x2e, 0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x65, 0x6d, + 0x61, 0x6e, 0x74, 0x69, 0x63, 0x52, 0x08, 0x73, 0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, 0x22, + 0x28, 0x0a, 0x08, 0x53, 0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, 0x12, 0x08, 0x0a, 0x04, 0x4e, + 0x4f, 0x4e, 0x45, 0x10, 0x00, 0x12, 0x07, 0x0a, 0x03, 0x53, 0x45, 0x54, 0x10, 0x01, 0x12, 0x09, + 0x0a, 0x05, 0x41, 0x4c, 0x49, 0x41, 0x53, 0x10, 0x02, 0x2a, 0x92, 0x02, 0x0a, 0x07, 0x45, 0x64, + 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x13, 0x0a, 0x0f, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, + 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x13, 0x0a, 0x0e, 0x45, 0x44, + 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x50, 0x52, 0x4f, 0x54, 0x4f, 0x32, 0x10, 0xe6, 0x07, 0x12, + 0x13, 0x0a, 0x0e, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x50, 0x52, 0x4f, 0x54, 0x4f, + 0x33, 0x10, 0xe7, 0x07, 0x12, 0x11, 0x0a, 0x0c, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, + 0x32, 0x30, 0x32, 0x33, 0x10, 0xe8, 0x07, 0x12, 0x11, 0x0a, 0x0c, 0x45, 0x44, 0x49, 0x54, 0x49, + 0x4f, 0x4e, 0x5f, 0x32, 0x30, 0x32, 0x34, 0x10, 0xe9, 0x07, 0x12, 0x17, 0x0a, 0x13, 0x45, 0x44, + 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x31, 0x5f, 0x54, 0x45, 0x53, 0x54, 0x5f, 0x4f, 0x4e, 0x4c, + 0x59, 0x10, 0x01, 0x12, 0x17, 0x0a, 0x13, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x32, + 0x5f, 0x54, 0x45, 0x53, 0x54, 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x02, 0x12, 0x1d, 0x0a, 0x17, + 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x39, 0x39, 0x39, 0x39, 0x37, 0x5f, 0x54, 0x45, + 0x53, 0x54, 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x9d, 0x8d, 0x06, 0x12, 0x1d, 0x0a, 0x17, 0x45, + 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x39, 0x39, 0x39, 0x39, 0x38, 0x5f, 0x54, 0x45, 0x53, + 0x54, 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x9e, 0x8d, 0x06, 0x12, 0x1d, 0x0a, 0x17, 0x45, 0x44, + 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x39, 0x39, 0x39, 0x39, 0x39, 0x5f, 0x54, 0x45, 0x53, 0x54, + 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x9f, 0x8d, 0x06, 0x12, 0x13, 0x0a, 0x0b, 0x45, 0x44, 0x49, + 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x4d, 0x41, 0x58, 0x10, 0xff, 0xff, 0xff, 0xff, 0x07, 0x42, 0x7e, + 0x0a, 0x13, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x62, 0x75, 0x66, 0x42, 0x10, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, + 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x73, 0x48, 0x01, 0x5a, 0x2d, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x74, 0x79, 0x70, 0x65, 0x73, 0x2f, 0x64, 0x65, 0x73, 0x63, + 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x70, 0x62, 0xf8, 0x01, 0x01, 0xa2, 0x02, 0x03, 0x47, 0x50, + 0x42, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x50, 0x72, 0x6f, 0x74, 0x6f, + 0x62, 0x75, 0x66, 0x2e, 0x52, 0x65, 0x66, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, } var ( @@ -4123,103 +5083,136 @@ func file_google_protobuf_descriptor_proto_rawDescGZIP() []byte { return file_google_protobuf_descriptor_proto_rawDescData } -var file_google_protobuf_descriptor_proto_enumTypes = make([]protoimpl.EnumInfo, 10) -var file_google_protobuf_descriptor_proto_msgTypes = make([]protoimpl.MessageInfo, 28) +var file_google_protobuf_descriptor_proto_enumTypes = make([]protoimpl.EnumInfo, 17) +var file_google_protobuf_descriptor_proto_msgTypes = make([]protoimpl.MessageInfo, 32) var file_google_protobuf_descriptor_proto_goTypes = []interface{}{ - (ExtensionRangeOptions_VerificationState)(0), // 0: google.protobuf.ExtensionRangeOptions.VerificationState - (FieldDescriptorProto_Type)(0), // 1: google.protobuf.FieldDescriptorProto.Type - (FieldDescriptorProto_Label)(0), // 2: google.protobuf.FieldDescriptorProto.Label - (FileOptions_OptimizeMode)(0), // 3: google.protobuf.FileOptions.OptimizeMode - (FieldOptions_CType)(0), // 4: google.protobuf.FieldOptions.CType - (FieldOptions_JSType)(0), // 5: google.protobuf.FieldOptions.JSType - (FieldOptions_OptionRetention)(0), // 6: google.protobuf.FieldOptions.OptionRetention - (FieldOptions_OptionTargetType)(0), // 7: google.protobuf.FieldOptions.OptionTargetType - (MethodOptions_IdempotencyLevel)(0), // 8: google.protobuf.MethodOptions.IdempotencyLevel - (GeneratedCodeInfo_Annotation_Semantic)(0), // 9: google.protobuf.GeneratedCodeInfo.Annotation.Semantic - (*FileDescriptorSet)(nil), // 10: google.protobuf.FileDescriptorSet - (*FileDescriptorProto)(nil), // 11: google.protobuf.FileDescriptorProto - (*DescriptorProto)(nil), // 12: google.protobuf.DescriptorProto - (*ExtensionRangeOptions)(nil), // 13: google.protobuf.ExtensionRangeOptions - (*FieldDescriptorProto)(nil), // 14: google.protobuf.FieldDescriptorProto - (*OneofDescriptorProto)(nil), // 15: google.protobuf.OneofDescriptorProto - (*EnumDescriptorProto)(nil), // 16: google.protobuf.EnumDescriptorProto - (*EnumValueDescriptorProto)(nil), // 17: google.protobuf.EnumValueDescriptorProto - (*ServiceDescriptorProto)(nil), // 18: google.protobuf.ServiceDescriptorProto - (*MethodDescriptorProto)(nil), // 19: google.protobuf.MethodDescriptorProto - (*FileOptions)(nil), // 20: google.protobuf.FileOptions - (*MessageOptions)(nil), // 21: google.protobuf.MessageOptions - (*FieldOptions)(nil), // 22: google.protobuf.FieldOptions - (*OneofOptions)(nil), // 23: google.protobuf.OneofOptions - (*EnumOptions)(nil), // 24: google.protobuf.EnumOptions - (*EnumValueOptions)(nil), // 25: google.protobuf.EnumValueOptions - (*ServiceOptions)(nil), // 26: google.protobuf.ServiceOptions - (*MethodOptions)(nil), // 27: google.protobuf.MethodOptions - (*UninterpretedOption)(nil), // 28: google.protobuf.UninterpretedOption - (*SourceCodeInfo)(nil), // 29: google.protobuf.SourceCodeInfo - (*GeneratedCodeInfo)(nil), // 30: google.protobuf.GeneratedCodeInfo - (*DescriptorProto_ExtensionRange)(nil), // 31: google.protobuf.DescriptorProto.ExtensionRange - (*DescriptorProto_ReservedRange)(nil), // 32: google.protobuf.DescriptorProto.ReservedRange - (*ExtensionRangeOptions_Declaration)(nil), // 33: google.protobuf.ExtensionRangeOptions.Declaration - (*EnumDescriptorProto_EnumReservedRange)(nil), // 34: google.protobuf.EnumDescriptorProto.EnumReservedRange - (*UninterpretedOption_NamePart)(nil), // 35: google.protobuf.UninterpretedOption.NamePart - (*SourceCodeInfo_Location)(nil), // 36: google.protobuf.SourceCodeInfo.Location - (*GeneratedCodeInfo_Annotation)(nil), // 37: google.protobuf.GeneratedCodeInfo.Annotation + (Edition)(0), // 0: google.protobuf.Edition + (ExtensionRangeOptions_VerificationState)(0), // 1: google.protobuf.ExtensionRangeOptions.VerificationState + (FieldDescriptorProto_Type)(0), // 2: google.protobuf.FieldDescriptorProto.Type + (FieldDescriptorProto_Label)(0), // 3: google.protobuf.FieldDescriptorProto.Label + (FileOptions_OptimizeMode)(0), // 4: google.protobuf.FileOptions.OptimizeMode + (FieldOptions_CType)(0), // 5: google.protobuf.FieldOptions.CType + (FieldOptions_JSType)(0), // 6: google.protobuf.FieldOptions.JSType + (FieldOptions_OptionRetention)(0), // 7: google.protobuf.FieldOptions.OptionRetention + (FieldOptions_OptionTargetType)(0), // 8: google.protobuf.FieldOptions.OptionTargetType + (MethodOptions_IdempotencyLevel)(0), // 9: google.protobuf.MethodOptions.IdempotencyLevel + (FeatureSet_FieldPresence)(0), // 10: google.protobuf.FeatureSet.FieldPresence + (FeatureSet_EnumType)(0), // 11: google.protobuf.FeatureSet.EnumType + (FeatureSet_RepeatedFieldEncoding)(0), // 12: google.protobuf.FeatureSet.RepeatedFieldEncoding + (FeatureSet_Utf8Validation)(0), // 13: google.protobuf.FeatureSet.Utf8Validation + (FeatureSet_MessageEncoding)(0), // 14: google.protobuf.FeatureSet.MessageEncoding + (FeatureSet_JsonFormat)(0), // 15: google.protobuf.FeatureSet.JsonFormat + (GeneratedCodeInfo_Annotation_Semantic)(0), // 16: google.protobuf.GeneratedCodeInfo.Annotation.Semantic + (*FileDescriptorSet)(nil), // 17: google.protobuf.FileDescriptorSet + (*FileDescriptorProto)(nil), // 18: google.protobuf.FileDescriptorProto + (*DescriptorProto)(nil), // 19: google.protobuf.DescriptorProto + (*ExtensionRangeOptions)(nil), // 20: google.protobuf.ExtensionRangeOptions + (*FieldDescriptorProto)(nil), // 21: google.protobuf.FieldDescriptorProto + (*OneofDescriptorProto)(nil), // 22: google.protobuf.OneofDescriptorProto + (*EnumDescriptorProto)(nil), // 23: google.protobuf.EnumDescriptorProto + (*EnumValueDescriptorProto)(nil), // 24: google.protobuf.EnumValueDescriptorProto + (*ServiceDescriptorProto)(nil), // 25: google.protobuf.ServiceDescriptorProto + (*MethodDescriptorProto)(nil), // 26: google.protobuf.MethodDescriptorProto + (*FileOptions)(nil), // 27: google.protobuf.FileOptions + (*MessageOptions)(nil), // 28: google.protobuf.MessageOptions + (*FieldOptions)(nil), // 29: google.protobuf.FieldOptions + (*OneofOptions)(nil), // 30: google.protobuf.OneofOptions + (*EnumOptions)(nil), // 31: google.protobuf.EnumOptions + (*EnumValueOptions)(nil), // 32: google.protobuf.EnumValueOptions + (*ServiceOptions)(nil), // 33: google.protobuf.ServiceOptions + (*MethodOptions)(nil), // 34: google.protobuf.MethodOptions + (*UninterpretedOption)(nil), // 35: google.protobuf.UninterpretedOption + (*FeatureSet)(nil), // 36: google.protobuf.FeatureSet + (*FeatureSetDefaults)(nil), // 37: google.protobuf.FeatureSetDefaults + (*SourceCodeInfo)(nil), // 38: google.protobuf.SourceCodeInfo + (*GeneratedCodeInfo)(nil), // 39: google.protobuf.GeneratedCodeInfo + (*DescriptorProto_ExtensionRange)(nil), // 40: google.protobuf.DescriptorProto.ExtensionRange + (*DescriptorProto_ReservedRange)(nil), // 41: google.protobuf.DescriptorProto.ReservedRange + (*ExtensionRangeOptions_Declaration)(nil), // 42: google.protobuf.ExtensionRangeOptions.Declaration + (*EnumDescriptorProto_EnumReservedRange)(nil), // 43: google.protobuf.EnumDescriptorProto.EnumReservedRange + (*FieldOptions_EditionDefault)(nil), // 44: google.protobuf.FieldOptions.EditionDefault + (*UninterpretedOption_NamePart)(nil), // 45: google.protobuf.UninterpretedOption.NamePart + (*FeatureSetDefaults_FeatureSetEditionDefault)(nil), // 46: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault + (*SourceCodeInfo_Location)(nil), // 47: google.protobuf.SourceCodeInfo.Location + (*GeneratedCodeInfo_Annotation)(nil), // 48: google.protobuf.GeneratedCodeInfo.Annotation } var file_google_protobuf_descriptor_proto_depIdxs = []int32{ - 11, // 0: google.protobuf.FileDescriptorSet.file:type_name -> google.protobuf.FileDescriptorProto - 12, // 1: google.protobuf.FileDescriptorProto.message_type:type_name -> google.protobuf.DescriptorProto - 16, // 2: google.protobuf.FileDescriptorProto.enum_type:type_name -> google.protobuf.EnumDescriptorProto - 18, // 3: google.protobuf.FileDescriptorProto.service:type_name -> google.protobuf.ServiceDescriptorProto - 14, // 4: google.protobuf.FileDescriptorProto.extension:type_name -> google.protobuf.FieldDescriptorProto - 20, // 5: google.protobuf.FileDescriptorProto.options:type_name -> google.protobuf.FileOptions - 29, // 6: google.protobuf.FileDescriptorProto.source_code_info:type_name -> google.protobuf.SourceCodeInfo - 14, // 7: google.protobuf.DescriptorProto.field:type_name -> google.protobuf.FieldDescriptorProto - 14, // 8: google.protobuf.DescriptorProto.extension:type_name -> google.protobuf.FieldDescriptorProto - 12, // 9: google.protobuf.DescriptorProto.nested_type:type_name -> google.protobuf.DescriptorProto - 16, // 10: google.protobuf.DescriptorProto.enum_type:type_name -> google.protobuf.EnumDescriptorProto - 31, // 11: google.protobuf.DescriptorProto.extension_range:type_name -> google.protobuf.DescriptorProto.ExtensionRange - 15, // 12: google.protobuf.DescriptorProto.oneof_decl:type_name -> google.protobuf.OneofDescriptorProto - 21, // 13: google.protobuf.DescriptorProto.options:type_name -> google.protobuf.MessageOptions - 32, // 14: google.protobuf.DescriptorProto.reserved_range:type_name -> google.protobuf.DescriptorProto.ReservedRange - 28, // 15: google.protobuf.ExtensionRangeOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 33, // 16: google.protobuf.ExtensionRangeOptions.declaration:type_name -> google.protobuf.ExtensionRangeOptions.Declaration - 0, // 17: google.protobuf.ExtensionRangeOptions.verification:type_name -> google.protobuf.ExtensionRangeOptions.VerificationState - 2, // 18: google.protobuf.FieldDescriptorProto.label:type_name -> google.protobuf.FieldDescriptorProto.Label - 1, // 19: google.protobuf.FieldDescriptorProto.type:type_name -> google.protobuf.FieldDescriptorProto.Type - 22, // 20: google.protobuf.FieldDescriptorProto.options:type_name -> google.protobuf.FieldOptions - 23, // 21: google.protobuf.OneofDescriptorProto.options:type_name -> google.protobuf.OneofOptions - 17, // 22: google.protobuf.EnumDescriptorProto.value:type_name -> google.protobuf.EnumValueDescriptorProto - 24, // 23: google.protobuf.EnumDescriptorProto.options:type_name -> google.protobuf.EnumOptions - 34, // 24: google.protobuf.EnumDescriptorProto.reserved_range:type_name -> google.protobuf.EnumDescriptorProto.EnumReservedRange - 25, // 25: google.protobuf.EnumValueDescriptorProto.options:type_name -> google.protobuf.EnumValueOptions - 19, // 26: google.protobuf.ServiceDescriptorProto.method:type_name -> google.protobuf.MethodDescriptorProto - 26, // 27: google.protobuf.ServiceDescriptorProto.options:type_name -> google.protobuf.ServiceOptions - 27, // 28: google.protobuf.MethodDescriptorProto.options:type_name -> google.protobuf.MethodOptions - 3, // 29: google.protobuf.FileOptions.optimize_for:type_name -> google.protobuf.FileOptions.OptimizeMode - 28, // 30: google.protobuf.FileOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 28, // 31: google.protobuf.MessageOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 4, // 32: google.protobuf.FieldOptions.ctype:type_name -> google.protobuf.FieldOptions.CType - 5, // 33: google.protobuf.FieldOptions.jstype:type_name -> google.protobuf.FieldOptions.JSType - 6, // 34: google.protobuf.FieldOptions.retention:type_name -> google.protobuf.FieldOptions.OptionRetention - 7, // 35: google.protobuf.FieldOptions.target:type_name -> google.protobuf.FieldOptions.OptionTargetType - 7, // 36: google.protobuf.FieldOptions.targets:type_name -> google.protobuf.FieldOptions.OptionTargetType - 28, // 37: google.protobuf.FieldOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 28, // 38: google.protobuf.OneofOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 28, // 39: google.protobuf.EnumOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 28, // 40: google.protobuf.EnumValueOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 28, // 41: google.protobuf.ServiceOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 8, // 42: google.protobuf.MethodOptions.idempotency_level:type_name -> google.protobuf.MethodOptions.IdempotencyLevel - 28, // 43: google.protobuf.MethodOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 35, // 44: google.protobuf.UninterpretedOption.name:type_name -> google.protobuf.UninterpretedOption.NamePart - 36, // 45: google.protobuf.SourceCodeInfo.location:type_name -> google.protobuf.SourceCodeInfo.Location - 37, // 46: google.protobuf.GeneratedCodeInfo.annotation:type_name -> google.protobuf.GeneratedCodeInfo.Annotation - 13, // 47: google.protobuf.DescriptorProto.ExtensionRange.options:type_name -> google.protobuf.ExtensionRangeOptions - 9, // 48: google.protobuf.GeneratedCodeInfo.Annotation.semantic:type_name -> google.protobuf.GeneratedCodeInfo.Annotation.Semantic - 49, // [49:49] is the sub-list for method output_type - 49, // [49:49] is the sub-list for method input_type - 49, // [49:49] is the sub-list for extension type_name - 49, // [49:49] is the sub-list for extension extendee - 0, // [0:49] is the sub-list for field type_name + 18, // 0: google.protobuf.FileDescriptorSet.file:type_name -> google.protobuf.FileDescriptorProto + 19, // 1: google.protobuf.FileDescriptorProto.message_type:type_name -> google.protobuf.DescriptorProto + 23, // 2: google.protobuf.FileDescriptorProto.enum_type:type_name -> google.protobuf.EnumDescriptorProto + 25, // 3: google.protobuf.FileDescriptorProto.service:type_name -> google.protobuf.ServiceDescriptorProto + 21, // 4: google.protobuf.FileDescriptorProto.extension:type_name -> google.protobuf.FieldDescriptorProto + 27, // 5: google.protobuf.FileDescriptorProto.options:type_name -> google.protobuf.FileOptions + 38, // 6: google.protobuf.FileDescriptorProto.source_code_info:type_name -> google.protobuf.SourceCodeInfo + 0, // 7: google.protobuf.FileDescriptorProto.edition:type_name -> google.protobuf.Edition + 21, // 8: google.protobuf.DescriptorProto.field:type_name -> google.protobuf.FieldDescriptorProto + 21, // 9: google.protobuf.DescriptorProto.extension:type_name -> google.protobuf.FieldDescriptorProto + 19, // 10: google.protobuf.DescriptorProto.nested_type:type_name -> google.protobuf.DescriptorProto + 23, // 11: google.protobuf.DescriptorProto.enum_type:type_name -> google.protobuf.EnumDescriptorProto + 40, // 12: google.protobuf.DescriptorProto.extension_range:type_name -> google.protobuf.DescriptorProto.ExtensionRange + 22, // 13: google.protobuf.DescriptorProto.oneof_decl:type_name -> google.protobuf.OneofDescriptorProto + 28, // 14: google.protobuf.DescriptorProto.options:type_name -> google.protobuf.MessageOptions + 41, // 15: google.protobuf.DescriptorProto.reserved_range:type_name -> google.protobuf.DescriptorProto.ReservedRange + 35, // 16: google.protobuf.ExtensionRangeOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 42, // 17: google.protobuf.ExtensionRangeOptions.declaration:type_name -> google.protobuf.ExtensionRangeOptions.Declaration + 36, // 18: google.protobuf.ExtensionRangeOptions.features:type_name -> google.protobuf.FeatureSet + 1, // 19: google.protobuf.ExtensionRangeOptions.verification:type_name -> google.protobuf.ExtensionRangeOptions.VerificationState + 3, // 20: google.protobuf.FieldDescriptorProto.label:type_name -> google.protobuf.FieldDescriptorProto.Label + 2, // 21: google.protobuf.FieldDescriptorProto.type:type_name -> google.protobuf.FieldDescriptorProto.Type + 29, // 22: google.protobuf.FieldDescriptorProto.options:type_name -> google.protobuf.FieldOptions + 30, // 23: google.protobuf.OneofDescriptorProto.options:type_name -> google.protobuf.OneofOptions + 24, // 24: google.protobuf.EnumDescriptorProto.value:type_name -> google.protobuf.EnumValueDescriptorProto + 31, // 25: google.protobuf.EnumDescriptorProto.options:type_name -> google.protobuf.EnumOptions + 43, // 26: google.protobuf.EnumDescriptorProto.reserved_range:type_name -> google.protobuf.EnumDescriptorProto.EnumReservedRange + 32, // 27: google.protobuf.EnumValueDescriptorProto.options:type_name -> google.protobuf.EnumValueOptions + 26, // 28: google.protobuf.ServiceDescriptorProto.method:type_name -> google.protobuf.MethodDescriptorProto + 33, // 29: google.protobuf.ServiceDescriptorProto.options:type_name -> google.protobuf.ServiceOptions + 34, // 30: google.protobuf.MethodDescriptorProto.options:type_name -> google.protobuf.MethodOptions + 4, // 31: google.protobuf.FileOptions.optimize_for:type_name -> google.protobuf.FileOptions.OptimizeMode + 36, // 32: google.protobuf.FileOptions.features:type_name -> google.protobuf.FeatureSet + 35, // 33: google.protobuf.FileOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 36, // 34: google.protobuf.MessageOptions.features:type_name -> google.protobuf.FeatureSet + 35, // 35: google.protobuf.MessageOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 5, // 36: google.protobuf.FieldOptions.ctype:type_name -> google.protobuf.FieldOptions.CType + 6, // 37: google.protobuf.FieldOptions.jstype:type_name -> google.protobuf.FieldOptions.JSType + 7, // 38: google.protobuf.FieldOptions.retention:type_name -> google.protobuf.FieldOptions.OptionRetention + 8, // 39: google.protobuf.FieldOptions.targets:type_name -> google.protobuf.FieldOptions.OptionTargetType + 44, // 40: google.protobuf.FieldOptions.edition_defaults:type_name -> google.protobuf.FieldOptions.EditionDefault + 36, // 41: google.protobuf.FieldOptions.features:type_name -> google.protobuf.FeatureSet + 35, // 42: google.protobuf.FieldOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 36, // 43: google.protobuf.OneofOptions.features:type_name -> google.protobuf.FeatureSet + 35, // 44: google.protobuf.OneofOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 36, // 45: