diff options
Diffstat (limited to 'vendor/github.com')
378 files changed, 47664 insertions, 8012 deletions
diff --git a/vendor/github.com/coreos/go-oidc/v3/oidc/jwks.go b/vendor/github.com/coreos/go-oidc/v3/oidc/jwks.go index a272b7ab2..fdcfba81e 100644 --- a/vendor/github.com/coreos/go-oidc/v3/oidc/jwks.go +++ b/vendor/github.com/coreos/go-oidc/v3/oidc/jwks.go @@ -2,6 +2,9 @@ package oidc import ( "context" + "crypto" + "crypto/ecdsa" + "crypto/rsa" "errors" "fmt" "io/ioutil" @@ -12,6 +15,35 @@ import ( jose "gopkg.in/square/go-jose.v2" ) +// StaticKeySet is a verifier that validates JWT against a static set of public keys. +type StaticKeySet struct { + // PublicKeys used to verify the JWT. Supported types are *rsa.PublicKey and + // *ecdsa.PublicKey. + PublicKeys []crypto.PublicKey +} + +// VerifySignature compares the signature against a static set of public keys. +func (s *StaticKeySet) VerifySignature(ctx context.Context, jwt string) ([]byte, error) { + jws, err := jose.ParseSigned(jwt) + if err != nil { + return nil, fmt.Errorf("parsing jwt: %v", err) + } + for _, pub := range s.PublicKeys { + switch pub.(type) { + case *rsa.PublicKey: + case *ecdsa.PublicKey: + default: + return nil, fmt.Errorf("invalid public key type provided: %T", pub) + } + payload, err := jws.Verify(pub) + if err != nil { + continue + } + return payload, nil + } + return nil, fmt.Errorf("no public keys able to verify jwt") +} + // NewRemoteKeySet returns a KeySet that can validate JSON web tokens by using HTTP // GETs to fetch JSON web token sets hosted at a remote URL. This is automatically // used by NewProvider using the URLs returned by OpenID Connect discovery, but is @@ -81,15 +113,23 @@ func (i *inflight) result() ([]jose.JSONWebKey, error) { return i.keys, i.err } +// paresdJWTKey is a context key that allows common setups to avoid parsing the +// JWT twice. It holds a *jose.JSONWebSignature value. +var parsedJWTKey contextKey + // VerifySignature validates a payload against a signature from the jwks_uri. // // Users MUST NOT call this method directly and should use an IDTokenVerifier // instead. This method skips critical validations such as 'alg' values and is // only exported to implement the KeySet interface. func (r *RemoteKeySet) VerifySignature(ctx context.Context, jwt string) ([]byte, error) { - jws, err := jose.ParseSigned(jwt) - if err != nil { - return nil, fmt.Errorf("oidc: malformed jwt: %v", err) + jws, ok := ctx.Value(parsedJWTKey).(*jose.JSONWebSignature) + if !ok { + var err error + jws, err = jose.ParseSigned(jwt) + if err != nil { + return nil, fmt.Errorf("oidc: malformed jwt: %v", err) + } } return r.verify(ctx, jws) } diff --git a/vendor/github.com/coreos/go-oidc/v3/oidc/oidc.go b/vendor/github.com/coreos/go-oidc/v3/oidc/oidc.go index 3e1d80e08..ae73eb028 100644 --- a/vendor/github.com/coreos/go-oidc/v3/oidc/oidc.go +++ b/vendor/github.com/coreos/go-oidc/v3/oidc/oidc.go @@ -134,6 +134,48 @@ var supportedAlgorithms = map[string]bool{ PS512: true, } +// ProviderConfig allows creating providers when discovery isn't supported. It's +// generally easier to use NewProvider directly. +type ProviderConfig struct { + // IssuerURL is the identity of the provider, and the string it uses to sign + // ID tokens with. For example "https://accounts.google.com". This value MUST + // match ID tokens exactly. + IssuerURL string + // AuthURL is the endpoint used by the provider to support the OAuth 2.0 + // authorization endpoint. + AuthURL string + // TokenURL is the endpoint used by the provider to support the OAuth 2.0 + // token endpoint. + TokenURL string + // UserInfoURL is the endpoint used by the provider to support the OpenID + // Connect UserInfo flow. + // + // https://openid.net/specs/openid-connect-core-1_0.html#UserInfo + UserInfoURL string + // JWKSURL is the endpoint used by the provider to advertise public keys to + // verify issued ID tokens. This endpoint is polled as new keys are made + // available. + JWKSURL string + + // Algorithms, if provided, indicate a list of JWT algorithms allowed to sign + // ID tokens. If not provided, this defaults to the algorithms advertised by + // the JWK endpoint, then the set of algorithms supported by this package. + Algorithms []string +} + +// NewProvider initializes a provider from a set of endpoints, rather than +// through discovery. +func (p *ProviderConfig) NewProvider(ctx context.Context) *Provider { + return &Provider{ + issuer: p.IssuerURL, + authURL: p.AuthURL, + tokenURL: p.TokenURL, + userInfoURL: p.UserInfoURL, + algorithms: p.Algorithms, + remoteKeySet: NewRemoteKeySet(cloneContext(ctx), p.JWKSURL), + } +} + // NewProvider uses the OpenID Connect discovery mechanism to construct a Provider. // // The issuer is the URL identifier for the service. For example: "https://accounts.google.com" diff --git a/vendor/github.com/coreos/go-oidc/v3/oidc/verify.go b/vendor/github.com/coreos/go-oidc/v3/oidc/verify.go index dc6b56dfe..b0dd60fa9 100644 --- a/vendor/github.com/coreos/go-oidc/v3/oidc/verify.go +++ b/vendor/github.com/coreos/go-oidc/v3/oidc/verify.go @@ -21,6 +21,18 @@ const ( issuerGoogleAccountsNoScheme = "accounts.google.com" ) +// TokenExpiredError indicates that Verify failed because the token was expired. This +// error does NOT indicate that the token is not also invalid for other reasons. Other +// checks might have failed if the expiration check had not failed. +type TokenExpiredError struct { + // Expiry is the time when the token expired. + Expiry time.Time +} + +func (e *TokenExpiredError) Error() string { + return fmt.Sprintf("oidc: token is expired (Token Expiry: %v)", e.Expiry) +} + // KeySet is a set of publc JSON Web Keys that can be used to validate the signature // of JSON web tokens. This is expected to be backed by a remote key set through // provider metadata discovery or an in-memory set of keys delivered out-of-band. @@ -55,15 +67,10 @@ type IDTokenVerifier struct { // keySet := oidc.NewRemoteKeySet(ctx, "https://www.googleapis.com/oauth2/v3/certs") // verifier := oidc.NewVerifier("https://accounts.google.com", keySet, config) // -// Since KeySet is an interface, this constructor can also be used to supply custom -// public key sources. For example, if a user wanted to supply public keys out-of-band -// and hold them statically in-memory: -// -// // Custom KeySet implementation. -// keySet := newStatisKeySet(publicKeys...) +// Or a static key set (e.g. for testing): // -// // Verifier uses the custom KeySet implementation. -// verifier := oidc.NewVerifier("https://auth.example.com", keySet, config) +// keySet := &oidc.StaticKeySet{PublicKeys: []crypto.PublicKey{pub1, pub2}} +// verifier := oidc.NewVerifier("https://accounts.google.com", keySet, config) // func NewVerifier(issuerURL string, keySet KeySet, config *Config) *IDTokenVerifier { return &IDTokenVerifier{keySet: keySet, config: config, issuer: issuerURL} @@ -100,12 +107,20 @@ type Config struct { // Time function to check Token expiry. Defaults to time.Now Now func() time.Time + + // InsecureSkipSignatureCheck causes this package to skip JWT signature validation. + // It's intended for special cases where providers (such as Azure), use the "none" + // algorithm. + // + // This option can only be enabled safely when the ID Token is received directly + // from the provider after the token exchange. + // + // This option MUST NOT be used when receiving an ID Token from sources other + // than the token endpoint. + InsecureSkipSignatureCheck bool } // Verifier returns an IDTokenVerifier that uses the provider's key set to verify JWTs. -// -// The returned IDTokenVerifier is tied to the Provider's context and its behavior is -// undefined once the Provider's context is canceled. func (p *Provider) Verifier(config *Config) *IDTokenVerifier { if len(config.SupportedSigningAlgs) == 0 && len(p.algorithms) > 0 { // Make a copy so we don't modify the config values. @@ -192,11 +207,6 @@ func resolveDistributedClaim(ctx context.Context, verifier *IDTokenVerifier, src // token, err := verifier.Verify(ctx, rawIDToken) // func (v *IDTokenVerifier) Verify(ctx context.Context, rawIDToken string) (*IDToken, error) { - jws, err := jose.ParseSigned(rawIDToken) - if err != nil { - return nil, fmt.Errorf("oidc: malformed jwt: %v", err) - } - // Throw out tokens with invalid claims before trying to verify the token. This lets // us do cheap checks before possibly re-syncing keys. payload, err := parseJWT(rawIDToken) @@ -268,13 +278,15 @@ func (v *IDTokenVerifier) Verify(ctx context.Context, rawIDToken string) (*IDTok nowTime := now() if t.Expiry.Before(nowTime) { - return nil, fmt.Errorf("oidc: token is expired (Token Expiry: %v)", t.Expiry) + return nil, &TokenExpiredError{Expiry: t.Expiry} } // If nbf claim is provided in token, ensure that it is indeed in the past. if token.NotBefore != nil { nbfTime := time.Time(*token.NotBefore) - leeway := 1 * time.Minute + // Set to 5 minutes since this is what other OpenID Connect providers do to deal with clock skew. + // https://github.com/AzureAD/azure-activedirectory-identitymodel-extensions-for-dotnet/blob/6.12.2/src/Microsoft.IdentityModel.Tokens/TokenValidationParameters.cs#L149-L153 + leeway := 5 * time.Minute if nowTime.Add(leeway).Before(nbfTime) { return nil, fmt.Errorf("oidc: current time %v before the nbf (not before) time: %v", nowTime, nbfTime) @@ -282,6 +294,15 @@ func (v *IDTokenVerifier) Verify(ctx context.Context, rawIDToken string) (*IDTok } } + if v.config.InsecureSkipSignatureCheck { + return t, nil + } + + jws, err := jose.ParseSigned(rawIDToken) + if err != nil { + return nil, fmt.Errorf("oidc: malformed jwt: %v", err) + } + switch len(jws.Signatures) { case 0: return nil, fmt.Errorf("oidc: id token not signed") @@ -302,6 +323,7 @@ func (v *IDTokenVerifier) Verify(ctx context.Context, rawIDToken string) (*IDTok t.sigAlgorithm = sig.Header.Algorithm + ctx = context.WithValue(ctx, parsedJWTKey, jws) gotPayload, err := v.keySet.VerifySignature(ctx, rawIDToken) if err != nil { return nil, fmt.Errorf("failed to verify signature: %v", err) diff --git a/vendor/github.com/gin-contrib/cors/.golangci.yml b/vendor/github.com/gin-contrib/cors/.golangci.yml new file mode 100644 index 000000000..5a0031c30 --- /dev/null +++ b/vendor/github.com/gin-contrib/cors/.golangci.yml @@ -0,0 +1,43 @@ +linters: + enable-all: false + disable-all: true + fast: false + enable: + - bodyclose + - deadcode + - depguard + - dogsled + - dupl + - errcheck + - exportloopref + - exhaustive + - gochecknoinits + - goconst + - gocritic + - gocyclo + - gofmt + - goimports + - goprintffuncname + - gosec + - gosimple + - govet + - ineffassign + - lll + - misspell + - nakedret + - noctx + - nolintlint + - rowserrcheck + - staticcheck + - structcheck + - stylecheck + - typecheck + - unconvert + - unparam + - unused + - varcheck + - whitespace + - gofumpt + +run: + timeout: 3m diff --git a/vendor/github.com/gin-contrib/cors/.goreleaser.yaml b/vendor/github.com/gin-contrib/cors/.goreleaser.yaml new file mode 100644 index 000000000..aa5453cfc --- /dev/null +++ b/vendor/github.com/gin-contrib/cors/.goreleaser.yaml @@ -0,0 +1,57 @@ +project_name: queue + +builds: + - + # If true, skip the build. + # Useful for library projects. + # Default is false + skip: true + +changelog: + # Set it to true if you wish to skip the changelog generation. + # This may result in an empty release notes on GitHub/GitLab/Gitea. + skip: false + + # Changelog generation implementation to use. + # + # Valid options are: + # - `git`: uses `git log`; + # - `github`: uses the compare GitHub API, appending the author login to the changelog. + # - `gitlab`: uses the compare GitLab API, appending the author name and email to the changelog. + # - `github-native`: uses the GitHub release notes generation API, disables the groups feature. + # + # Defaults to `git`. + use: git + + # Sorts the changelog by the commit's messages. + # Could either be asc, desc or empty + # Default is empty + sort: asc + + # Group commits messages by given regex and title. + # Order value defines the order of the groups. + # Proving no regex means all commits will be grouped under the default group. + # Groups are disabled when using github-native, as it already groups things by itself. + # + # Default is no groups. + groups: + - title: Features + regexp: "^.*feat[(\\w)]*:+.*$" + order: 0 + - title: 'Bug fixes' + regexp: "^.*fix[(\\w)]*:+.*$" + order: 1 + - title: 'Enhancements' + regexp: "^.*chore[(\\w)]*:+.*$" + order: 2 + - title: Others + order: 999 + + filters: + # Commit messages matching the regexp listed here will be removed from + # the changelog + # Default is empty + exclude: + - '^docs' + - 'CICD' + - typo diff --git a/vendor/github.com/gin-contrib/cors/.travis.yml b/vendor/github.com/gin-contrib/cors/.travis.yml deleted file mode 100644 index e5308a10d..000000000 --- a/vendor/github.com/gin-contrib/cors/.travis.yml +++ /dev/null @@ -1,31 +0,0 @@ -language: go -sudo: false - -go: - - 1.11.x - - 1.12.x - - 1.13.x - - 1.14.x - - master - -matrix: - fast_finish: true - include: - - go: 1.11.x - env: GO111MODULE=on - - go: 1.12.x - env: GO111MODULE=on - -script: - - go test -v -covermode=atomic -coverprofile=coverage.out - -after_success: - - bash <(curl -s https://codecov.io/bash) - -notifications: - webhooks: - urls: - - https://webhooks.gitter.im/e/acc2c57482e94b44f557 - on_success: change - on_failure: always - on_start: false diff --git a/vendor/github.com/gin-contrib/cors/README.md b/vendor/github.com/gin-contrib/cors/README.md index bd567b10b..6289994d0 100644 --- a/vendor/github.com/gin-contrib/cors/README.md +++ b/vendor/github.com/gin-contrib/cors/README.md @@ -1,10 +1,9 @@ # CORS gin's middleware -[](https://travis-ci.org/gin-contrib/cors) +[](https://github.com/gin-contrib/cors/actions/workflows/go.yml) [](https://codecov.io/gh/gin-contrib/cors) [](https://goreportcard.com/report/github.com/gin-contrib/cors) [](https://godoc.org/github.com/gin-contrib/cors) -[](https://gitter.im/gin-gonic/gin) Gin middleware/handler to enable CORS support. @@ -15,7 +14,7 @@ Gin middleware/handler to enable CORS support. Download and install it: ```sh -$ go get github.com/gin-contrib/cors +go get github.com/gin-contrib/cors ``` Import it in your code: @@ -24,37 +23,37 @@ Import it in your code: import "github.com/gin-contrib/cors" ``` -### Canonical example: +### Canonical example ```go package main import ( - "time" + "time" - "github.com/gin-contrib/cors" - "github.com/gin-gonic/gin" + "github.com/gin-contrib/cors" + "github.com/gin-gonic/gin" ) func main() { - router := gin.Default() - // CORS for https://foo.com and https://github.com origins, allowing: - // - PUT and PATCH methods - // - Origin header - // - Credentials share - // - Preflight requests cached for 12 hours - router.Use(cors.New(cors.Config{ - AllowOrigins: []string{"https://foo.com"}, - AllowMethods: []string{"PUT", "PATCH"}, - AllowHeaders: []string{"Origin"}, - ExposeHeaders: []string{"Content-Length"}, - AllowCredentials: true, - AllowOriginFunc: func(origin string) bool { - return origin == "https://github.com" - }, - MaxAge: 12 * time.Hour, - })) - router.Run() + router := gin.Default() + // CORS for https://foo.com and https://github.com origins, allowing: + // - PUT and PATCH methods + // - Origin header + // - Credentials share + // - Preflight requests cached for 12 hours + router.Use(cors.New(cors.Config{ + AllowOrigins: []string{"https://foo.com"}, + AllowMethods: []string{"PUT", "PATCH"}, + AllowHeaders: []string{"Origin"}, + ExposeHeaders: []string{"Content-Length"}, + AllowCredentials: true, + AllowOriginFunc: func(origin string) bool { + return origin == "https://github.com" + }, + MaxAge: 12 * time.Hour, + })) + router.Run() } ``` @@ -62,30 +61,32 @@ func main() { ```go func main() { - router := gin.Default() - // - No origin allowed by default - // - GET,POST, PUT, HEAD methods - // - Credentials share disabled - // - Preflight requests cached for 12 hours - config := cors.DefaultConfig() - config.AllowOrigins = []string{"http://google.com"} - // config.AllowOrigins == []string{"http://google.com", "http://facebook.com"} - - router.Use(cors.New(config)) - router.Run() + router := gin.Default() + // - No origin allowed by default + // - GET,POST, PUT, HEAD methods + // - Credentials share disabled + // - Preflight requests cached for 12 hours + config := cors.DefaultConfig() + config.AllowOrigins = []string{"http://google.com"} + // config.AllowOrigins = []string{"http://google.com", "http://facebook.com"} + // config.AllowAllOrigins = true + + router.Use(cors.New(config)) + router.Run() } ``` +note: while Default() allows all origins, DefaultConfig() does not and you will still have to use AllowAllOrigins ### Default() allows all origins ```go func main() { - router := gin.Default() - // same as - // config := cors.DefaultConfig() - // config.AllowAllOrigins = true - // router.Use(cors.New(config)) - router.Use(cors.Default()) - router.Run() + router := gin.Default() + // same as + // config := cors.DefaultConfig() + // config.AllowAllOrigins = true + // router.Use(cors.New(config)) + router.Use(cors.Default()) + router.Run() } ``` diff --git a/vendor/github.com/gin-contrib/cors/config.go b/vendor/github.com/gin-contrib/cors/config.go index d4fc11801..735c8c1ab 100644 --- a/vendor/github.com/gin-contrib/cors/config.go +++ b/vendor/github.com/gin-contrib/cors/config.go @@ -12,7 +12,6 @@ type cors struct { allowCredentials bool allowOriginFunc func(string) bool allowOrigins []string - exposeHeaders []string normalHeaders http.Header preflightHeaders http.Header wildcardOrigins [][]string @@ -43,6 +42,12 @@ func newCors(config Config) *cors { panic(err.Error()) } + for _, origin := range config.AllowOrigins { + if origin == "*" { + config.AllowAllOrigins = true + } + } + return &cors{ allowOriginFunc: config.AllowOriginFunc, allowAllOrigins: config.AllowAllOrigins, diff --git a/vendor/github.com/gin-contrib/cors/cors.go b/vendor/github.com/gin-contrib/cors/cors.go index d6d06de03..f0e230ae4 100644 --- a/vendor/github.com/gin-contrib/cors/cors.go +++ b/vendor/github.com/gin-contrib/cors/cors.go @@ -23,7 +23,7 @@ type Config struct { AllowOriginFunc func(origin string) bool // AllowMethods is a list of methods the client is allowed to use with - // cross-domain requests. Default value is simple methods (GET and POST) + // cross-domain requests. Default value is simple methods (GET, POST, PUT, PATCH, DELETE, HEAD, and OPTIONS) AllowMethods []string // AllowHeaders is list of non simple headers the client is allowed to use with @@ -34,11 +34,11 @@ type Config struct { // cookies, HTTP authentication or client side SSL certificates. AllowCredentials bool - // ExposedHeaders indicates which headers are safe to expose to the API of a CORS + // ExposeHeaders indicates which headers are safe to expose to the API of a CORS // API specification ExposeHeaders []string - // MaxAge indicates how long (in seconds) the results of a preflight request + // MaxAge indicates how long (with second-precision) the results of a preflight request // can be cached MaxAge time.Duration @@ -95,7 +95,7 @@ func (c Config) validateAllowedSchemas(origin string) bool { } // Validate is check configuration of user defined. -func (c *Config) Validate() error { +func (c Config) Validate() error { if c.AllowAllOrigins && (c.AllowOriginFunc != nil || len(c.AllowOrigins) > 0) { return errors.New("conflict settings: all origins are allowed. AllowOriginFunc or AllowOrigins is not needed") } @@ -103,10 +103,7 @@ func (c *Config) Validate() error { return errors.New("conflict settings: all origins disabled") } for _, origin := range c.AllowOrigins { - if origin == "*" { - c.AllowAllOrigins = true - return nil - } else if !strings.Contains(origin, "*") && !c.validateAllowedSchemas(origin) { + if !strings.Contains(origin, "*") && !c.validateAllowedSchemas(origin) { return errors.New("bad origin: origins must contain '*' or include " + strings.Join(c.getAllowedSchemas(), ",")) } } @@ -148,7 +145,7 @@ func (c Config) parseWildcardRules() [][]string { // DefaultConfig returns a generic default configuration mapped to localhost. func DefaultConfig() Config { return Config{ - AllowMethods: []string{"GET", "POST", "PUT", "PATCH", "DELETE", "HEAD"}, + AllowMethods: []string{"GET", "POST", "PUT", "PATCH", "DELETE", "HEAD", "OPTIONS"}, AllowHeaders: []string{"Origin", "Content-Length", "Content-Type"}, AllowCredentials: false, MaxAge: 12 * time.Hour, diff --git a/vendor/github.com/gin-contrib/gzip/.gitignore b/vendor/github.com/gin-contrib/gzip/.gitignore new file mode 100644 index 000000000..2d830686d --- /dev/null +++ b/vendor/github.com/gin-contrib/gzip/.gitignore @@ -0,0 +1 @@ +coverage.out diff --git a/vendor/github.com/gin-contrib/gzip/.golangci.yml b/vendor/github.com/gin-contrib/gzip/.golangci.yml new file mode 100644 index 000000000..60b7c368b --- /dev/null +++ b/vendor/github.com/gin-contrib/gzip/.golangci.yml @@ -0,0 +1,48 @@ +linters: + enable-all: false + disable-all: true + fast: false + enable: + - bodyclose + - deadcode + - depguard + - dogsled + - dupl + - errcheck + - exportloopref + - exhaustive + - gochecknoinits + - goconst + - gocritic + - gocyclo + - gofmt + - goimports + - goprintffuncname + - gosec + - gosimple + - govet + - ineffassign + - lll + - misspell + - nakedret + - noctx + - nolintlint + - rowserrcheck + - staticcheck + - structcheck + - stylecheck + - typecheck + - unconvert + - unparam + - unused + - varcheck + - whitespace + - gofumpt + +run: + timeout: 3m + +linters-settings: + dupl: + # tokens count to trigger issue, 150 by default + threshold: 200 diff --git a/vendor/github.com/gin-contrib/gzip/handler.go b/vendor/github.com/gin-contrib/gzip/handler.go index 58f87db9b..7de33eb64 100644 --- a/vendor/github.com/gin-contrib/gzip/handler.go +++ b/vendor/github.com/gin-contrib/gzip/handler.go @@ -64,7 +64,6 @@ func (g *gzipHandler) shouldCompress(req *http.Request) bool { if !strings.Contains(req.Header.Get("Accept-Encoding"), "gzip") || strings.Contains(req.Header.Get("Connection"), "Upgrade") || strings.Contains(req.Header.Get("Accept"), "text/event-stream") { - return false } diff --git a/vendor/github.com/gin-gonic/gin/.golangci.yml b/vendor/github.com/gin-gonic/gin/.golangci.yml new file mode 100644 index 000000000..c5e1de388 --- /dev/null +++ b/vendor/github.com/gin-gonic/gin/.golangci.yml @@ -0,0 +1,39 @@ +run: + timeout: 5m +linters: + enable: + - asciicheck + - depguard + - dogsled + - durationcheck + - errcheck + - errorlint + - exportloopref + - gci + - gofmt + - goimports + - gosec + - misspell + - nakedret + - nilerr + - nolintlint + - revive + - wastedassign +issues: + exclude-rules: + - linters: + - structcheck + - unused + text: "`data` is unused" + - linters: + - staticcheck + text: "SA1019:" + - linters: + - revive + text: "var-naming:" + - linters: + - revive + text: "exported:" + - path: _test\.go + linters: + - gosec # security is not make sense in tests diff --git a/vendor/github.com/gin-gonic/gin/.goreleaser.yaml b/vendor/github.com/gin-gonic/gin/.goreleaser.yaml new file mode 100644 index 000000000..e435e56aa --- /dev/null +++ b/vendor/github.com/gin-gonic/gin/.goreleaser.yaml @@ -0,0 +1,57 @@ +project_name: gin + +builds: + - + # If true, skip the build. + # Useful for library projects. + # Default is false + skip: true + +changelog: + # Set it to true if you wish to skip the changelog generation. + # This may result in an empty release notes on GitHub/GitLab/Gitea. + skip: false + + # Changelog generation implementation to use. + # + # Valid options are: + # - `git`: uses `git log`; + # - `github`: uses the compare GitHub API, appending the author login to the changelog. + # - `gitlab`: uses the compare GitLab API, appending the author name and email to the changelog. + # - `github-native`: uses the GitHub release notes generation API, disables the groups feature. + # + # Defaults to `git`. + use: git + + # Sorts the changelog by the commit's messages. + # Could either be asc, desc or empty + # Default is empty + sort: asc + + # Group commits messages by given regex and title. + # Order value defines the order of the groups. + # Proving no regex means all commits will be grouped under the default group. + # Groups are disabled when using github-native, as it already groups things by itself. + # + # Default is no groups. + groups: + - title: Features + regexp: "^.*feat[(\\w)]*:+.*$" + order: 0 + - title: 'Bug fixes' + regexp: "^.*fix[(\\w)]*:+.*$" + order: 1 + - title: 'Enhancements' + regexp: "^.*chore[(\\w)]*:+.*$" + order: 2 + - title: Others + order: 999 + + filters: + # Commit messages matching the regexp listed here will be removed from + # the changelog + # Default is empty + exclude: + - '^docs' + - 'CICD' + - typo diff --git a/vendor/github.com/gin-gonic/gin/.travis.yml b/vendor/github.com/gin-gonic/gin/.travis.yml deleted file mode 100644 index bcc21414d..000000000 --- a/vendor/github.com/gin-gonic/gin/.travis.yml +++ /dev/null @@ -1,48 +0,0 @@ -language: go - -matrix: - fast_finish: true - include: - - go: 1.13.x - - go: 1.13.x - env: - - TESTTAGS=nomsgpack - - go: 1.14.x - - go: 1.14.x - env: - - TESTTAGS=nomsgpack - - go: 1.15.x - - go: 1.15.x - env: - - TESTTAGS=nomsgpack - - go: master - -git: - depth: 10 - -before_install: - - if [[ "${GO111MODULE}" = "on" ]]; then mkdir "${HOME}/go"; export GOPATH="${HOME}/go"; fi - -install: - - if [[ "${GO111MODULE}" = "on" ]]; then go mod download; fi - - if [[ "${GO111MODULE}" = "on" ]]; then export PATH="${GOPATH}/bin:${GOROOT}/bin:${PATH}"; fi - - if [[ "${GO111MODULE}" = "on" ]]; then make tools; fi - -go_import_path: github.com/gin-gonic/gin - -script: - - make vet - - make fmt-check - - make misspell-check - - make test - -after_success: - - bash <(curl -s https://codecov.io/bash) - -notifications: - webhooks: - urls: - - https://webhooks.gitter.im/e/7f95bf605c4d356372f4 - on_success: change # options: [always|never|change] default: always - on_failure: always # options: [always|never|change] default: always - on_start: false # default: false diff --git a/vendor/github.com/gin-gonic/gin/AUTHORS.md b/vendor/github.com/gin-gonic/gin/AUTHORS.md index c634e6be0..b4773ef3d 100644 --- a/vendor/github.com/gin-gonic/gin/AUTHORS.md +++ b/vendor/github.com/gin-gonic/gin/AUTHORS.md @@ -2,232 +2,405 @@ List of all the awesome people working to make Gin the best Web Framework in Go. ## gin 1.x series authors -**Gin Core Team:** Bo-Yi Wu (@appleboy), 田欧 (@thinkerou), Javier Provecho (@javierprovecho) +**Gin Core Team:** Bo-Yi Wu (@appleboy), thinkerou (@thinkerou), Javier Provecho (@javierprovecho) ## gin 0.x series authors **Maintainers:** Manu Martinez-Almeida (@manucorporat), Javier Provecho (@javierprovecho) -People and companies, who have contributed, in alphabetical order. - -**@858806258 (杰哥)** -- Fix typo in example - - -**@achedeuzot (Klemen Sever)** -- Fix newline debug printing - - -**@adammck (Adam Mckaig)** -- Add MIT license - - -**@AlexanderChen1989 (Alexander)** -- Typos in README - - -**@alexanderdidenko (Aleksandr Didenko)** -- Add support multipart/form-data - - -**@alexandernyquist (Alexander Nyquist)** -- Using template.Must to fix multiple return issue -- ★ Added support for OPTIONS verb -- ★ Setting response headers before calling WriteHeader -- Improved documentation for model binding -- ★ Added Content.Redirect() -- ★ Added tons of Unit tests - - -**@austinheap (Austin Heap)** -- Added travis CI integration - - -**@andredublin (Andre Dublin)** -- Fix typo in comment - - -**@bredov (Ludwig Valda Vasquez)** -- Fix html templating in debug mode - - -**@bluele (Jun Kimura)** -- Fixes code examples in README - - -**@chad-russell** -- ★ Support for serializing gin.H into XML - - -**@dickeyxxx (Jeff Dickey)** -- Typos in README -- Add example about serving static files - - -**@donileo (Adonis)** -- Add NoMethod handler - - -**@dutchcoders (DutchCoders)** -- ★ Fix security bug that allows client to spoof ip -- Fix typo. r.HTMLTemplates -> SetHTMLTemplate - - -**@el3ctro- (Joshua Loper)** -- Fix typo in example - - -**@ethankan (Ethan Kan)** -- Unsigned integers in binding - - -**(Evgeny Persienko)** -- Validate sub structures - - -**@frankbille (Frank Bille)** -- Add support for HTTP Realm Auth - - -**@fmd (Fareed Dudhia)** -- Fix typo. SetHTTPTemplate -> SetHTMLTemplate - - -**@ironiridis (Christopher Harrington)** -- Remove old reference - - -**@jammie-stackhouse (Jamie Stackhouse)** -- Add more shortcuts for router methods - - -**@jasonrhansen** -- Fix spelling and grammar errors in documentation - - -**@JasonSoft (Jason Lee)** -- Fix typo in comment - - -**@joiggama (Ignacio Galindo)** -- Add utf-8 charset header on renders - - -**@julienschmidt (Julien Schmidt)** -- gofmt the code examples - - -**@kelcecil (Kel Cecil)** -- Fix readme typo - - -**@kyledinh (Kyle Dinh)** -- Adds RunTLS() - - -**@LinusU (Linus Unnebäck)** -- Small fixes in README - - -**@loongmxbt (Saint Asky)** -- Fix typo in example - - -**@lucas-clemente (Lucas Clemente)** -- ★ work around path.Join removing trailing slashes from routes - - -**@mattn (Yasuhiro Matsumoto)** -- Improve color logger - - -**@mdigger (Dmitry Sedykh)** -- Fixes Form binding when content-type is x-www-form-urlencoded -- No repeat call c.Writer.Status() in gin.Logger -- Fixes Content-Type for json render - - -**@mirzac (Mirza Ceric)** -- Fix debug printing - - -**@mopemope (Yutaka Matsubara)** -- ★ Adds Godep support (Dependencies Manager) -- Fix variadic parameter in the flexible render API -- Fix Corrupted plain render -- Add Pluggable View Renderer Example - - -**@msemenistyi (Mykyta Semenistyi)** -- update Readme.md. Add code to String method - - -**@msoedov (Sasha Myasoedov)** -- ★ Adds tons of unit tests. - - -**@ngerakines (Nick Gerakines)** -- ★ Improves API, c.GET() doesn't panic -- Adds MustGet() method - - -**@r8k (Rajiv Kilaparti)** -- Fix Port usage in README. - - -**@rayrod2030 (Ray Rodriguez)** -- Fix typo in example - - -**@rns** -- Fix typo in example - - -**@RobAWilkinson (Robert Wilkinson)** -- Add example of forms and params - - -**@rogierlommers (Rogier Lommers)** -- Add updated static serve example - -**@rw-access (Ross Wolf)** -- Added support to mix exact and param routes - -**@se77en (Damon Zhao)** -- Improve color logging - - -**@silasb (Silas Baronda)** -- Fixing quotes in README - - -**@SkuliOskarsson (Skuli Oskarsson)** -- Fixes some texts in README II - - -**@slimmy (Jimmy Pettersson)** -- Added messages for required bindings - - -**@smira (Andrey Smirnov)** -- Add support for ignored/unexported fields in binding - - -**@superalsrk (SRK.Lyu)** -- Update httprouter godeps - - -**@tebeka (Miki Tebeka)** -- Use net/http constants instead of numeric values - - -**@techjanitor** -- Update context.go reserved IPs - - -**@yosssi (Keiji Yoshida)** -- Fix link in README +------ +People and companies, who have contributed, in alphabetical order. -**@yuyabee** -- Fixed README +- 178inaba <178inaba@users.noreply.github.com> +- A. F <hello@clivern.com> +- ABHISHEK SONI <abhishek.rocks26@gmail.com> +- Abhishek Chanda <achanda@users.noreply.github.com> +- Abner Chen <houjunchen@gmail.com> +- AcoNCodes <acongame@gmail.com> +- Adam Dratwinski <adam.dratwinski@gmail.com> +- Adam Mckaig <adam.mckaig@gmail.com> +- Adam Zielinski <MusicAdam@users.noreply.github.com> +- Adonis <donileo@gmail.com> +- Alan Wang <azzwacb9001@126.com> +- Albin Gilles <gilles.albin@gmail.com> +- Aleksandr Didenko <aa.didenko@yandex.ru> +- Alessandro (Ale) Segala <43508+ItalyPaleAle@users.noreply.github.com> +- Alex <AWulkan@users.noreply.github.com> +- Alexander <alexanderchenmh@gmail.com> +- Alexander Lokhman <alex.lokhman@gmail.com> +- Alexander Melentyev <55826637+alexander-melentyev@users.noreply.github.com> +- Alexander Nyquist <nyquist.alexander@gmail.com> +- Allen Ren <kulong0105@gmail.com> +- AllinGo <tanhp@outlook.com> +- Ammar Bandukwala <ammar@ammar.io> +- An Xiao (Luffy) <hac@zju.edu.cn> +- Andre Dublin <81dublin@gmail.com> +- Andrew Szeto <github@jabagawee.com> +- Andrey Abramov <andreyabramov.aaa@gmail.com> +- Andrey Nering <andrey.nering@gmail.com> +- Andrey Smirnov <Smirnov.Andrey@gmail.com> +- Andrii Bubis <firstrow@gmail.com> +- André Bazaglia <bazaglia@users.noreply.github.com> +- Andy Pan <panjf2000@gmail.com> +- Antoine GIRARD <sapk@users.noreply.github.com> +- Anup Kumar Panwar <1anuppanwar@gmail.com> +- Aravinth Sundaram <gosh.aravind@gmail.com> +- Artem <horechek@gmail.com> +- Ashwani <ashwanisharma686@gmail.com> +- Aurelien Regat-Barrel <arb@cyberkarma.net> +- Austin Heap <me@austinheap.com> +- Barnabus <jbampton@users.noreply.github.com> +- Bo-Yi Wu <appleboy.tw@gmail.com> +- Boris Borshevsky <BorisBorshevsky@gmail.com> +- Boyi Wu <p581581@gmail.com> +- BradyBromley <51128276+BradyBromley@users.noreply.github.com> +- Brendan Fosberry <brendan@shopkeep.com> +- Brian Wigginton <brianwigginton@gmail.com> +- Carlos Eduardo <carlosedp@gmail.com> +- Chad Russell <chaddouglasrussell@gmail.com> +- Charles <cxjava@gmail.com> +- Christian Muehlhaeuser <muesli@gmail.com> +- Christian Persson <saser@live.se> +- Christopher Harrington <ironiridis@gmail.com> +- Damon Zhao <yijun.zhao@outlook.com> +- Dan Markham <dmarkham@gmail.com> +- Dang Nguyen <hoangdang.me@gmail.com> +- Daniel Krom <kromdan@gmail.com> +- Daniel M. Lambea <dmlambea@gmail.com> +- Danieliu <liudanking@gmail.com> +- David Irvine <aviddiviner@gmail.com> +- David Zhang <crispgm@gmail.com> +- Davor Kapsa <dvrkps@users.noreply.github.com> +- DeathKing <DeathKing@users.noreply.github.com> +- Dennis Cho <47404603+forest747@users.noreply.github.com> +- Dmitry Dorogin <dmirogin@ya.ru> +- Dmitry Kutakov <vkd.castle@gmail.com> +- Dmitry Sedykh <dmitrys@d3h.local> +- Don2Quixote <35610661+Don2Quixote@users.noreply.github.com> +- Donn Pebe <iam@donnpebe.com> +- Dustin Decker <dustindecker@protonmail.com> +- Eason Lin <easonlin404@gmail.com> +- Edward Betts <edward@4angle.com> +- Egor Seredin <4819888+agmt@users.noreply.github.com> +- Emmanuel Goh <emmanuel@visenze.com> +- Equim <sayaka@ekyu.moe> +- Eren A. Akyol <eren@redmc.me> +- Eric_Lee <xplzv@126.com> +- Erik Bender <erik.bender@develerik.dev> +- Ethan Kan <ethankan@neoplot.com> +- Evgeny Persienko <e.persienko@office.ngs.ru> +- Faisal Alam <ifaisalalam@gmail.com> +- Fareed Dudhia <fareeddudhia@googlemail.com> +- Filip Figiel <figiel.filip@gmail.com> +- Florian Polster <couchpolster@icqmail.com> +- Frank Bille <github@frankbille.dk> +- Franz Bettag <franz@bett.ag> +- Ganlv <ganlvtech@users.noreply.github.com> +- Gaozhen Ying <yinggaozhen@hotmail.com> +- George Gabolaev <gabolaev98@gmail.com> +- George Kirilenko <necryin@users.noreply.github.com> +- Georges Varouchas <georges.varouchas@gmail.com> +- Gordon Tyler <gordon@doxxx.net> +- Harindu Perera <harinduenator@gmail.com> +- Helios <674876158@qq.com> +- Henry Kwan <piengeng@users.noreply.github.com> +- Henry Yee <henry@yearning.io> +- Himanshu Mishra <OrkoHunter@users.noreply.github.com> +- Hiroyuki Tanaka <h.tanaka.0325@gmail.com> +- Ibraheem Ahmed <ibrah1440@gmail.com> +- Ignacio Galindo <joiggama@gmail.com> +- Igor H. Vieira <zignd.igor@gmail.com> +- Ildar1111 <54001462+Ildar1111@users.noreply.github.com> +- Iskander (Alex) Sharipov <iskander.sharipov@intel.com> +- Ismail Gjevori <isgjevori@protonmail.com> +- Ivan Chen <allenivan@gmail.com> +- JINNOUCHI Yasushi <delphinus@remora.cx> +- James Pettyjohn <japettyjohn@users.noreply.github.com> +- Jamie Stackhouse <jamie.stackhouse@redspace.com> +- Jason Lee <jawc@hotmail.com> +- Javier Provecho <j.provecho@dartekstudios.com> +- Javier Provecho <javier.provecho@bq.com> +- Javier Provecho <javiertitan@gmail.com> +- Javier Provecho Fernandez <j.provecho@dartekstudios.com> +- Javier Provecho Fernandez <javiertitan@gmail.com> +- Jean-Christophe Lebreton <jclebreton@gmail.com> +- Jeff <laojianzi1994@gmail.com> +- Jeremy Loy <jeremy.b.loy@icloud.com> +- Jim Filippou <p3160253@aueb.gr> +- Jimmy Pettersson <jimmy@expertmaker.com> +- John Bampton <jbampton@users.noreply.github.com> +- Johnny Dallas <johnnydallas0308@gmail.com> +- Johnny Dallas <theonlyjohnny@theonlyjohnny.sh> +- Jonathan (JC) Chen <jc@dijonkitchen.org> +- Josep Jesus Bigorra Algaba <42377845+averageflow@users.noreply.github.com> +- Josh Horowitz <joshua.m.horowitz@gmail.com> +- Joshua Loper <josh.el3@gmail.com> +- Julien Schmidt <github@julienschmidt.com> +- Jun Kimura <jksmphone@gmail.com> +- Justin Beckwith <justin.beckwith@gmail.com> +- Justin Israel <justinisrael@gmail.com> +- Justin Mayhew <mayhew@live.ca> +- Jérôme Laforge <jerome-laforge@users.noreply.github.com> +- Kacper Bąk <56700396+53jk1@users.noreply.github.com> +- Kamron Batman <kamronbatman@users.noreply.github.com> +- Kane Rogers <kane@cleanstream.com.au> +- Kaushik Neelichetty <kaushikneelichetty6132@gmail.com> +- Keiji Yoshida <yoshida.keiji.84@gmail.com> +- Kel Cecil <kel.cecil@listhub.com> +- Kevin Mulvey <kmulvey@linux.com> +- Kevin Zhu <ipandtcp@gmail.com> +- Kirill Motkov <motkov.kirill@gmail.com> +- Klemen Sever <ksever@student.42.fr> +- Kristoffer A. Iversen <kristoffer.a.iversen@gmail.com> +- Krzysztof Szafrański <k.p.szafranski@gmail.com> +- Kumar McMillan <kumar.mcmillan@gmail.com> +- Kyle Mcgill <email@kylescottmcgill.com> +- Lanco <35420416+lancoLiu@users.noreply.github.com> +- Levi Olson <olson.levi@gmail.com> +- Lin Kao-Yuan <mosdeo@gmail.com> +- Linus Unnebäck <linus@folkdatorn.se> +- Lucas Clemente <lucas@clemente.io> +- Ludwig Valda Vasquez <bredov@gmail.com> +- Luis GG <lggomez@users.noreply.github.com> +- MW Lim <williamchange@gmail.com> +- Maksimov Sergey <konjoot@gmail.com> +- Manjusaka <lizheao940510@gmail.com> +- Manu MA <manu.mtza@gmail.com> +- Manu MA <manu.valladolid@gmail.com> +- Manu Mtz-Almeida <manu.valladolid@gmail.com> +- Manu Mtz.-Almeida <manu.valladolid@gmail.com> +- Manuel Alonso <manuelalonso@invisionapp.com> +- Mara Kim <hacker.root@gmail.com> +- Mario Kostelac <mario@intercom.io> +- Martin Karlsch <martin@karlsch.com> +- Matt Newberry <mnewberry@opentable.com> +- Matt Williams <gh@mattyw.net> +- Matthieu MOREL <mmorel-35@users.noreply.github.com> +- Max Hilbrunner <mhilbrunner@users.noreply.github.com> +- Maxime Soulé <btik-git@scoubidou.com> +- MetalBreaker <johnymichelson@gmail.com> +- Michael Puncel <mpuncel@squareup.com> +- MichaelDeSteven <51652084+MichaelDeSteven@users.noreply.github.com> +- Mike <38686456+icy4ever@users.noreply.github.com> +- Mike Stipicevic <mst@ableton.com> +- Miki Tebeka <miki.tebeka@gmail.com> +- Miles <MilesLin@users.noreply.github.com> +- Mirza Ceric <mirza.ceric@b2match.com> +- Mykyta Semenistyi <nikeiwe@gmail.com> +- Naoki Takano <honten@tinkermode.com> +- Ngalim Siregar <ngalim.siregar@gmail.com> +- Ni Hao <supernihaooo@qq.com> +- Nick Gerakines <nick@gerakines.net> +- Nikifor Seryakov <nikandfor@gmail.com> +- Notealot <714804968@qq.com> +- Olivier Mengué <dolmen@cpan.org> +- Olivier Robardet <orobardet@users.noreply.github.com> +- Pablo Moncada <pablo.moncada@bq.com> +- Pablo Moncada <pmoncadaisla@gmail.com> +- Panmax <967168@qq.com> +- Peperoncino <2wua4nlyi@gmail.com> +- Philipp Meinen <philipp@bind.ch> +- Pierre Massat <pierre@massat.io> +- Qt <golang.chen@gmail.com> +- Quentin ROYER <aydendevg@gmail.com> +- README Bot <35302948+codetriage-readme-bot@users.noreply.github.com> +- Rafal Zajac <rzajac@gmail.com> +- Rahul Datta Roy <rahuldroy@users.noreply.github.com> +- Rajiv Kilaparti <rajivk085@gmail.com> +- Raphael Gavache <raphael.gavache@datadoghq.com> +- Ray Rodriguez <rayrod2030@gmail.com> +- Regner Blok-Andersen <shadowdf@gmail.com> +- Remco <remco@dutchcoders.io> +- Rex Lee(李俊) <duguying2008@gmail.com> +- Richard Lee <dlackty@gmail.com> +- Riverside <wangyb65@gmail.com> +- Robert Wilkinson <wilkinson.robert.a@gmail.com> +- Rogier Lommers <rogier@lommers.org> +- Rohan Pai <me@rohanpai.com> +- Romain Beuque <rbeuque74@gmail.com> +- Roman Belyakovsky <ihryamzik@gmail.com> +- Roman Zaynetdinov <627197+zaynetro@users.noreply.github.com> +- Roman Zaynetdinov <roman.zaynetdinov@lekane.com> +- Ronald Petty <ronald.petty@rx-m.com> +- Ross Wolf <31489089+rw-access@users.noreply.github.com> +- Roy Lou <roylou@gmail.com> +- Rubi <14269809+codenoid@users.noreply.github.com> +- Ryan <46182144+ryanker@users.noreply.github.com> +- Ryan J. Yoder <me@ryanjyoder.com> +- SRK.Lyu <superalsrk@gmail.com> +- Sai <sairoutine@gmail.com> +- Samuel Abreu <sdepaula@gmail.com> +- Santhosh Kumar <santhoshkumarr1096@gmail.com> +- Sasha Melentyev <sasha@melentyev.io> +- Sasha Myasoedov <msoedov@gmail.com> +- Segev Finer <segev208@gmail.com> +- Sergey Egorov <egorovhome@gmail.com> +- Sergey Fedchenko <seregayoga@bk.ru> +- Sergey Gonimar <sergey.gonimar@gmail.com> +- Sergey Ponomarev <me@sergey-ponomarev.ru> +- Serica <943914044@qq.com> +- Shamus Taylor <Shamus03@me.com> +- Shilin Wang <jarvisfironman@gmail.com> +- Shuo <openset.wang@gmail.com> +- Skuli Oskarsson <skuli@codeiak.io> +- Snawoot <vladislav-ex-github@vm-0.com> +- Sridhar Ratnakumar <srid@srid.ca> +- Steeve Chailloux <steeve@chaahk.com> +- Sudhir Mishra <sudhirxps@gmail.com> +- Suhas Karanth <sudo-suhas@users.noreply.github.com> +- TaeJun Park <miking38@gmail.com> +- Tatsuya Hoshino <tatsuya7.hoshino7@gmail.com> +- Tevic <tevic.tt@gmail.com> +- Tevin Jeffrey <tev.jeffrey@gmail.com> +- The Gitter Badger <badger@gitter.im> +- Thibault Jamet <tjamet@users.noreply.github.com> +- Thomas Boerger <thomas@webhippie.de> +- Thomas Schaffer <loopfz@gmail.com> +- Tommy Chu <tommychu2256@gmail.com> +- Tudor Roman <tudurom@gmail.com> +- Uwe Dauernheim <djui@users.noreply.github.com> +- Valentine Oragbakosi <valentine13400@gmail.com> +- Vas N <pnvasanth@users.noreply.github.com> +- Vasilyuk Vasiliy <By-Vasiliy@users.noreply.github.com> +- Victor Castell <victor@victorcastell.com> +- Vince Yuan <vince.yuan@gmail.com> +- Vyacheslav Dubinin <vyacheslav.dubinin@gmail.com> +- Waynerv <ampedee@gmail.com> +- Weilin Shi <934587911@qq.com> +- Xudong Cai <fifsky@gmail.com> +- Yasuhiro Matsumoto <mattn.jp@gmail.com> +- Yehezkiel Syamsuhadi <ybs@ybs.im> +- Yoshiki Nakagawa <yyoshiki41@gmail.com> +- Yoshiyuki Kinjo <yskkin+github@gmail.com> +- Yue Yang <g1enyy0ung@gmail.com> +- ZYunH <zyunhjob@163.com> +- Zach Newburgh <zach.newburgh@gmail.com> +- Zasda Yusuf Mikail <zasdaym@gmail.com> +- ZhangYunHao <zyunhjob@163.com> +- ZhiFeng Hu <hufeng1987@gmail.com> +- Zhu Xi <zhuxi910511@163.com> +- a2tt <usera2tt@gmail.com> +- ahuigo <1781999+ahuigo@users.noreply.github.com> +- ali <anio@users.noreply.github.com> +- aljun <salameryy@163.com> +- andrea <crypto.andrea@protonmail.ch> +- andriikushch <andrii.kushch@gmail.com> +- anoty <anjunyou@foxmail.com> +- awkj <hzzbiu@gmail.com> +- axiaoxin <254606826@qq.com> +- bbiao <bbbiao@gmail.com> +- bestgopher <84328409@qq.com> +- betahu <zhong.wenhuang@foxmail.com> +- bigwheel <k.bigwheel+eng@gmail.com> +- bn4t <17193640+bn4t@users.noreply.github.com> +- bullgare <bullgare@gmail.com> +- chainhelen <chainhelen@gmail.com> +- chenyang929 <chenyang929code@gmail.com> +- chriswhelix <chris.williams@helix.com> +- collinmsn <4130944@qq.com> +- cssivision <cssivision@gmail.com> +- danielalves <alves.lopes.dan@gmail.com> +- delphinus <delphinus@remora.cx> +- dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com> +- dickeyxxx <jeff@dickeyxxx.com> +- edebernis <emeric.debernis@gmail.com> +- error10 <error@ioerror.us> +- esplo <esplo@users.noreply.github.com> +- eudore <30709860+eudore@users.noreply.github.com> +- ffhelicopter <32922889+ffhelicopter@users.noreply.github.com> +- filikos <11477309+filikos@users.noreply.github.com> +- forging2012 <forging2012@users.noreply.github.com> +- goqihoo <goqihoo@gmail.com> +- grapeVine <treeui.old@gmail.com> +- guonaihong <guonaihong@qq.com> +- heige <daheige@users.noreply.github.com> +- heige <zhuwei313@hotmail.com> +- hellojukay <hellojukay@163.com> +- henrylee2cn <henrylee2cn@gmail.com> +- htobenothing <htobenothing@gmail.com> +- iamhesir <78344375+iamhesir@users.noreply.github.com> +- ijaa <kailiu2013@gmail.com> +- ishanray <ishan.iipm@gmail.com> +- ishanray <ishanray@users.noreply.github.com> +- itcloudy <272685110@qq.com> +- jarodsong6 <jarodsong6@gmail.com> +- jasonrhansen <jasonrodneyhansen@gmail.com> +- jincheng9 <perfume0607@gmail.com> +- joeADSP <75027008+joeADSP@users.noreply.github.com> +- junfengye <junfeng.yejf@gmail.com> +- kaiiak <aNxFi37X@outlook.com> +- kebo <kevinke2020@outlook.com> +- keke <19yamashita15@gmail.com> +- kishor kunal raj <68464660+kishorkunal-raj@users.noreply.github.com> +- kyledinh <kyledinh@gmail.com> +- lantw44 <lantw44@gmail.com> +- likakuli <1154584512@qq.com> +- linfangrong <linfangrong.liuxin@qq.com> +- linzi <873804682@qq.com> +- llgoer <yanghuxiao@vip.qq.com> +- long-road <13412081338@163.com> +- mbesancon <mathieu.besancon@gmail.com> +- mehdy <mehdy.khoshnoody@gmail.com> +- metal A-wing <freedom.awing.777@gmail.com> +- micanzhang <micanzhang@gmail.com> +- minarc <ragnhildmowinckel@gmail.com> +- mllu <mornlyn@gmail.com> +- mopemoepe <yutaka.matsubara@gmail.com> +- msoedov <msoedov@gmail.com> +- mstmdev <mstmdev@gmail.com> +- novaeye <fcoffee@gmail.com> +- olebedev <oolebedev@gmail.com> +- phithon <phith0n@users.noreply.github.com> +- pjgg <pablo.gonzalez.granados@gmail.com> +- qm012 <67568757+qm012@users.noreply.github.com> +- raymonder jin <rayjingithub@gmail.com> +- rns <ruslan.shvedov@gmail.com> +- root@andrea:~# <crypto.andrea@protonmail.ch> +- sekky0905 <20237968+sekky0905@users.noreply.github.com> +- senhtry <w169q169@gmail.com> +- shadrus <shadrus@gmail.com> +- silasb <silas.baronda@gmail.com> +- solos <lxl1217@gmail.com> +- songjiayang <songjiayang@users.noreply.github.com> +- sope <shenshouer@163.com> +- srt180 <30768686+srt180@users.noreply.github.com> +- stackerzzq <foo_stacker@yeah.net> +- sunshineplan <sunshineplan@users.noreply.github.com> +- syssam <s.y.s.sam.sys@gmail.com> +- techjanitor <puntme@gmail.com> +- techjanitor <techjanitor@users.noreply.github.com> +- thinkerou <thinkerou@gmail.com> +- thinkgo <49174849+thinkgos@users.noreply.github.com> +- tsirolnik <tsirolnik@users.noreply.github.com> +- tyltr <31768692+tylitianrui@users.noreply.github.com> +- vinhha96 <anhvinha1@gmail.com> +- voidman <retmain@foxmail.com> +- vz <vzvway@gmail.com> +- wei <wei840222@gmail.com> +- weibaohui <weibaohui@yeah.net> +- whirosan <whirosan@users.noreply.github.com> +- willnewrelic <will@newrelic.com> +- wssccc <wssccc@qq.com> +- wuhuizuo <wuhuizuo@126.com> +- xyb <xyb4638@gmail.com> +- y-yagi <yuuji.yaginuma@gmail.com> +- yiranzai <wuqingdzx@gmail.com> +- youzeliang <youzel@126.com> +- yugu <chenzilong_1227@foxmail.com> +- yuyabe <yuyabee@gmail.com> +- zebozhuang <zebozhuang@163.com> +- zero11-0203 <93071220+zero11-0203@users.noreply.github.com> +- zesani <7sin@outlook.co.th> +- zhanweidu <zhanweidu@163.com> +- zhing <zqwillseven@gmail.com> +- ziheng <zihenglv@gmail.com> +- zzjin <zzjin@users.noreply.github.com> +- 森 優太 <59682979+uta-mori@users.noreply.github.com> +- 杰哥 <858806258@qq.com> +- 涛叔 <hi@taoshu.in> +- 市民233 <mengrenxiong@gmail.com> +- 尹宝强 <wmdandme@gmail.com> +- 梦溪笔谈 <loongmxbt@gmail.com> +- 飞雪无情 <ls8707@gmail.com> +- 寻寻觅觅的Gopher <zoujh99@qq.com> diff --git a/vendor/github.com/gin-gonic/gin/CHANGELOG.md b/vendor/github.com/gin-gonic/gin/CHANGELOG.md index 4c806a5a7..1bc51a8c9 100644 --- a/vendor/github.com/gin-gonic/gin/CHANGELOG.md +++ b/vendor/github.com/gin-gonic/gin/CHANGELOG.md @@ -1,5 +1,53 @@ # Gin ChangeLog +## Gin v1.8.1 + +### ENHANCEMENTS + +* feat(context): add ContextWithFallback feature flag [#3172](https://github.com/gin-gonic/gin/pull/3172) + +## Gin v1.8.0 + +## Break Changes + +* TrustedProxies: Add default IPv6 support and refactor [#2967](https://github.com/gin-gonic/gin/pull/2967). Please replace `RemoteIP() (net.IP, bool)` with `RemoteIP() net.IP` +* gin.Context with fallback value from gin.Context.Request.Context() [#2751](https://github.com/gin-gonic/gin/pull/2751) + +### BUGFIXES + +* Fixed SetOutput() panics on go 1.17 [#2861](https://github.com/gin-gonic/gin/pull/2861) +* Fix: wrong when wildcard follows named param [#2983](https://github.com/gin-gonic/gin/pull/2983) +* Fix: missing sameSite when do context.reset() [#3123](https://github.com/gin-gonic/gin/pull/3123) + +### ENHANCEMENTS + +* Use Header() instead of deprecated HeaderMap [#2694](https://github.com/gin-gonic/gin/pull/2694) +* RouterGroup.Handle regular match optimization of http method [#2685](https://github.com/gin-gonic/gin/pull/2685) +* Add support go-json, another drop-in json replacement [#2680](https://github.com/gin-gonic/gin/pull/2680) +* Use errors.New to replace fmt.Errorf will much better [#2707](https://github.com/gin-gonic/gin/pull/2707) +* Use Duration.Truncate for truncating precision [#2711](https://github.com/gin-gonic/gin/pull/2711) +* Get client IP when using Cloudflare [#2723](https://github.com/gin-gonic/gin/pull/2723) +* Optimize code adjust [#2700](https://github.com/gin-gonic/gin/pull/2700/files) +* Optimize code and reduce code cyclomatic complexity [#2737](https://github.com/gin-gonic/gin/pull/2737) +* Improve sliceValidateError.Error performance [#2765](https://github.com/gin-gonic/gin/pull/2765) +* Support custom struct tag [#2720](https://github.com/gin-gonic/gin/pull/2720) +* Improve router group tests [#2787](https://github.com/gin-gonic/gin/pull/2787) +* Fallback Context.Deadline() Context.Done() Context.Err() to Context.Request.Context() [#2769](https://github.com/gin-gonic/gin/pull/2769) +* Some codes optimize [#2830](https://github.com/gin-gonic/gin/pull/2830) [#2834](https://github.com/gin-gonic/gin/pull/2834) [#2838](https://github.com/gin-gonic/gin/pull/2838) [#2837](https://github.com/gin-gonic/gin/pull/2837) [#2788](https://github.com/gin-gonic/gin/pull/2788) [#2848](https://github.com/gin-gonic/gin/pull/2848) [#2851](https://github.com/gin-gonic/gin/pull/2851) [#2701](https://github.com/gin-gonic/gin/pull/2701) +* TrustedProxies: Add default IPv6 support and refactor [#2967](https://github.com/gin-gonic/gin/pull/2967) +* Test(route): expose performRequest func [#3012](https://github.com/gin-gonic/gin/pull/3012) +* Support h2c with prior knowledge [#1398](https://github.com/gin-gonic/gin/pull/1398) +* Feat attachment filename support utf8 [#3071](https://github.com/gin-gonic/gin/pull/3071) +* Feat: add StaticFileFS [#2749](https://github.com/gin-gonic/gin/pull/2749) +* Feat(context): return GIN Context from Value method [#2825](https://github.com/gin-gonic/gin/pull/2825) +* Feat: automatically SetMode to TestMode when run go test [#3139](https://github.com/gin-gonic/gin/pull/3139) +* Add TOML bining for gin [#3081](https://github.com/gin-gonic/gin/pull/3081) +* IPv6 add default trusted proxies [#3033](https://github.com/gin-gonic/gin/pull/3033) + +### DOCS + +* Add note about nomsgpack tag to the readme [#2703](https://github.com/gin-gonic/gin/pull/2703) + ## Gin v1.7.7 ### BUGFIXES diff --git a/vendor/github.com/gin-gonic/gin/CONTRIBUTING.md b/vendor/github.com/gin-gonic/gin/CONTRIBUTING.md index 97daa808f..d1c723c67 100644 --- a/vendor/github.com/gin-gonic/gin/CONTRIBUTING.md +++ b/vendor/github.com/gin-gonic/gin/CONTRIBUTING.md @@ -8,6 +8,6 @@ - With pull requests: - Open your pull request against `master` - Your pull request should have no more than two commits, if not you should squash them. - - It should pass all tests in the available continuous integration systems such as TravisCI. + - It should pass all tests in the available continuous integration systems such as GitHub Actions. - You should add/modify tests to cover your proposed code changes. - If your pull request contains a new feature, please document it on the README. diff --git a/vendor/github.com/gin-gonic/gin/Makefile b/vendor/github.com/gin-gonic/gin/Makefile index 1a9919395..5d55b444c 100644 --- a/vendor/github.com/gin-gonic/gin/Makefile +++ b/vendor/github.com/gin-gonic/gin/Makefile @@ -1,5 +1,6 @@ GO ?= go GOFMT ?= gofmt "-s" +GO_VERSION=$(shell $(GO) version | cut -c 14- | cut -d' ' -f1 | cut -d'.' -f2) PACKAGES ?= $(shell $(GO) list ./...) VETPACKAGES ?= $(shell $(GO) list ./... | grep -v /examples/) GOFILES := $(shell find . -name "*.go") @@ -67,5 +68,10 @@ misspell: .PHONY: tools tools: - go install golang.org/x/lint/golint; \ - go install github.com/client9/misspell/cmd/misspell; + @if [ $(GO_VERSION) -gt 15 ]; then \ + $(GO) install golang.org/x/lint/golint@latest; \ + $(GO) install github.com/client9/misspell/cmd/misspell@latest; \ + elif [ $(GO_VERSION) -lt 16 ]; then \ + $(GO) install golang.org/x/lint/golint; \ + $(GO) install github.com/client9/misspell/cmd/misspell; \ + fi diff --git a/vendor/github.com/gin-gonic/gin/README.md b/vendor/github.com/gin-gonic/gin/README.md index 9bf459b09..5cc8321b6 100644 --- a/vendor/github.com/gin-gonic/gin/README.md +++ b/vendor/github.com/gin-gonic/gin/README.md @@ -2,7 +2,7 @@ <img align="right" width="159px" src="https://raw.githubusercontent.com/gin-gonic/logo/master/color.png"> -[](https://travis-ci.org/gin-gonic/gin) +[](https://github.com/gin-gonic/gin/actions?query=branch%3Amaster) [](https://codecov.io/gh/gin-gonic/gin) [](https://goreportcard.com/report/github.com/gin-gonic/gin) [](https://pkg.go.dev/github.com/gin-gonic/gin?tab=doc) @@ -23,7 +23,8 @@ Gin is a web framework written in Go (Golang). It features a martini-like API wi - [Quick start](#quick-start) - [Benchmarks](#benchmarks) - [Gin v1. stable](#gin-v1-stable) - - [Build with jsoniter](#build-with-jsoniter) + - [Build with jsoniter/go-json](#build-with-json-replacement) + - [Build without `MsgPack` rendering feature](#build-without-msgpack-rendering-feature) - [API Examples](#api-examples) - [Using GET, POST, PUT, PATCH, DELETE and OPTIONS](#using-get-post-put-patch-delete-and-options) - [Parameters in path](#parameters-in-path) @@ -77,7 +78,7 @@ Gin is a web framework written in Go (Golang). It features a martini-like API wi - [http2 server push](#http2-server-push) - [Define format for the log of routes](#define-format-for-the-log-of-routes) - [Set and get a cookie](#set-and-get-a-cookie) - - [Don't trust all proxies](#don't-trust-all-proxies) + - [Don't trust all proxies](#dont-trust-all-proxies) - [Testing](#testing) - [Users](#users) @@ -85,7 +86,7 @@ Gin is a web framework written in Go (Golang). It features a martini-like API wi To install Gin package, you need to install Go and set your Go workspace first. -1. The first need [Go](https://golang.org/) installed (**version 1.13+ is required**), then you can use the below Go command to install Gin. +1. You first need [Go](https://golang.org/) installed (**version 1.14+ is required**), then you can use the below Go command to install Gin. ```sh $ go get -u github.com/gin-gonic/gin @@ -113,12 +114,16 @@ $ cat example.go ```go package main -import "github.com/gin-gonic/gin" +import ( + "net/http" + + "github.com/gin-gonic/gin" +) func main() { r := gin.Default() r.GET("/ping", func(c *gin.Context) { - c.JSON(200, gin.H{ + c.JSON(http.StatusOK, gin.H{ "message": "pong", }) }) @@ -183,13 +188,28 @@ Gin uses a custom version of [HttpRouter](https://github.com/julienschmidt/httpr - [x] Battle tested. - [x] API frozen, new releases will not break your code. -## Build with [jsoniter](https://github.com/json-iterator/go) +## Build with json replacement -Gin uses `encoding/json` as default json package but you can change to [jsoniter](https://github.com/json-iterator/go) by build from other tags. +Gin uses `encoding/json` as default json package but you can change it by build from other tags. +[jsoniter](https://github.com/json-iterator/go) ```sh $ go build -tags=jsoniter . ``` +[go-json](https://github.com/goccy/go-json) +```sh +$ go build -tags=go_json . +``` + +## Build without `MsgPack` rendering feature + +Gin enables `MsgPack` rendering feature by default. But you can disable this feature by specifying `nomsgpack` build tag. + +```sh +$ go build -tags=nomsgpack . +``` + +This is useful to reduce the binary size of executable files. See the [detail information](https://github.com/gin-gonic/gin/pull/1852). ## API Examples @@ -241,14 +261,15 @@ func main() { // For each matched request Context will hold the route definition router.POST("/user/:name/*action", func(c *gin.Context) { - c.FullPath() == "/user/:name/*action" // true + b := c.FullPath() == "/user/:name/*action" // true + c.String(http.StatusOK, "%t", b) }) // This handler will add a new router for /user/groups. // Exact routes are resolved before param routes, regardless of the order they were defined. // Routes starting with /user/groups are never interpreted as /user/:name/... routes router.GET("/user/groups", func(c *gin.Context) { - c.String(http.StatusOK, "The available groups are [...]", name) + c.String(http.StatusOK, "The available groups are [...]") }) router.Run(":8080") @@ -283,7 +304,7 @@ func main() { message := c.PostForm("message") nick := c.DefaultPostForm("nick", "anonymous") - c.JSON(200, gin.H{ + c.JSON(http.StatusOK, gin.H{ "status": "posted", "message": message, "nick": nick, @@ -367,7 +388,7 @@ func main() { // Set a lower memory limit for multipart forms (default is 32 MiB) router.MaxMultipartMemory = 8 << 20 // 8 MiB router.POST("/upload", func(c *gin.Context) { - // single file + // Single file file, _ := c.FormFile("file") log.Println(file.Filename) @@ -496,6 +517,7 @@ func main() { // nested group testing := authorized.Group("testing") + // visit 0.0.0.0:8080/testing/analytics testing.GET("/analytics", analyticsEndpoint) } @@ -552,7 +574,7 @@ func main() { router := gin.Default() router.GET("/ping", func(c *gin.Context) { - c.String(200, "pong") + c.String(http.StatusOK, "pong") }) router.Run(":8080") @@ -584,7 +606,7 @@ func main() { router.Use(gin.Recovery()) router.GET("/ping", func(c *gin.Context) { - c.String(200, "pong") + c.String(http.StatusOK, "pong") }) router.Run(":8080") @@ -612,7 +634,7 @@ func main() { router := gin.Default() router.GET("/ping", func(c *gin.Context) { - c.String(200, "pong") + c.String(http.StatusOK, "pong") }) router.Run(":8080") @@ -631,7 +653,7 @@ func main() { router := gin.Default() router.GET("/ping", func(c *gin.Context) { - c.String(200, "pong") + c.String(http.StatusOK, "pong") }) router.Run(":8080") @@ -640,7 +662,7 @@ func main() { ### Model binding and validation -To bind a request body into a type, use model binding. We currently support binding of JSON, XML, YAML and standard form values (foo=bar&boo=baz). +To bind a request body into a type, use model binding. We currently support binding of JSON, XML, YAML, TOML and standard form values (foo=bar&boo=baz). Gin uses [**go-playground/validator/v10**](https://github.com/go-playground/validator) for validation. Check the full docs on tags usage [here](https://godoc.org/github.com/go-playground/validator#hdr-Baked_In_Validators_and_Tags). @@ -648,10 +670,10 @@ Note that you need to set the corresponding binding tag on all fields you want t Also, Gin provides two sets of methods for binding: - **Type** - Must bind - - **Methods** - `Bind`, `BindJSON`, `BindXML`, `BindQuery`, `BindYAML`, `BindHeader` + - **Methods** - `Bind`, `BindJSON`, `BindXML`, `BindQuery`, `BindYAML`, `BindHeader`, `BindTOML` - **Behavior** - These methods use `MustBindWith` under the hood. If there is a binding error, the request is aborted with `c.AbortWithError(400, err).SetType(ErrorTypeBind)`. This sets the response status code to 400 and the `Content-Type` header is set to `text/plain; charset=utf-8`. Note that if you try to set the response code after this, it will result in a warning `[GIN-debug] [WARNING] Headers were already written. Wanted to override status code 400 with 422`. If you wish to have greater control over the behavior, consider using the `ShouldBind` equivalent method. - **Type** - Should bind - - **Methods** - `ShouldBind`, `ShouldBindJSON`, `ShouldBindXML`, `ShouldBindQuery`, `ShouldBindYAML`, `ShouldBindHeader` + - **Methods** - `ShouldBind`, `ShouldBindJSON`, `ShouldBindXML`, `ShouldBindQuery`, `ShouldBindYAML`, `ShouldBindHeader`, `ShouldBindTOML`, - **Behavior** - These methods use `ShouldBindWith` under the hood. If there is a binding error, the error is returned and it is the developer's responsibility to handle the request and error appropriately. When using the Bind-method, Gin tries to infer the binder depending on the Content-Type header. If you are sure what you are binding, you can use `MustBindWith` or `ShouldBindWith`. @@ -687,7 +709,7 @@ func main() { // Example for binding XML ( // <?xml version="1.0" encoding="UTF-8"?