google.protobuf.EnumOptions.features:type_name -> google.protobuf.FeatureSet + 35, // 46: google.protobuf.EnumOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 36, // 47: google.protobuf.EnumValueOptions.features:type_name -> google.protobuf.FeatureSet + 35, // 48: google.protobuf.EnumValueOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 36, // 49: google.protobuf.ServiceOptions.features:type_name -> google.protobuf.FeatureSet + 35, // 50: google.protobuf.ServiceOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 9, // 51: google.protobuf.MethodOptions.idempotency_level:type_name -> google.protobuf.MethodOptions.IdempotencyLevel + 36, // 52: google.protobuf.MethodOptions.features:type_name -> google.protobuf.FeatureSet + 35, // 53: google.protobuf.MethodOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 45, // 54: google.protobuf.UninterpretedOption.name:type_name -> google.protobuf.UninterpretedOption.NamePart + 10, // 55: google.protobuf.FeatureSet.field_presence:type_name -> google.protobuf.FeatureSet.FieldPresence + 11, // 56: google.protobuf.FeatureSet.enum_type:type_name -> google.protobuf.FeatureSet.EnumType + 12, // 57: google.protobuf.FeatureSet.repeated_field_encoding:type_name -> google.protobuf.FeatureSet.RepeatedFieldEncoding + 13, // 58: google.protobuf.FeatureSet.utf8_validation:type_name -> google.protobuf.FeatureSet.Utf8Validation + 14, // 59: google.protobuf.FeatureSet.message_encoding:type_name -> google.protobuf.FeatureSet.MessageEncoding + 15, // 60: google.protobuf.FeatureSet.json_format:type_name -> google.protobuf.FeatureSet.JsonFormat + 46, // 61: google.protobuf.FeatureSetDefaults.defaults:type_name -> google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault + 0, // 62: google.protobuf.FeatureSetDefaults.minimum_edition:type_name -> google.protobuf.Edition + 0, // 63: google.protobuf.FeatureSetDefaults.maximum_edition:type_name -> google.protobuf.Edition + 47, // 64: google.protobuf.SourceCodeInfo.location:type_name -> google.protobuf.SourceCodeInfo.Location + 48, // 65: google.protobuf.GeneratedCodeInfo.annotation:type_name -> google.protobuf.GeneratedCodeInfo.Annotation + 20, // 66: google.protobuf.DescriptorProto.ExtensionRange.options:type_name -> google.protobuf.ExtensionRangeOptions + 0, // 67: google.protobuf.FieldOptions.EditionDefault.edition:type_name -> google.protobuf.Edition + 0, // 68: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.edition:type_name -> google.protobuf.Edition + 36, // 69: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.features:type_name -> google.protobuf.FeatureSet + 16, // 70: google.protobuf.GeneratedCodeInfo.Annotation.semantic:type_name -> google.protobuf.GeneratedCodeInfo.Annotation.Semantic + 71, // [71:71] is the sub-list for method output_type + 71, // [71:71] is the sub-list for method input_type + 71, // [71:71] is the sub-list for extension type_name + 71, // [71:71] is the sub-list for extension extendee + 0, // [0:71] is the sub-list for field type_name } func init() { file_google_protobuf_descriptor_proto_init() } @@ -4475,19 +5468,21 @@ func file_google_protobuf_descriptor_proto_init() { } } file_google_protobuf_descriptor_proto_msgTypes[19].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*SourceCodeInfo); i { + switch v := v.(*FeatureSet); i { case 0: return &v.state case 1: return &v.sizeCache case 2: return &v.unknownFields + case 3: + return &v.extensionFields default: return nil } } file_google_protobuf_descriptor_proto_msgTypes[20].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*GeneratedCodeInfo); i { + switch v := v.(*FeatureSetDefaults); i { case 0: return &v.state case 1: @@ -4499,7 +5494,7 @@ func file_google_protobuf_descriptor_proto_init() { } } file_google_protobuf_descriptor_proto_msgTypes[21].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*DescriptorProto_ExtensionRange); i { + switch v := v.(*SourceCodeInfo); i { case 0: return &v.state case 1: @@ -4511,7 +5506,7 @@ func file_google_protobuf_descriptor_proto_init() { } } file_google_protobuf_descriptor_proto_msgTypes[22].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*DescriptorProto_ReservedRange); i { + switch v := v.(*GeneratedCodeInfo); i { case 0: return &v.state case 1: @@ -4523,7 +5518,7 @@ func file_google_protobuf_descriptor_proto_init() { } } file_google_protobuf_descriptor_proto_msgTypes[23].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ExtensionRangeOptions_Declaration); i { + switch v := v.(*DescriptorProto_ExtensionRange); i { case 0: return &v.state case 1: @@ -4535,7 +5530,7 @@ func file_google_protobuf_descriptor_proto_init() { } } file_google_protobuf_descriptor_proto_msgTypes[24].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*EnumDescriptorProto_EnumReservedRange); i { + switch v := v.(*DescriptorProto_ReservedRange); i { case 0: return &v.state case 1: @@ -4547,7 +5542,7 @@ func file_google_protobuf_descriptor_proto_init() { } } file_google_protobuf_descriptor_proto_msgTypes[25].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*UninterpretedOption_NamePart); i { + switch v := v.