> // <root> - // <user>user</user> + // <user>manu</user> // <password>123</password> // </root>) router.POST("/loginXML", func(c *gin.Context) { @@ -830,6 +852,7 @@ package main import ( "log" + "net/http" "github.com/gin-gonic/gin" ) @@ -852,7 +875,7 @@ func startPage(c *gin.Context) { log.Println(person.Name) log.Println(person.Address) } - c.String(200, "Success") + c.String(http.StatusOK, "Success") } ``` @@ -866,6 +889,7 @@ package main import ( "log" + "net/http" "time" "github.com/gin-gonic/gin" @@ -889,7 +913,7 @@ func startPage(c *gin.Context) { var person Person // If `GET`, only `Form` binding engine (`query`) used. // If `POST`, first checks the `content-type` for `JSON` or `XML`, then uses `Form` (`form-data`). - // See more at https://github.com/gin-gonic/gin/blob/master/binding/binding.go#L48 + // See more at https://github.com/gin-gonic/gin/blob/master/binding/binding.go#L88 if c.ShouldBind(&person) == nil { log.Println(person.Name) log.Println(person.Address) @@ -898,7 +922,7 @@ func startPage(c *gin.Context) { log.Println(person.UnixTime) } - c.String(200, "Success") + c.String(http.StatusOK, "Success") } ``` @@ -914,7 +938,11 @@ See the [detail information](https://github.com/gin-gonic/gin/issues/846). ```go package main -import "github.com/gin-gonic/gin" +import ( + "net/http" + + "github.com/gin-gonic/gin" +) type Person struct { ID string `uri:"id" binding:"required,uuid"` @@ -926,10 +954,10 @@ func main() { route.GET("/:name/:id", func(c *gin.Context) { var person Person if err := c.ShouldBindUri(&person); err != nil { - c.JSON(400, gin.H{"msg": err}) + c.JSON(http.StatusBadRequest, gin.H{"msg": err.Error()}) return } - c.JSON(200, gin.H{"name": person.Name, "uuid": person.ID}) + c.JSON(http.StatusOK, gin.H{"name": person.Name, "uuid": person.ID}) }) route.Run(":8088") } @@ -948,6 +976,8 @@ package main import ( "fmt" + "net/http" + "github.com/gin-gonic/gin" ) @@ -962,11 +992,11 @@ func main() { h := testHeader{} if err := c.ShouldBindHeader(&h); err != nil { - c.JSON(200, err) + c.JSON(http.StatusOK, err) } fmt.Printf("%#v\n", h) - c.JSON(200, gin.H{"Rate": h.Rate, "Domain": h.Domain}) + c.JSON(http.StatusOK, gin.H{"Rate": h.Rate, "Domain": h.Domain}) }) r.Run() @@ -996,7 +1026,7 @@ type myForm struct { func formHandler(c *gin.Context) { var fakeForm myForm c.ShouldBind(&fakeForm) - c.JSON(200, gin.H{"color": fakeForm.Colors}) + c.JSON(http.StatusOK, gin.H{"color": fakeForm.Colors}) } ... @@ -1201,14 +1231,14 @@ func main() { // Serves unicode entities r.GET("/json", func(c *gin.Context) { - c.JSON(200, gin.H{ + c.JSON(http.StatusOK, gin.H{ "html": "<b>Hello, world!</b>", }) }) // Serves literal characters r.GET("/purejson", func(c *gin.Context) { - c.PureJSON(200, gin.H{ + c.PureJSON(http.StatusOK, gin.H{ "html": "<b>Hello, world!</b>", }) }) @@ -1226,7 +1256,8 @@ func main() { router.Static("/assets", "./assets") router.StaticFS("/more_static", http.Dir("my_file_system")) router.StaticFile("/favicon.ico", "./resources/favicon.ico") - + router.StaticFileFS("/more_favicon.ico", "more_favicon.ico", http.Dir("my_file_system")) + // Listen and serve on 0.0.0.0:8080 router.Run(":8080") } @@ -1392,7 +1423,7 @@ import ( func formatAsDate(t time.Time) string { year, month, day := t.Date() - return fmt.Sprintf("%d%02d/%02d", year, month, day) + return fmt.Sprintf("%d/%02d/%02d", year, month, day) } func main() { @@ -1454,7 +1485,7 @@ r.GET("/test", func(c *gin.Context) { r.HandleContext(c) }) r.GET("/test2", func(c *gin.Context) { - c.JSON(200, gin.H{"hello": "world"}) + c.JSON(http.StatusOK, gin.H{"hello": "world"}) }) ``` @@ -1607,6 +1638,7 @@ package main import ( "log" + "net/http" "github.com/gin-gonic/autotls" "github.com/gin-gonic/gin" @@ -1617,7 +1649,7 @@ func main() { // Ping handler r.GET("/ping", func(c *gin.Context) { - c.String(200, "pong") + c.String(http.StatusOK, "pong") }) log.Fatal(autotls.Run(r, "example1.com", "example2.com")) @@ -1631,6 +1663,7 @@ package main import ( "log" + "net/http" "github.com/gin-gonic/autotls" "github.com/gin-gonic/gin" @@ -1642,7 +1675,7 @@ func main() { // Ping handler r.GET("/ping", func(c *gin.Context) { - c.String(200, "pong") + c.String(http.StatusOK, "pong") }) m := autocert.Manager{ @@ -1811,7 +1844,7 @@ func main() { quit := make(chan os.Signal) // kill (no param) default send syscall.SIGTERM // kill -2 is syscall.SIGINT - // kill -9 is syscall.SIGKILL but can't be catch, so don't need add it + // kill -9 is syscall.SIGKILL but can't be caught, so don't need to add it signal.Notify(quit, syscall.SIGINT, syscall.SIGTERM) <-quit log.Println("Shutting down server...") @@ -1903,7 +1936,7 @@ type StructD struct { func GetDataB(c *gin.Context) { var b StructB c.Bind(&b) - c.JSON(200, gin.H{ + c.JSON(http.StatusOK, gin.H{ "a": b.NestedStruct, "b": b.FieldB, }) @@ -1912,7 +1945,7 @@ func GetDataB(c *gin.Context) { func GetDataC(c *gin.Context) { var b StructC c.Bind(&b) - c.JSON(200, gin.H{ + c.JSON(http.StatusOK, gin.H{ "a": b.NestedStructPointer, "c": b.FieldC, }) @@ -1921,7 +1954,7 @@ func GetDataC(c *gin.Context) { func GetDataD(c *gin.Context) { var b StructD c.Bind(&b) - c.JSON(200, gin.H{ + c.JSON(http.StatusOK, gin.H{ "x": b.NestedAnonyStruct, "d": b.FieldD, }) @@ -1984,7 +2017,7 @@ func SomeHandler(c *gin.Context) { objA := formA{} objB := formB{} // This reads c.Request.Body and stores the result into the context. - if errA := c.ShouldBindBodyWith(&objA, binding.JSON); errA == nil { + if errA := c.ShouldBindBodyWith(&objA, binding.Form); errA == nil { c.String(http.StatusOK, `the body should be formA`) // At this time, it reuses body stored in the context. } else if errB := c.ShouldBindBodyWith(&objB, binding.JSON); errB == nil { @@ -2006,6 +2039,61 @@ enough to call binding at once. can be called by `c.ShouldBind()` multiple times without any damage to performance (See [#1341](https://github.com/gin-gonic/gin/pull/1341)). +### Bind form-data request with custom struct and custom tag + +```go +const ( + customerTag = "url" + defaultMemory = 32 << 20 +) + +type customerBinding struct {} + +func (customerBinding) Name() string { + return "form" +} + +func (customerBinding) Bind(req *http.Request, obj interface{}) error { + if err := req.ParseForm(); err != nil { + return err + } + if err := req.ParseMultipartForm(defaultMemory); err != nil { + if err != http.ErrNotMultipart { + return err + } + } + if err := binding.MapFormWithTag(obj, req.Form, customerTag); err != nil { + return err + } + return validate(obj) +} + +func validate(obj interface{}) error { + if binding.Validator == nil { + return nil + } + return binding.Validator.ValidateStruct(obj) +} + +// Now we can do this!!! +// FormA is a external type that we can't modify it's tag +type FormA struct { + FieldA string `url:"field_a"` +} + +func ListHandler(s *Service) func(ctx *gin.Context) { + return func(ctx *gin.Context) { + var urlBinding = customerBinding{} + var opt FormA + err := ctx.MustBindWith(&opt, urlBinding) + if err != nil { + ... + } + ... + } +} +``` + ### http2 server push http.Pusher is supported only **go1.8+**. See the [golang blog](https://blog.golang.org/h2push) for detail information. @@ -2016,6 +2104,7 @@ package main import ( "html/template" "log" + "net/http" "github.com/gin-gonic/gin" ) @@ -2044,7 +2133,7 @@ func main() { log.Printf("Failed to push: %v", err) } } - c.HTML(200, "https", gin.H{ + c.HTML(http.StatusOK, "https", gin.H{ "status": "success", }) }) @@ -2200,10 +2289,16 @@ The `net/http/httptest` package is preferable way for HTTP testing. ```go package main +import ( + "net/http" + + "github.com/gin-gonic/gin" +) + func setupRouter() *gin.Engine { r := gin.Default() r.GET("/ping", func(c *gin.Context) { - c.String(200, "pong") + c.String(http.StatusOK, "pong") }) return r } @@ -2231,10 +2326,10 @@ func TestPingRoute(t *testing.T) { router := setupRouter() w := httptest.NewRecorder() - req, _ := http.NewRequest("GET", "/ping", nil) + req, _ := http.NewRequest(http.MethodGet, "/ping", nil) router.ServeHTTP(w, req) - assert.Equal(t, 200, w.Code) + assert.Equal(t, http.StatusOK, w.Code) assert.Equal(t, "pong", w.Body.String()) } ``` @@ -2250,3 +2345,4 @@ Awesome project lists using [Gin](https://github.com/gin-gonic/gin) web framewor * [picfit](https://github.com/thoas/picfit): An image resizing server written in Go. * [brigade](https://github.com/brigadecore/brigade): Event-based Scripting for Kubernetes. * [dkron](https://github.com/distribworks/dkron): Distributed, fault tolerant job scheduling system. + diff --git a/vendor/github.com/gin-gonic/gin/any.go b/vendor/github.com/gin-gonic/gin/any.go new file mode 100644 index 000000000..42b1ea46f --- /dev/null +++ b/vendor/github.com/gin-gonic/gin/any.go @@ -0,0 +1,10 @@ +// Copyright 2022 Gin Core Team. All rights reserved. +// Use of this source code is governed by a MIT style +// license that can be found in the LICENSE file. + +//go:build !go1.18 +// +build !go1.18 + +package gin + +type any = interface{} diff --git a/vendor/github.com/gin-gonic/gin/auth.go b/vendor/github.com/gin-gonic/gin/auth.go index 4d8a6ce48..2503c5156 100644 --- a/vendor/github.com/gin-gonic/gin/auth.go +++ b/vendor/github.com/gin-gonic/gin/auth.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -31,7 +31,7 @@ func (a authPairs) searchCredential(authValue string) (string, bool) { return "", false } for _, pair := range a { - if subtle.ConstantTimeCompare([]byte(pair.value), []byte(authValue)) == 1 { + if subtle.ConstantTimeCompare(bytesconv.StringToBytes(pair.value), bytesconv.StringToBytes(authValue)) == 1 { return pair.user, true } } diff --git a/vendor/github.com/gin-gonic/gin/binding/any.go b/vendor/github.com/gin-gonic/gin/binding/any.go new file mode 100644 index 000000000..d8251a7c2 --- /dev/null +++ b/vendor/github.com/gin-gonic/gin/binding/any.go @@ -0,0 +1,10 @@ +// Copyright 2022 Gin Core Team. All rights reserved. +// Use of this source code is governed by a MIT style +// license that can be found in the LICENSE file. + +//go:build !go1.18 +// +build !go1.18 + +package binding + +type any = interface{} diff --git a/vendor/github.com/gin-gonic/gin/binding/binding.go b/vendor/github.com/gin-gonic/gin/binding/binding.go index 5caeb581a..a58924ed3 100644 --- a/vendor/github.com/gin-gonic/gin/binding/binding.go +++ b/vendor/github.com/gin-gonic/gin/binding/binding.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -22,6 +22,7 @@ const ( MIMEMSGPACK = "application/x-msgpack" MIMEMSGPACK2 = "application/msgpack" MIMEYAML = "application/x-yaml" + MIMETOML = "application/toml" ) // Binding describes the interface which needs to be implemented for binding the @@ -29,27 +30,27 @@ const ( // the form POST. type Binding interface { Name() string - Bind(*http.Request, interface{}) error + Bind(*http.Request, any) error } // BindingBody adds BindBody method to Binding. BindBody is similar with Bind, // but it reads the body from supplied bytes instead of req.Body. type BindingBody interface { Binding - BindBody([]byte, interface{}) error + BindBody([]byte, any) error } // BindingUri adds BindUri method to Binding. BindUri is similar with Bind, -// but it read the Params. +// but it reads the Params. type BindingUri interface { Name() string - BindUri(map[string][]string, interface{}) error + BindUri(map[string][]string, any) error } // StructValidator is the minimal interface which needs to be implemented in // order for it to be used as the validator engine for ensuring the correctness // of the request. Gin provides a default implementation for this using -// https://github.com/go-playground/validator/tree/v8.18.2. +// https://github.com/go-playground/validator/tree/v10.6.1. type StructValidator interface { // ValidateStruct can receive any kind of type and it should never panic, even if the configuration is not right. // If the received type is a slice|array, the validation should be performed travel on every element. @@ -57,15 +58,15 @@ type StructValidator interface { // If the received type is a struct or pointer to a struct, the validation should be performed. // If the struct is not valid or the validation itself fails, a descriptive error should be returned. // Otherwise nil must be returned. - ValidateStruct(interface{}) error + ValidateStruct(any) error // Engine returns the underlying validator engine which powers the // StructValidator implementation. - Engine() interface{} + Engine() any } // Validator is the default validator which implements the StructValidator -// interface. It uses https://github.com/go-playground/validator/tree/v8.18.2 +// interface. It uses https://github.com/go-playground/validator/tree/v10.6.1 // under the hood. var Validator StructValidator = &defaultValidator{} @@ -83,6 +84,7 @@ var ( YAML = yamlBinding{} Uri = uriBinding{} Header = headerBinding{} + TOML = tomlBinding{} ) // Default returns the appropriate Binding instance based on the HTTP method @@ -103,6 +105,8 @@ func Default(method, contentType string) Binding { return MsgPack case MIMEYAML: return YAML + case MIMETOML: + return TOML case MIMEMultipartPOSTForm: return FormMultipart default: // case MIMEPOSTForm: @@ -110,7 +114,7 @@ func Default(method, contentType string) Binding { } } -func validate(obj interface{}) error { +func validate(obj any) error { if Validator == nil { return nil } diff --git a/vendor/github.com/gin-gonic/gin/binding/binding_nomsgpack.go b/vendor/github.com/gin-gonic/gin/binding/binding_nomsgpack.go index 9afa3dcf6..7f6a904ab 100644 --- a/vendor/github.com/gin-gonic/gin/binding/binding_nomsgpack.go +++ b/vendor/github.com/gin-gonic/gin/binding/binding_nomsgpack.go @@ -20,6 +20,7 @@ const ( MIMEMultipartPOSTForm = "multipart/form-data" MIMEPROTOBUF = "application/x-protobuf" MIMEYAML = "application/x-yaml" + MIMETOML = "application/toml" ) // Binding describes the interface which needs to be implemented for binding the @@ -27,42 +28,42 @@ const ( // the form POST. type Binding interface { Name() string - Bind(*http.Request, interface{}) error + Bind(*http.Request, any) error } // BindingBody adds BindBody method to Binding. BindBody is similar with Bind, // but it reads the body from supplied bytes instead of req.Body. type BindingBody interface { Binding - BindBody([]byte, interface{}) error + BindBody([]byte, any) error } // BindingUri adds BindUri method to Binding. BindUri is similar with Bind, -// but it read the Params. +// but it reads the Params. type BindingUri interface { Name() string - BindUri(map[string][]string, interface{}) error + BindUri(map[string][]string, any) error } // StructValidator is the minimal interface which needs to be implemented in // order for it to be used as the validator engine for ensuring the correctness // of the request. Gin provides a default implementation for this using -// https://github.com/go-playground/validator/tree/v8.18.2. +// https://github.com/go-playground/validator/tree/v10.6.1. type StructValidator interface { // ValidateStruct can receive any kind of type and it should never panic, even if the configuration is not right. // If the received type is not a struct, any validation should be skipped and nil must be returned. // If the received type is a struct or pointer to a struct, the validation should be performed. // If the struct is not valid or the validation itself fails, a descriptive error should be returned. // Otherwise nil must be returned. - ValidateStruct(interface{}) error + ValidateStruct(any) error // Engine returns the underlying validator engine which powers the // StructValidator implementation. - Engine() interface{} + Engine() any } // Validator is the default validator which implements the StructValidator -// interface. It uses https://github.com/go-playground/validator/tree/v8.18.2 +// interface. It uses https://github.com/go-playground/validator/tree/v10.6.1 // under the hood. var Validator StructValidator = &defaultValidator{} @@ -79,6 +80,7 @@ var ( YAML = yamlBinding{} Uri = uriBinding{} Header = headerBinding{} + TOML = tomlBinding{} ) // Default returns the appropriate Binding instance based on the HTTP method @@ -99,12 +101,14 @@ func Default(method, contentType string) Binding { return YAML case MIMEMultipartPOSTForm: return FormMultipart + case MIMETOML: + return TOML default: // case MIMEPOSTForm: return Form } } -func validate(obj interface{}) error { +func validate(obj any) error { if Validator == nil { return nil } diff --git a/vendor/github.com/gin-gonic/gin/binding/default_validator.go b/vendor/github.com/gin-gonic/gin/binding/default_validator.go index c57a120fc..c03afe75b 100644 --- a/vendor/github.com/gin-gonic/gin/binding/default_validator.go +++ b/vendor/github.com/gin-gonic/gin/binding/default_validator.go @@ -1,4 +1,4 @@ -// Copyright 2017 Manu Martinez-Almeida. All rights reserved. +// Copyright 2017 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -18,23 +18,35 @@ type defaultValidator struct { validate *validator.Validate } -type sliceValidateError []error +type SliceValidationError []error -func (err sliceValidateError) Error() string { - var errMsgs []string - for i, e := range err { - if e == nil { - continue +// Error concatenates all error elements in SliceValidationError into a single string separated by \n. +func (err SliceValidationError) Error() string { + n := len(err) + switch n { + case 0: + return "" + default: + var b strings.Builder + if err[0] != nil { + fmt.Fprintf(&b, "[%d]: %s", 0, err[0].Error()) + } + if n > 1 { + for i := 1; i < n; i++ { + if err[i] != nil { + b.WriteString("\n") + fmt.Fprintf(&b, "[%d]: %s", i, err[i].Error()) + } + } } - errMsgs = append(errMsgs, fmt.Sprintf("[%d]: %s", i, e.Error())) + return b.String() } - return strings.Join(errMsgs, "\n") } var _ StructValidator = &defaultValidator{} // ValidateStruct receives any kind of type, but only performed struct or pointer to struct type. -func (v *defaultValidator) ValidateStruct(obj interface{}) error { +func (v *defaultValidator) ValidateStruct(obj any) error { if obj == nil { return nil } @@ -47,7 +59,7 @@ func (v *defaultValidator) ValidateStruct(obj interface{}) error { return v.validateStruct(obj) case reflect.Slice, reflect.Array: count := value.Len() - validateRet := make(sliceValidateError, 0) + validateRet := make(SliceValidationError, 0) for i := 0; i < count; i++ { if err := v.ValidateStruct(value.Index(i).Interface()); err != nil { validateRet = append(validateRet, err) @@ -63,7 +75,7 @@ func (v *defaultValidator) ValidateStruct(obj interface{}) error { } // validateStruct receives struct type -func (v *defaultValidator) validateStruct(obj interface{}) error { +func (v *defaultValidator) validateStruct(obj any) error { v.lazyinit() return v.validate.Struct(obj) } @@ -71,8 +83,8 @@ func (v *defaultValidator) validateStruct(obj interface{}) error { // Engine returns the underlying validator engine which powers the default // Validator instance. This is useful if you want to register custom validations // or struct level validations. See validator GoDoc for more info - -// https://godoc.org/gopkg.in/go-playground/validator.v8 -func (v *defaultValidator) Engine() interface{} { +// https://pkg.go.dev/github.com/go-playground/validator/v10 +func (v *defaultValidator) Engine() any { v.lazyinit() return v.validate } diff --git a/vendor/github.com/gin-gonic/gin/binding/form.go b/vendor/github.com/gin-gonic/gin/binding/form.go index b93c34cf4..b17352bad 100644 --- a/vendor/github.com/gin-gonic/gin/binding/form.go +++ b/vendor/github.com/gin-gonic/gin/binding/form.go @@ -1,10 +1,11 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. package binding import ( + "errors" "net/http" ) @@ -18,14 +19,12 @@ func (formBinding) Name() string { return "form" } -func (formBinding) Bind(req *http.Request, obj interface{}) error { +func (formBinding) Bind(req *http.Request, obj any) error { if err := req.ParseForm(); err != nil { return err } - if err := req.ParseMultipartForm(defaultMemory); err != nil { - if err != http.ErrNotMultipart { - return err - } + if err := req.ParseMultipartForm(defaultMemory); err != nil && !errors.Is(err, http.ErrNotMultipart) { + return err } if err := mapForm(obj, req.Form); err != nil { return err @@ -37,7 +36,7 @@ func (formPostBinding) Name() string { return "form-urlencoded" } -func (formPostBinding) Bind(req *http.Request, obj interface{}) error { +func (formPostBinding) Bind(req *http.Request, obj any) error { if err := req.ParseForm(); err != nil { return err } @@ -51,7 +50,7 @@ func (formMultipartBinding) Name() string { return "multipart/form-data" } -func (formMultipartBinding) Bind(req *http.Request, obj interface{}) error { +func (formMultipartBinding) Bind(req *http.Request, obj any) error { if err := req.ParseMultipartForm(defaultMemory); err != nil { return err } diff --git a/vendor/github.com/gin-gonic/gin/binding/form_mapping.go b/vendor/github.com/gin-gonic/gin/binding/form_mapping.go index 2f4e45b40..98cebfecf 100644 --- a/vendor/github.com/gin-gonic/gin/binding/form_mapping.go +++ b/vendor/github.com/gin-gonic/gin/binding/form_mapping.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -16,22 +16,34 @@ import ( "github.com/gin-gonic/gin/internal/json" ) -var errUnknownType = errors.New("unknown type") +var ( + errUnknownType = errors.New("unknown type") -func mapUri(ptr interface{}, m map[string][]string) error { + // ErrConvertMapStringSlice can not covert to map[string][]string + ErrConvertMapStringSlice = errors.New("can not convert to map slices of strings") + + // ErrConvertToMapString can not convert to map[string]string + ErrConvertToMapString = errors.New("can not convert to map of strings") +) + +func mapURI(ptr any, m map[string][]string) error { return mapFormByTag(ptr, m, "uri") } -func mapForm(ptr interface{}, form map[string][]string) error { +func mapForm(ptr any, form map[string][]string) error { return mapFormByTag(ptr, form, "form") } +func MapFormWithTag(ptr any, form map[string][]string, tag string) error { + return mapFormByTag(ptr, form, tag) +} + var emptyField = reflect.StructField{} -func mapFormByTag(ptr interface{}, form map[string][]string, tag string) error { +func mapFormByTag(ptr any, form map[string][]string, tag string) error { // Check if ptr is a map ptrVal := reflect.ValueOf(ptr) - var pointed interface{} + var pointed any if ptrVal.Kind() == reflect.Ptr { ptrVal = ptrVal.Elem() pointed = ptrVal.Interface() @@ -49,7 +61,7 @@ func mapFormByTag(ptr interface{}, form map[string][]string, tag string) error { // setter tries to set value on a walking by fields of a struct type setter interface { - TrySet(value reflect.Value, field reflect.StructField, key string, opt setOptions) (isSetted bool, err error) + TrySet(value reflect.Value, field reflect.StructField, key string, opt setOptions) (isSet bool, err error) } type formSource map[string][]string @@ -57,11 +69,11 @@ type formSource map[string][]string var _ setter = formSource(nil) // TrySet tries to set a value by request's form source (like map[string][]string) -func (form formSource) TrySet(value reflect.Value, field reflect.StructField, tagValue string, opt setOptions) (isSetted bool, err error) { +func (form formSource) TrySet(value reflect.Value, field reflect.StructField, tagValue string, opt setOptions) (isSet bool, err error) { return setByForm(value, field, form, tagValue, opt) } -func mappingByPtr(ptr interface{}, setter setter, tag string) error { +func mappingByPtr(ptr any, setter setter, tag string) error { _, err := mapping(reflect.ValueOf(ptr), emptyField, setter, tag) return err } @@ -71,7 +83,7 @@ func mapping(value reflect.Value, field reflect.StructField, setter setter, tag return false, nil } - var vKind = value.Kind() + vKind := value.Kind() if vKind == reflect.Ptr { var isNew bool @@ -80,14 +92,14 @@ func mapping(value reflect.Value, field reflect.StructField, setter setter, tag isNew = true vPtr = reflect.New(value.Type().Elem()) } - isSetted, err := mapping(vPtr.Elem(), field, setter, tag) + isSet, err := mapping(vPtr.Elem(), field, setter, tag) if err != nil { return false, err } - if isNew && isSetted { + if isNew && isSet { value.Set(vPtr) } - return isSetted, nil + return isSet, nil } if vKind != reflect.Struct || !field.Anonymous { @@ -103,19 +115,19 @@ func mapping(value reflect.Value, field reflect.StructField, setter setter, tag if vKind == reflect.Struct { tValue := value.Type() - var isSetted bool + var isSet bool for i := 0; i < value.NumField(); i++ { sf := tValue.Field(i) if sf.PkgPath != "" && !sf.Anonymous { // unexported continue } - ok, err := mapping(value.Field(i), tValue.Field(i), setter, tag) + ok, err := mapping(value.Field(i), sf, setter, tag) if err != nil { return false, err } - isSetted = isSetted || ok + isSet = isSet || ok } - return isSetted, nil + return isSet, nil } return false, nil } @@ -152,7 +164,7 @@ func tryToSetValue(value reflect.Value, field reflect.StructField, setter setter return setter.TrySet(value, field, tagValue, setOpt) } -func setByForm(value reflect.Value, field reflect.StructField, form map[string][]string, tagValue string, opt setOptions) (isSetted bool, err error) { +func setByForm(value reflect.Value, field reflect.StructField, form map[string][]string, tagValue string, opt setOptions) (isSet bool, err error) { vs, ok := form[tagValue] if !ok && !opt.isDefaultExists { return false, nil @@ -198,7 +210,7 @@ func setWithProperType(val string, value reflect.Value, field reflect.StructFiel case reflect.Int64: switch value.Interface().(type) { case time.Duration: - return setTimeDuration(val, value, field) + return setTimeDuration(val, value) } return setIntField(val, 64, value) case reflect.Uint: @@ -298,7 +310,6 @@ func setTimeField(val string, structField reflect.StructField, value reflect.Val t := time.Unix(tv/int64(d), tv%int64(d)) value.Set(reflect.ValueOf(t)) return nil - } if val == "" { @@ -348,7 +359,7 @@ func setSlice(vals []string, value reflect.Value, field reflect.StructField) err return nil } -func setTimeDuration(val string, value reflect.Value, field reflect.StructField) error { +func setTimeDuration(val string, value reflect.Value) error { d, err := time.ParseDuration(val) if err != nil { return err @@ -365,13 +376,13 @@ func head(str, sep string) (head string, tail string) { return str[:idx], str[idx+len(sep):] } -func setFormMap(ptr interface{}, form map[string][]string) error { +func setFormMap(ptr any, form map[string][]string) error { el := reflect.TypeOf(ptr).Elem() if el.Kind() == reflect.Slice { ptrMap, ok := ptr.(map[string][]string) if !ok { - return errors.New("cannot convert to map slices of strings") + return ErrConvertMapStringSlice } for k, v := range form { ptrMap[k] = v @@ -382,7 +393,7 @@ func setFormMap(ptr interface{}, form map[string][]string) error { ptrMap, ok := ptr.(map[string]string) if !ok { - return errors.New("cannot convert to map of strings") + return ErrConvertToMapString } for k, v := range form { ptrMap[k] = v[len(v)-1] // pick last diff --git a/vendor/github.com/gin-gonic/gin/binding/header.go b/vendor/github.com/gin-gonic/gin/binding/header.go index 179ce4ea2..03bc78dae 100644 --- a/vendor/github.com/gin-gonic/gin/binding/header.go +++ b/vendor/github.com/gin-gonic/gin/binding/header.go @@ -1,3 +1,7 @@ +// Copyright 2022 Gin Core Team. All rights reserved. +// Use of this source code is governed by a MIT style +// license that can be found in the LICENSE file. + package binding import ( @@ -12,7 +16,7 @@ func (headerBinding) Name() string { return "header" } -func (headerBinding) Bind(req *http.Request, obj interface{}) error { +func (headerBinding) Bind(req *http.Request, obj any) error { if err := mapHeader(obj, req.Header); err != nil { return err @@ -21,7 +25,7 @@ func (headerBinding) Bind(req *http.Request, obj interface{}) error { return validate(obj) } -func mapHeader(ptr interface{}, h map[string][]string) error { +func mapHeader(ptr any, h map[string][]string) error { return mappingByPtr(ptr, headerSource(h), "header") } @@ -29,6 +33,6 @@ type headerSource map[string][]string var _ setter = headerSource(nil) -func (hs headerSource) TrySet(value reflect.Value, field reflect.StructField, tagValue string, opt setOptions) (isSetted bool, err error) { +func (hs headerSource) TrySet(value reflect.Value, field reflect.StructField, tagValue string, opt setOptions) (bool, error) { return setByForm(value, field, hs, textproto.CanonicalMIMEHeaderKey(tagValue), opt) } diff --git a/vendor/github.com/gin-gonic/gin/binding/json.go b/vendor/github.com/gin-gonic/gin/binding/json.go index d62e07059..36eb27a34 100644 --- a/vendor/github.com/gin-gonic/gin/binding/json.go +++ b/vendor/github.com/gin-gonic/gin/binding/json.