(*ExtensionRangeOptions_Declaration); i { case 0: return &v.state case 1: @@ -4559,7 +5554,7 @@ func file_google_protobuf_descriptor_proto_init() { } } file_google_protobuf_descriptor_proto_msgTypes[26].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*SourceCodeInfo_Location); i { + switch v := v.(*EnumDescriptorProto_EnumReservedRange); i { case 0: return &v.state case 1: @@ -4571,6 +5566,54 @@ func file_google_protobuf_descriptor_proto_init() { } } file_google_protobuf_descriptor_proto_msgTypes[27].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*FieldOptions_EditionDefault); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_google_protobuf_descriptor_proto_msgTypes[28].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*UninterpretedOption_NamePart); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_google_protobuf_descriptor_proto_msgTypes[29].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*FeatureSetDefaults_FeatureSetEditionDefault); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_google_protobuf_descriptor_proto_msgTypes[30].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*SourceCodeInfo_Location); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_google_protobuf_descriptor_proto_msgTypes[31].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*GeneratedCodeInfo_Annotation); i { case 0: return &v.state @@ -4588,8 +5631,8 @@ func file_google_protobuf_descriptor_proto_init() { File: protoimpl.DescBuilder{ GoPackagePath: reflect.TypeOf(x{}).PkgPath(), RawDescriptor: file_google_protobuf_descriptor_proto_rawDesc, - NumEnums: 10, - NumMessages: 28, + NumEnums: 17, + NumMessages: 32, NumExtensions: 0, NumServices: 0, }, diff --git a/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.pb.go b/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.pb.go new file mode 100644 index 000000000..25de5ae00 --- /dev/null +++ b/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.pb.go @@ -0,0 +1,177 @@ +// Protocol Buffers - Google's data interchange format +// Copyright 2023 Google Inc. All rights reserved. +// +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file or at +// https://developers.google.com/open-source/licenses/bsd + +// Code generated by protoc-gen-go. DO NOT EDIT. +// source: reflect/protodesc/proto/go_features.proto + +package proto + +import ( + protoreflect "google.golang.org/protobuf/reflect/protoreflect" + protoimpl "google.golang.org/protobuf/runtime/protoimpl" + descriptorpb "google.golang.org/protobuf/types/descriptorpb" + reflect "reflect" + sync "sync" +) + +type GoFeatures struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Whether or not to generate the deprecated UnmarshalJSON method for enums. + LegacyUnmarshalJsonEnum *bool `protobuf:"varint,1,opt,name=legacy_unmarshal_json_enum,json=legacyUnmarshalJsonEnum" json:"legacy_unmarshal_json_enum,omitempty"` +} + +func (x *GoFeatures) Reset() { + *x = GoFeatures{} + if protoimpl.UnsafeEnabled { + mi := &file_reflect_protodesc_proto_go_features_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *GoFeatures) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*GoFeatures) ProtoMessage() {} + +func (x *GoFeatures) ProtoReflect() protoreflect.Message { + mi := &file_reflect_protodesc_proto_go_features_proto_msgTypes[0] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use GoFeatures.ProtoReflect.Descriptor instead. +func (*GoFeatures) Descriptor() ([]byte, []int) { + return file_reflect_protodesc_proto_go_features_proto_rawDescGZIP(), []int{0} +} + +func (x *GoFeatures) GetLegacyUnmarshalJsonEnum() bool { + if x != nil && x.LegacyUnmarshalJsonEnum != nil { + return *x.LegacyUnmarshalJsonEnum + } + return false +} + +var file_reflect_protodesc_proto_go_features_proto_extTypes = []protoimpl.ExtensionInfo{ + { + ExtendedType: (*descriptorpb.FeatureSet)(nil), + ExtensionType: (*GoFeatures)(nil), + Field: 1002, + Name: "google.protobuf.go", + Tag: "bytes,1002,opt,name=go", + Filename: "reflect/protodesc/proto/go_features.proto", + }, +} + +// Extension fields to descriptorpb.FeatureSet. +var ( + // optional google.protobuf.GoFeatures go = 1002; + E_Go = &file_reflect_protodesc_proto_go_features_proto_extTypes[0] +) + +var File_reflect_protodesc_proto_go_features_proto protoreflect.FileDescriptor + +var file_reflect_protodesc_proto_go_features_proto_rawDesc = []byte{ + 0x0a, 0x29, 0x72, 0x65, 0x66, 0x6c, 0x65, 0x63, 0x74, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x64, + 0x65, 0x73, 0x63, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x6f, 0x5f, 0x66, 0x65, 0x61, + 0x74, 0x75, 0x72, 0x65, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x0f, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x1a, 0x20, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x64, 0x65, + 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0x6a, + 0x0a, 0x0a, 0x47, 0x6f, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x5c, 0x0a, 0x1a, + 0x6c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x5f, 0x75, 0x6e, 0x6d, 0x61, 0x72, 0x73, 0x68, 0x61, 0x6c, + 0x5f, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x65, 0x6e, 0x75, 0x6d, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, + 0x42, 0x1f, 0x88, 0x01, 0x01, 0x98, 0x01, 0x06, 0xa2, 0x01, 0x09, 0x12, 0x04, 0x74, 0x72, 0x75, + 0x65, 0x18, 0xe6, 0x07, 0xa2, 0x01, 0x0a, 0x12, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x18, 0xe7, + 0x07, 0x52, 0x17, 0x6c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x55, 0x6e, 0x6d, 0x61, 0x72, 0x73, 0x68, + 0x61, 0x6c, 0x4a, 0x73, 0x6f, 0x6e, 0x45, 0x6e, 0x75, 0x6d, 0x3a, 0x49, 0x0a, 0x02, 0x67, 0x6f, + 0x12, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x18, 0xea, 0x07, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x47, 0x6f, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, + 0x73, 0x52, 0x02, 0x67, 0x6f, 0x42, 0x34, 0x5a, 0x32, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x62, 0x75, 0x66, 0x2f, 0x72, 0x65, 0x66, 0x6c, 0x65, 0x63, 0x74, 0x2f, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x64, 0x65, 0x73, 0x63, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, +} + +var ( + file_reflect_protodesc_proto_go_features_proto_rawDescOnce sync.Once + file_reflect_protodesc_proto_go_features_proto_rawDescData = file_reflect_protodesc_proto_go_features_proto_rawDesc +) + +func file_reflect_protodesc_proto_go_features_proto_rawDescGZIP() []byte { + file_reflect_protodesc_proto_go_features_proto_rawDescOnce.Do(func() { + file_reflect_protodesc_proto_go_features_proto_rawDescData = protoimpl.X.CompressGZIP(file_reflect_protodesc_proto_go_features_proto_rawDescData) + }) + return file_reflect_protodesc_proto_go_features_proto_rawDescData +} + +var file_reflect_protodesc_proto_go_features_proto_msgTypes = make([]protoimpl.MessageInfo, 1) +var file_reflect_protodesc_proto_go_features_proto_goTypes = []interface{}{ + (*GoFeatures)(nil), // 0: google.protobuf.GoFeatures + (*descriptorpb.FeatureSet)(nil), // 1: google.protobuf.FeatureSet +} +var file_reflect_protodesc_proto_go_features_proto_depIdxs = []int32{ + 1, // 0: google.protobuf.go:extendee -> google.protobuf.FeatureSet + 0, // 1: google.protobuf.go:type_name -> google.protobuf.GoFeatures + 2, // [2:2] is the sub-list for method output_type + 2, // [2:2] is the sub-list for method input_type + 1, // [1:2] is the sub-list for extension type_name + 0, // [0:1] is the sub-list for extension extendee + 0, // [0:0] is the sub-list for field type_name +} + +func init() { file_reflect_protodesc_proto_go_features_proto_init() } +func file_reflect_protodesc_proto_go_features_proto_init() { + if File_reflect_protodesc_proto_go_features_proto != nil { + return + } + if !protoimpl.UnsafeEnabled { + file_reflect_protodesc_proto_go_features_proto_msgTypes[0].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*GoFeatures); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + } + type x struct{} + out := protoimpl.TypeBuilder{ + File: protoimpl.DescBuilder{ + GoPackagePath: reflect.TypeOf(x{}).PkgPath(), + RawDescriptor: file_reflect_protodesc_proto_go_features_proto_rawDesc, + NumEnums: 0, + NumMessages: 1, + NumExtensions: 1, + NumServices: 0, + }, + GoTypes: file_reflect_protodesc_proto_go_features_proto_goTypes, + DependencyIndexes: file_reflect_protodesc_proto_go_features_proto_depIdxs, + MessageInfos: file_reflect_protodesc_proto_go_features_proto_msgTypes, + ExtensionInfos: file_reflect_protodesc_proto_go_features_proto_extTypes, + }.Build() + File_reflect_protodesc_proto_go_features_proto = out.File + file_reflect_protodesc_proto_go_features_proto_rawDesc = nil + file_reflect_protodesc_proto_go_features_proto_goTypes = nil + file_reflect_protodesc_proto_go_features_proto_depIdxs = nil +} diff --git a/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.proto b/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.proto new file mode 100644 index 000000000..d24657129 --- /dev/null +++ b/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.proto @@ -0,0 +1,28 @@ +// Protocol Buffers - Google's data interchange format +// Copyright 2023 Google Inc. All rights reserved. +// +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file or at +// https://developers.google.com/open-source/licenses/bsd + +syntax = "proto2"; + +package google.protobuf; + +import "google/protobuf/descriptor.proto"; + +option go_package = "google.golang.org/protobuf/types/gofeaturespb"; + +extend google.protobuf.FeatureSet { + optional GoFeatures go = 1002; +} + +message GoFeatures { + // Whether or not to generate the deprecated UnmarshalJSON method for enums. + optional bool legacy_unmarshal_json_enum = 1 [ + retention = RETENTION_RUNTIME, + targets = TARGET_TYPE_ENUM, + edition_defaults = { edition: EDITION_PROTO2, value: "true" }, + edition_defaults = { edition: EDITION_PROTO3, value: "false" } + ]; +} diff --git a/vendor/google.golang.org/protobuf/types/known/anypb/any.pb.go b/vendor/google.golang.org/protobuf/types/known/anypb/any.pb.go index 580b232f4..9de51be54 100644 --- a/vendor/google.golang.org/protobuf/types/known/anypb/any.pb.go +++ b/vendor/google.golang.org/protobuf/types/known/anypb/any.pb.go @@ -237,7 +237,8 @@ type Any struct { // // Note: this functionality is not currently available in the official // protobuf release, and it is not used for type URLs beginning