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -6,7 +6,7 @@ package binding import ( "bytes" - "fmt" + "errors" "io" "net/http" @@ -30,18 +30,18 @@ func (jsonBinding) Name() string { return "json" } -func (jsonBinding) Bind(req *http.Request, obj interface{}) error { +func (jsonBinding) Bind(req *http.Request, obj any) error { if req == nil || req.Body == nil { - return fmt.Errorf("invalid request") + return errors.New("invalid request") } return decodeJSON(req.Body, obj) } -func (jsonBinding) BindBody(body []byte, obj interface{}) error { +func (jsonBinding) BindBody(body []byte, obj any) error { return decodeJSON(bytes.NewReader(body), obj) } -func decodeJSON(r io.Reader, obj interface{}) error { +func decodeJSON(r io.Reader, obj any) error { decoder := json.NewDecoder(r) if EnableDecoderUseNumber { decoder.UseNumber() diff --git a/vendor/github.com/gin-gonic/gin/binding/msgpack.go b/vendor/github.com/gin-gonic/gin/binding/msgpack.go index 2a442996a..d1f035e44 100644 --- a/vendor/github.com/gin-gonic/gin/binding/msgpack.go +++ b/vendor/github.com/gin-gonic/gin/binding/msgpack.go @@ -1,4 +1,4 @@ -// Copyright 2017 Manu Martinez-Almeida. All rights reserved. +// Copyright 2017 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -21,15 +21,15 @@ func (msgpackBinding) Name() string { return "msgpack" } -func (msgpackBinding) Bind(req *http.Request, obj interface{}) error { +func (msgpackBinding) Bind(req *http.Request, obj any) error { return decodeMsgPack(req.Body, obj) } -func (msgpackBinding) BindBody(body []byte, obj interface{}) error { +func (msgpackBinding) BindBody(body []byte, obj any) error { return decodeMsgPack(bytes.NewReader(body), obj) } -func decodeMsgPack(r io.Reader, obj interface{}) error { +func decodeMsgPack(r io.Reader, obj any) error { cdc := new(codec.MsgpackHandle) if err := codec.NewDecoder(r, cdc).Decode(&obj); err != nil { return err diff --git a/vendor/github.com/gin-gonic/gin/binding/multipart_form_mapping.go b/vendor/github.com/gin-gonic/gin/binding/multipart_form_mapping.go index f85a1aa60..4ebe83263 100644 --- a/vendor/github.com/gin-gonic/gin/binding/multipart_form_mapping.go +++ b/vendor/github.com/gin-gonic/gin/binding/multipart_form_mapping.go @@ -1,4 +1,4 @@ -// Copyright 2019 Gin Core Team. All rights reserved. +// Copyright 2019 Gin Core Team. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -15,8 +15,16 @@ type multipartRequest http.Request var _ setter = (*multipartRequest)(nil) +var ( + // ErrMultiFileHeader multipart.FileHeader invalid + ErrMultiFileHeader = errors.New("unsupported field type for multipart.FileHeader") + + // ErrMultiFileHeaderLenInvalid array for []*multipart.FileHeader len invalid + ErrMultiFileHeaderLenInvalid = errors.New("unsupported len of array for []*multipart.FileHeader") +) + // TrySet tries to set a value by the multipart request with the binding a form file -func (r *multipartRequest) TrySet(value reflect.Value, field reflect.StructField, key string, opt setOptions) (isSetted bool, err error) { +func (r *multipartRequest) TrySet(value reflect.Value, field reflect.StructField, key string, opt setOptions) (bool, error) { if files := r.MultipartForm.File[key]; len(files) != 0 { return setByMultipartFormFile(value, field, files) } @@ -24,7 +32,7 @@ func (r *multipartRequest) TrySet(value reflect.Value, field reflect.StructField return setByForm(value, field, r.MultipartForm.Value, key, opt) } -func setByMultipartFormFile(value reflect.Value, field reflect.StructField, files []*multipart.FileHeader) (isSetted bool, err error) { +func setByMultipartFormFile(value reflect.Value, field reflect.StructField, files []*multipart.FileHeader) (isSet bool, err error) { switch value.Kind() { case reflect.Ptr: switch value.Interface().(type) { @@ -40,26 +48,26 @@ func setByMultipartFormFile(value reflect.Value, field reflect.StructField, file } case reflect.Slice: slice := reflect.MakeSlice(value.Type(), len(files), len(files)) - isSetted, err = setArrayOfMultipartFormFiles(slice, field, files) - if err != nil || !isSetted { - return isSetted, err + isSet, err = setArrayOfMultipartFormFiles(slice, field, files) + if err != nil || !isSet { + return isSet, err } value.Set(slice) return true, nil case reflect.Array: return setArrayOfMultipartFormFiles(value, field, files) } - return false, errors.New("unsupported field type for multipart.FileHeader") + return false, ErrMultiFileHeader } -func setArrayOfMultipartFormFiles(value reflect.Value, field reflect.StructField, files []*multipart.FileHeader) (isSetted bool, err error) { +func setArrayOfMultipartFormFiles(value reflect.Value, field reflect.StructField, files []*multipart.FileHeader) (isSet bool, err error) { if value.Len() != len(files) { - return false, errors.New("unsupported len of array for []*multipart.FileHeader") + return false, ErrMultiFileHeaderLenInvalid } for i := range files { - setted, err := setByMultipartFormFile(value.Index(i), field, files[i:i+1]) - if err != nil || !setted { - return setted, err + set, err := setByMultipartFormFile(value.Index(i), field, files[i:i+1]) + if err != nil || !set { + return set, err } } return true, nil diff --git a/vendor/github.com/gin-gonic/gin/binding/protobuf.go b/vendor/github.com/gin-gonic/gin/binding/protobuf.go index f9ece928d..44f2fdb93 100644 --- a/vendor/github.com/gin-gonic/gin/binding/protobuf.go +++ b/vendor/github.com/gin-gonic/gin/binding/protobuf.go @@ -1,14 +1,15 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. package binding import ( + "errors" "io/ioutil" "net/http" - "github.com/golang/protobuf/proto" + "google.golang.org/protobuf/proto" ) type protobufBinding struct{} @@ -17,7 +18,7 @@ func (protobufBinding) Name() string { return "protobuf" } -func (b protobufBinding) Bind(req *http.Request, obj interface{}) error { +func (b protobufBinding) Bind(req *http.Request, obj any) error { buf, err := ioutil.ReadAll(req.Body) if err != nil { return err @@ -25,8 +26,12 @@ func (b protobufBinding) Bind(req *http.Request, obj interface{}) error { return b.BindBody(buf, obj) } -func (protobufBinding) BindBody(body []byte, obj interface{}) error { - if err := proto.Unmarshal(body, obj.(proto.Message)); err != nil { +func (protobufBinding) BindBody(body []byte, obj any) error { + msg, ok := obj.(proto.Message) + if !ok { + return errors.New("obj is not ProtoMessage") + } + if err := proto.Unmarshal(body, msg); err != nil { return err } // Here it's same to return validate(obj), but util now we can't add diff --git a/vendor/github.com/gin-gonic/gin/binding/query.go b/vendor/github.com/gin-gonic/gin/binding/query.go index 219743f2a..c958b88bd 100644 --- a/vendor/github.com/gin-gonic/gin/binding/query.go +++ b/vendor/github.com/gin-gonic/gin/binding/query.go @@ -1,4 +1,4 @@ -// Copyright 2017 Manu Martinez-Almeida. All rights reserved. +// Copyright 2017 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -12,7 +12,7 @@ func (queryBinding) Name() string { return "query" } -func (queryBinding) Bind(req *http.Request, obj interface{}) error { +func (queryBinding) Bind(req *http.Request, obj any) error { values := req.URL.Query() if err := mapForm(obj, values); err != nil { return err diff --git a/vendor/github.com/gin-gonic/gin/binding/toml.go b/vendor/github.com/gin-gonic/gin/binding/toml.go new file mode 100644 index 000000000..a6b8a90ab --- /dev/null +++ b/vendor/github.com/gin-gonic/gin/binding/toml.go @@ -0,0 +1,35 @@ +// Copyright 2022 Gin Core Team. All rights reserved. +// Use of this source code is governed by a MIT style +// license that can be found in the LICENSE file. + +package binding + +import ( + "bytes" + "io" + "net/http" + + "github.com/pelletier/go-toml/v2" +) + +type tomlBinding struct{} + +func (tomlBinding) Name() string { + return "toml" +} + +func decodeToml(r io.Reader, obj any) error { + decoder := toml.NewDecoder(r) + if err := decoder.Decode(obj); err != nil { + return err + } + return decoder.Decode(obj) +} + +func (tomlBinding) Bind(req *http.Request, obj any) error { + return decodeToml(req.Body, obj) +} + +func (tomlBinding) BindBody(body []byte, obj any) error { + return decodeToml(bytes.NewReader(body), obj) +} diff --git a/vendor/github.com/gin-gonic/gin/binding/uri.go b/vendor/github.com/gin-gonic/gin/binding/uri.go index f91ec3819..29151064a 100644 --- a/vendor/github.com/gin-gonic/gin/binding/uri.go +++ b/vendor/github.com/gin-gonic/gin/binding/uri.go @@ -1,4 +1,4 @@ -// Copyright 2018 Gin Core Team. All rights reserved. +// Copyright 2018 Gin Core Team. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -10,8 +10,8 @@ func (uriBinding) Name() string { return "uri" } -func (uriBinding) BindUri(m map[string][]string, obj interface{}) error { - if err := mapUri(obj, m); err != nil { +func (uriBinding) BindUri(m map[string][]string, obj any) error { + if err := mapURI(obj, m); err != nil { return err } return validate(obj) diff --git a/vendor/github.com/gin-gonic/gin/binding/xml.go b/vendor/github.com/gin-gonic/gin/binding/xml.go index 4e9011496..a70f4ad36 100644 --- a/vendor/github.com/gin-gonic/gin/binding/xml.go +++ b/vendor/github.com/gin-gonic/gin/binding/xml.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -17,14 +17,14 @@ func (xmlBinding) Name() string { return "xml" } -func (xmlBinding) Bind(req *http.Request, obj interface{}) error { +func (xmlBinding) Bind(req *http.Request, obj any) error { return decodeXML(req.Body, obj) } -func (xmlBinding) BindBody(body []byte, obj interface{}) error { +func (xmlBinding) BindBody(body []byte, obj any) error { return decodeXML(bytes.NewReader(body), obj) } -func decodeXML(r io.Reader, obj interface{}) error { +func decodeXML(r io.Reader, obj any) error { decoder := xml.NewDecoder(r) if err := decoder.Decode(obj); err != nil { return err diff --git a/vendor/github.com/gin-gonic/gin/binding/yaml.go b/vendor/github.com/gin-gonic/gin/binding/yaml.go index a2d36d6a5..b0d36a358 100644 --- a/vendor/github.com/gin-gonic/gin/binding/yaml.go +++ b/vendor/github.com/gin-gonic/gin/binding/yaml.go @@ -1,4 +1,4 @@ -// Copyright 2018 Gin Core Team. All rights reserved. +// Copyright 2018 Gin Core Team. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -18,15 +18,15 @@ func (yamlBinding) Name() string { return "yaml" } -func (yamlBinding) Bind(req *http.Request, obj interface{}) error { +func (yamlBinding) Bind(req *http.Request, obj any) error { return decodeYAML(req.Body, obj) } -func (yamlBinding) BindBody(body []byte, obj interface{}) error { +func (yamlBinding) BindBody(body []byte, obj any) error { return decodeYAML(bytes.NewReader(body), obj) } -func decodeYAML(r io.Reader, obj interface{}) error { +func decodeYAML(r io.Reader, obj any) error { decoder := yaml.NewDecoder(r) if err := decoder.Decode(obj); err != nil { return err diff --git a/vendor/github.com/gin-gonic/gin/context.go b/vendor/github.com/gin-gonic/gin/context.go index 220d1bc7b..b1ad95e62 100644 --- a/vendor/github.com/gin-gonic/gin/context.go +++ b/vendor/github.com/gin-gonic/gin/context.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -6,7 +6,6 @@ package gin import ( "errors" - "fmt" "io" "io/ioutil" "log" @@ -35,12 +34,17 @@ const ( MIMEPOSTForm = binding.MIMEPOSTForm MIMEMultipartPOSTForm = binding.MIMEMultipartPOSTForm MIMEYAML = binding.MIMEYAML + MIMETOML = binding.MIMETOML ) // BodyBytesKey indicates a default body bytes key. const BodyBytesKey = "_gin-gonic/gin/bodybyteskey" -const abortIndex int8 = math.MaxInt8 / 2 +// ContextKey is the key that a Context returns itself for. +const ContextKey = "_gin-gonic/gin/contextkey" + +// abortIndex represents a typical value used in abort functions. +const abortIndex int8 = math.MaxInt8 >> 1 // Context is the most important part of gin. It allows us to pass variables between middleware, // manage the flow, validate the JSON of a request and render a JSON response for example. @@ -58,11 +62,11 @@ type Context struct { params *Params skippedNodes *[]skippedNode - // This mutex protect Keys map + // This mutex protects Keys map. mu sync.RWMutex // Keys is a key/value pair exclusively for the context of each request. - Keys map[string]interface{} + Keys map[string]any // Errors is a list of errors attached to all the handlers/middlewares who used this context. Errors errorMsgs @@ -70,10 +74,10 @@ type Context struct { // Accepted defines a list of manually accepted formats for content negotiation. Accepted []string - // queryCache use url.ParseQuery cached the param query result from c.Request.URL.Query() + // queryCache caches the query result from c.Request.URL.Query(). queryCache url.Values - // formCache use url.ParseQuery cached PostForm contains the parsed form data from POST, PATCH, + // formCache caches c.Request.PostForm, which contains the parsed form data from POST, PATCH, // or PUT body parameters. formCache url.Values @@ -88,16 +92,17 @@ type Context struct { func (c *Context) reset() { c.Writer = &c.writermem - c.Params = c.Params[0:0] + c.Params = c.Params[:0] c.handlers = nil c.index = -1 c.fullPath = "" c.Keys = nil - c.Errors = c.Errors[0:0] + c.Errors = c.Errors[:0] c.Accepted = nil c.queryCache = nil c.formCache = nil + c.sameSite = 0 *c.params = (*c.params)[:0] *c.skippedNodes = (*c.skippedNodes)[:0] } @@ -115,7 +120,7 @@ func (c *Context) Copy() *Context { cp.Writer = &cp.writermem cp.index = abortIndex cp.handlers = nil - cp.Keys = map[string]interface{}{} + cp.Keys = map[string]any{} for k, v := range c.Keys { cp.Keys[k] = v } @@ -194,7 +199,7 @@ func (c *Context) AbortWithStatus(code int) { // AbortWithStatusJSON calls `Abort()` and then `JSON` internally. // This method stops the chain, writes the status code and return a JSON body. // It also sets the Content-Type as "application/json". -func (c *Context) AbortWithStatusJSON(code int, jsonObj interface{}) { +func (c *Context) AbortWithStatusJSON(code int, jsonObj any) { c.Abort() c.JSON(code, jsonObj) } @@ -221,7 +226,8 @@ func (c *Context) Error(err error) *Error { panic("err is nil") } - parsedError, ok := err.