with - // type.googleapis.com. + // type.googleapis.com. As of May 2023, there are no widely used type server + // implementations and no plans to implement one. // // Schemes other than `http`, `https` (or the empty scheme) might be // used with implementation specific semantics. diff --git a/vendor/modules.txt b/vendor/modules.txt index c2f16b105..2079a35e5 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -97,7 +97,7 @@ github.com/beorn7/perks/quantile ## explicit; go 1.14 github.com/buckket/go-blurhash github.com/buckket/go-blurhash/base83 -# github.com/bytedance/sonic v1.10.1 +# github.com/bytedance/sonic v1.11.2 ## explicit; go 1.16 github.com/bytedance/sonic github.com/bytedance/sonic/ast @@ -129,7 +129,7 @@ github.com/cespare/xxhash/v2 # github.com/chenzhuoyu/base64x v0.0.0-20230717121745-296ad89f973d ## explicit; go 1.16 github.com/chenzhuoyu/base64x -# github.com/chenzhuoyu/iasm v0.9.0 +# github.com/chenzhuoyu/iasm v0.9.1 ## explicit; go 1.16 github.com/chenzhuoyu/iasm/expr github.com/chenzhuoyu/iasm/x86_64 @@ -194,13 +194,13 @@ github.com/felixge/httpsnoop # github.com/fsnotify/fsnotify v1.7.0 ## explicit; go 1.17 github.com/fsnotify/fsnotify -# github.com/gabriel-vasile/mimetype v1.4.2 +# github.com/gabriel-vasile/mimetype v1.4.3 ## explicit; go 1.20 github.com/gabriel-vasile/mimetype github.com/gabriel-vasile/mimetype/internal/charset github.com/gabriel-vasile/mimetype/internal/json github.com/gabriel-vasile/mimetype/internal/magic -# github.com/gin-contrib/cors v1.5.0 +# github.com/gin-contrib/cors v1.7.0 ## explicit; go 1.18 github.com/gin-contrib/cors # github.com/gin-contrib/gzip v0.0.6 @@ -295,7 +295,7 @@ github.com/go-playground/locales/currency # github.com/go-playground/universal-translator v0.18.1 ## explicit; go 1.18 github.com/go-playground/universal-translator -# github.com/go-playground/validator/v10 v10.15.5 +# github.com/go-playground/validator/v10 v10.19.0 ## explicit; go 1.18 github.com/go-playground/validator/v10 # github.com/go-swagger/go-swagger v0.30.5 @@ -446,7 +446,7 @@ github.com/klauspost/compress/gzip github.com/klauspost/compress/s2 github.com/klauspost/compress/snappy github.com/klauspost/compress/zlib -# github.com/klauspost/cpuid/v2 v2.2.6 +# github.com/klauspost/cpuid/v2 v2.2.7 ## explicit; go 1.15 github.com/klauspost/cpuid/v2 # github.com/kr/pretty v0.3.1 @@ -455,9 +455,10 @@ github.com/kr/pretty # github.com/kr/text v0.2.0 ## explicit github.com/kr/text -# github.com/leodido/go-urn v1.2.4 -## explicit; go 1.16 +# github.com/leodido/go-urn v1.4.0 +## explicit; go 1.18 github.com/leodido/go-urn +github.com/leodido/go-urn/scim/schema # github.com/magiconair/properties v1.8.7 ## explicit; go 1.19 github.com/magiconair/properties @@ -844,7 +845,7 @@ github.com/twitchyliquid64/golang-asm/objabi github.com/twitchyliquid64/golang-asm/src github.com/twitchyliquid64/golang-asm/sys github.com/twitchyliquid64/golang-asm/unsafeheader -# github.com/ugorji/go/codec v1.2.11 +# github.com/ugorji/go/codec v1.2.12 ## explicit; go 1.11 github.com/ugorji/go/codec # github.com/ulule/limiter/v3 v3.11.2 @@ -989,10 +990,10 @@ go.uber.org/automaxprocs/maxprocs # go.uber.org/multierr v1.11.0 ## explicit; go 1.19 go.uber.org/multierr -# golang.org/x/arch v0.5.0 -## explicit; go 1.17 +# golang.org/x/arch v0.7.0 +## explicit; go 1.18 golang.org/x/arch/x86/x86asm -# golang.org/x/crypto v0.20.0 +# golang.org/x/crypto v0.21.0 ## explicit; go 1.18 golang.org/x/crypto/acme golang.org/x/crypto/acme/autocert @@ -1035,7 +1036,7 @@ golang.org/x/image/webp golang.org/x/mod/internal/lazyregexp golang.org/x/mod/module golang.org/x/mod/semver -# golang.org/x/net v0.21.0 +# golang.org/x/net v0.22.0 ## explicit; go 1.18 golang.org/x/net/bpf golang.org/x/net/context @@ -1062,7 +1063,7 @@ golang.org/x/oauth2/internal # golang.org/x/sync v0.6.0 ## explicit; go 1.18 golang.org/x/sync/semaphore -# golang.org/x/sys v0.17.0 +# golang.org/x/sys v0.18.0 ## explicit; go 1.18 golang.org/x/sys/cpu golang.org/x/sys/unix @@ -1185,14 +1186,15 @@ google.golang.org/grpc/serviceconfig google.golang.org/grpc/stats google.golang.org/grpc/status google.golang.org/grpc/tap -# google.golang.org/protobuf v1.31.0 -## explicit; go 1.11 +# google.golang.org/protobuf v1.33.0 +## explicit; go 1.17 google.golang.org/protobuf/encoding/protojson google.golang.org/protobuf/encoding/prototext google.golang.org/protobuf/encoding/protowire google.golang.org/protobuf/internal/descfmt google.golang.org/protobuf/internal/descopts google.golang.org/protobuf/internal/detrand +google.golang.org/protobuf/internal/editiondefaults google.golang.org/protobuf/internal/encoding/defval google.golang.org/protobuf/internal/encoding/json google.golang.org/protobuf/internal/encoding/messageset @@ -1216,6 +1218,7 @@ google.golang.org/protobuf/reflect/protoregistry google.golang.org/protobuf/runtime/protoiface google.golang.org/protobuf/runtime/protoimpl google.golang.org/protobuf/types/descriptorpb +google.golang.org/protobuf/types/gofeaturespb google.golang.org/protobuf/types/known/anypb google.golang.org/protobuf/types/known/durationpb google.golang.org/protobuf/types/known/fieldmaskpb -- cgit v1.3