(*Error) + var parsedError *Error + ok := errors.As(err, &parsedError) if !ok { parsedError = &Error{ Err: err, @@ -239,10 +245,10 @@ func (c *Context) Error(err error) *Error { // Set is used to store a new key/value pair exclusively for this context. // It also lazy initializes c.Keys if it was not used previously. -func (c *Context) Set(key string, value interface{}) { +func (c *Context) Set(key string, value any) { c.mu.Lock() if c.Keys == nil { - c.Keys = make(map[string]interface{}) + c.Keys = make(map[string]any) } c.Keys[key] = value @@ -250,8 +256,8 @@ func (c *Context) Set(key string, value interface{}) { } // Get returns the value for the given key, ie: (value, true). -// If the value does not exists it returns (nil, false) -func (c *Context) Get(key string) (value interface{}, exists bool) { +// If the value does not exist it returns (nil, false) +func (c *Context) Get(key string) (value any, exists bool) { c.mu.RLock() value, exists = c.Keys[key] c.mu.RUnlock() @@ -259,7 +265,7 @@ func (c *Context) Get(key string) (value interface{}, exists bool) { } // MustGet returns the value for the given key if it exists, otherwise it panics. -func (c *Context) MustGet(key string) interface{} { +func (c *Context) MustGet(key string) any { if value, exists := c.Get(key); exists { return value } @@ -347,9 +353,9 @@ func (c *Context) GetStringSlice(key string) (ss []string) { } // GetStringMap returns the value associated with the key as a map of interfaces. -func (c *Context) GetStringMap(key string) (sm map[string]interface{}) { +func (c *Context) GetStringMap(key string) (sm map[string]any) { if val, ok := c.Get(key); ok && val != nil { - sm, _ = val.(map[string]interface{}) + sm, _ = val.(map[string]any) } return } @@ -384,6 +390,15 @@ func (c *Context) Param(key string) string { return c.Params.ByName(key) } +// AddParam adds param to context and +// replaces path param key with given value for e2e testing purposes +// Example Route: "/user/:id" +// AddParam("id", 1) +// Result: "/user/1" +func (c *Context) AddParam(key, value string) { + c.Params = append(c.Params, Param{Key: key, Value: value}) +} + // Query returns the keyed url query value if it exists, // otherwise it returns an empty string `("")`. // It is shortcut for `c.Request.URL.Query().Get(key)` @@ -392,9 +407,9 @@ func (c *Context) Param(key string) string { // c.Query("name") == "Manu" // c.Query("value") == "" // c.Query("wtf") == "" -func (c *Context) Query(key string) string { - value, _ := c.GetQuery(key) - return value +func (c *Context) Query(key string) (value string) { + value, _ = c.GetQuery(key) + return } // DefaultQuery returns the keyed url query value if it exists, @@ -428,9 +443,9 @@ func (c *Context) GetQuery(key string) (string, bool) { // QueryArray returns a slice of strings for a given query key. // The length of the slice depends on the number of params with the given key. -func (c *Context) QueryArray(key string) []string { - values, _ := c.GetQueryArray(key) - return values +func (c *Context) QueryArray(key string) (values []string) { + values, _ = c.GetQueryArray(key) + return } func (c *Context) initQueryCache() { @@ -445,18 +460,16 @@ func (c *Context) initQueryCache() { // GetQueryArray returns a slice of strings for a given query key, plus // a boolean value whether at least one value exists for the given key. -func (c *Context) GetQueryArray(key string) ([]string, bool) { +func (c *Context) GetQueryArray(key string) (values []string, ok bool) { c.initQueryCache() - if values, ok := c.queryCache[key]; ok && len(values) > 0 { - return values, true - } - return []string{}, false + values, ok = c.queryCache[key] + return } // QueryMap returns a map for a given query key. -func (c *Context) QueryMap(key string) map[string]string { - dicts, _ := c.GetQueryMap(key) - return dicts +func (c *Context) QueryMap(key string) (dicts map[string]string) { + dicts, _ = c.GetQueryMap(key) + return } // GetQueryMap returns a map for a given query key, plus a boolean value @@ -468,9 +481,9 @@ func (c *Context) GetQueryMap(key string) (map[string]string, bool) { // PostForm returns the specified key from a POST urlencoded form or multipart form // when it exists, otherwise it returns an empty string `("")`. -func (c *Context) PostForm(key string) string { - value, _ := c.GetPostForm(key) - return value +func (c *Context) PostForm(key string) (value string) { + value, _ = c.GetPostForm(key) + return } // DefaultPostForm returns the specified key from a POST urlencoded form or multipart form @@ -499,9 +512,9 @@ func (c *Context) GetPostForm(key string) (string, bool) { // PostFormArray returns a slice of strings for a given form key. // The length of the slice depends on the number of params with the given key. -func (c *Context) PostFormArray(key string) []string { - values, _ := c.GetPostFormArray(key) - return values +func (c *Context) PostFormArray(key string) (values []string) { + values, _ = c.GetPostFormArray(key) + return } func (c *Context) initFormCache() { @@ -509,7 +522,7 @@ func (c *Context) initFormCache() { c.formCache = make(url.Values) req := c.Request if err := req.ParseMultipartForm(c.engine.MaxMultipartMemory); err != nil { - if err != http.ErrNotMultipart { + if !errors.Is(err, http.ErrNotMultipart) { debugPrint("error on parse multipart form array: %v", err) } } @@ -519,18 +532,16 @@ func (c *Context) initFormCache() { // GetPostFormArray returns a slice of strings for a given form key, plus // a boolean value whether at least one value exists for the given key. -func (c *Context) GetPostFormArray(key string) ([]string, bool) { +func (c *Context) GetPostFormArray(key string) (values []string, ok bool) { c.initFormCache() - if values := c.formCache[key]; len(values) > 0 { - return values, true - } - return []string{}, false + values, ok = c.formCache[key] + return } // PostFormMap returns a map for a given form key. -func (c *Context) PostFormMap(key string) map[string]string { - dicts, _ := c.GetPostFormMap(key) - return dicts +func (c *Context) PostFormMap(key string) (dicts map[string]string) { + dicts, _ = c.GetPostFormMap(key) + return } // GetPostFormMap returns a map for a given form key, plus a boolean value @@ -594,47 +605,51 @@ func (c *Context) SaveUploadedFile(file *multipart.FileHeader, dst string) error return err } -// Bind checks the Content-Type to select a binding engine automatically, -// Depending the "Content-Type" header different bindings are used: +// Bind checks the Method and Content-Type to select a binding engine automatically, +// Depending on the "Content-Type" header different bindings are used, for example: // "application/json" --> JSON binding // "application/xml" --> XML binding -// otherwise --> returns an error. // It parses the request's body as JSON if Content-Type == "application/json" using JSON or XML as a JSON input. // It decodes the json payload into the struct specified as a pointer. // It writes a 400 error and sets Content-Type header "text/plain" in the response if input is not valid. -func (c *Context) Bind(obj interface{}) error { +func (c *Context) Bind(obj any) error { b := binding.Default(c.Request.Method, c.ContentType()) return c.MustBindWith(obj, b) } // BindJSON is a shortcut for c.MustBindWith(obj, binding.JSON). -func (c *Context) BindJSON(obj interface{}) error { +func (c *Context) BindJSON(obj any) error { return c.MustBindWith(obj, binding.JSON) } // BindXML is a shortcut for c.MustBindWith(obj, binding.BindXML). -func (c *Context) BindXML(obj interface{}) error { +func (c *Context) BindXML(obj any) error { return c.MustBindWith(obj, binding.XML) } // BindQuery is a shortcut for c.MustBindWith(obj, binding.Query). -func (c *Context) BindQuery(obj interface{}) error { +func (c *Context) BindQuery(obj any) error { return c.MustBindWith(obj, binding.Query) } // BindYAML is a shortcut for c.MustBindWith(obj, binding.YAML). -func (c *Context) BindYAML(obj interface{}) error { +func (c *Context) BindYAML(obj any) error { return c.MustBindWith(obj, binding.YAML) } +// BindTOML is a shortcut for c.MustBindWith(obj, binding.TOML). +func (c *Context) BindTOML(obj interface{}) error { + return c.MustBindWith(obj, binding.TOML) +} + // BindHeader is a shortcut for c.MustBindWith(obj, binding.Header). -func (c *Context) BindHeader(obj interface{}) error { +func (c *Context) BindHeader(obj any) error { return c.MustBindWith(obj, binding.Header) } // BindUri binds the passed struct pointer using binding.Uri. // It will abort the request with HTTP 400 if any error occurs. -func (c *Context) BindUri(obj interface{}) error { +func (c *Context) BindUri(obj any) error { if err := c.ShouldBindUri(obj); err != nil { c.AbortWithError(http.StatusBadRequest, err).SetType(ErrorTypeBind) // nolint: errcheck return err @@ -645,7 +660,7 @@ func (c *Context) BindUri(obj interface{}) error { // MustBindWith binds the passed struct pointer using the specified binding engine. // It will abort the request with HTTP 400 if any error occurs. // See the binding package. -func (c *Context) MustBindWith(obj interface{}, b binding.Binding) error { +func (c *Context) MustBindWith(obj any, b binding.Binding) error { if err := c.ShouldBindWith(obj, b); err != nil { c.AbortWithError(http.StatusBadRequest, err).SetType(ErrorTypeBind) // nolint: errcheck return err @@ -653,46 +668,50 @@ func (c *Context) MustBindWith(obj interface{}, b binding.Binding) error { return nil } -// ShouldBind checks the Content-Type to select a binding engine automatically, -// Depending the "Content-Type" header different bindings are used: +// ShouldBind checks the Method and Content-Type to select a binding engine automatically, +// Depending on the "Content-Type" header different bindings are used, for example: // "application/json" --> JSON binding // "application/xml" --> XML binding -// otherwise --> returns an error // It parses the request's body as JSON if Content-Type == "application/json" using JSON or XML as a JSON input. // It decodes the json payload into the struct specified as a pointer. -// Like c.Bind() but this method does not set the response status code to 400 and abort if the json is not valid. -func (c *Context) ShouldBind(obj interface{}) error { +// Like c.Bind() but this method does not set the response status code to 400 or abort if input is not valid. +func (c *Context) ShouldBind(obj any) error { b := binding.Default(c.Request.Method, c.ContentType()) return c.ShouldBindWith(obj, b) } // ShouldBindJSON is a shortcut for c.ShouldBindWith(obj, binding.JSON). -func (c *Context) ShouldBindJSON(obj interface{}) error { +func (c *Context) ShouldBindJSON(obj any) error { return c.ShouldBindWith(obj, binding.JSON) } // ShouldBindXML is a shortcut for c.ShouldBindWith(obj, binding.XML). -func (c *Context) ShouldBindXML(obj interface{}) error { +func (c *Context) ShouldBindXML(obj any) error { return c.ShouldBindWith(obj, binding.XML) } // ShouldBindQuery is a shortcut for c.ShouldBindWith(obj, binding.Query). -func (c *Context) ShouldBindQuery(obj interface{}) error { +func (c *Context) ShouldBindQuery(obj any) error { return c.ShouldBindWith(obj, binding.Query) } // ShouldBindYAML is a shortcut for c.ShouldBindWith(obj, binding.YAML). -func (c *Context) ShouldBindYAML(obj interface{}) error { +func (c *Context) ShouldBindYAML(obj any) error { return c.ShouldBindWith(obj, binding.YAML) } +// ShouldBindTOML is a shortcut for c.ShouldBindWith(obj, binding.TOML). +func (c *Context) ShouldBindTOML(obj interface{}) error { + return c.ShouldBindWith(obj, binding.TOML) +} + // ShouldBindHeader is a shortcut for c.ShouldBindWith(obj, binding.Header). -func (c *Context) ShouldBindHeader(obj interface{}) error { +func (c *Context) ShouldBindHeader(obj any) error { return c.ShouldBindWith(obj, binding.Header) } // ShouldBindUri binds the passed struct pointer using the specified binding engine. -func (c *Context) ShouldBindUri(obj interface{}) error { +func (c *Context) ShouldBindUri(obj any) error { m := make(map[string][]string) for _, v := range c.Params { m[v.Key] = []string{v.Value} @@ -702,7 +721,7 @@ func (c *Context) ShouldBindUri(obj interface{}) error { // ShouldBindWith binds the passed struct pointer using the specified binding engine. // See the binding package. -func (c *Context) ShouldBindWith(obj interface{}, b binding.Binding) error { +func (c *Context) ShouldBindWith(obj any, b binding.Binding) error { return b.Bind(c.Request, obj) } @@ -711,7 +730,7 @@ func (c *Context) ShouldBindWith(obj interface{}, b binding.Binding) error { // // NOTE: This method reads the body before binding. So you should use // ShouldBindWith for better performance if you need to call only once. -func (c *Context) ShouldBindBodyWith(obj interface{}, bb binding.BindingBody) (err error) { +func (c *Context) ShouldBindBodyWith(obj any, bb binding.BindingBody) (err error) { var body []byte if cb, ok := c.Get(BodyBytesKey); ok { if cbb, ok := cb.([]byte); ok { @@ -732,7 +751,7 @@ func (c *Context) ShouldBindBodyWith(obj interface{}, bb binding.BindingBody) (e // It called c.RemoteIP() under the hood, to check if the remote IP is a trusted proxy or not. // If it is it will then try to parse the headers defined in Engine.RemoteIPHeaders (defaulting to [X-Forwarded-For, X-Real-Ip]). // If the headers are not syntactically valid OR the remote IP does not correspond to a trusted proxy, -// the remote IP (coming form Request.RemoteAddr) is returned. +// the remote IP (coming from Request.RemoteAddr) is returned. func (c *Context) ClientIP() string { // Check if we're running on a trusted platform, continue running backwards if error if c.engine.TrustedPlatform != "" { @@ -750,10 +769,14 @@ func (c *Context) ClientIP() string { } } - remoteIP, trusted := c.RemoteIP() + // It also checks if the remoteIP is a trusted proxy or not. + // In order to perform this validation, it will see if the IP is contained within at least one of the CIDR blocks + // defined by Engine.SetTrustedProxies() + remoteIP := net.ParseIP(c.RemoteIP()) if remoteIP == nil { return "" } + trusted := c.engine.isTrustedProxy(remoteIP) if trusted && c.engine.ForwardedByClientIP && c.engine.RemoteIPHeaders != nil { for _, headerName := range c.engine.RemoteIPHeaders { @@ -766,53 +789,13 @@ func (c *Context) ClientIP() string { return remoteIP.String() } -func (e *Engine) isTrustedProxy(ip net.IP) bool { - if e.trustedCIDRs != nil { - for _, cidr := range e.trustedCIDRs { - if cidr.Contains(ip) { - return true - } - } - } - return false -} - // RemoteIP parses the IP from Request.RemoteAddr, normalizes and returns the IP (without the port). -// It also checks if the remoteIP is a trusted proxy or not. -// In order to perform this validation, it will see if the IP is contained within at least one of the CIDR blocks -// defined by Engine.SetTrustedProxies() -func (c *Context) RemoteIP() (net.IP, bool) { +func (c *Context) RemoteIP() string { ip, _, err := net.SplitHostPort(strings.TrimSpace(c.Request.RemoteAddr)) if err != nil { - return nil, false - } - remoteIP := net.ParseIP(ip) - if remoteIP == nil { - return nil, false - } - - return remoteIP, c.engine.isTrustedProxy(remoteIP) -} - -func (e *Engine) validateHeader(header string) (clientIP string, valid bool) { - if header == "" { - return "", false - } - items := strings.Split(header, ",") - for i := len(items) - 1; i >= 0; i-- { - ipStr := strings.TrimSpace(items[i]) - ip := net.ParseIP(ipStr) - if ip == nil { - return "", false - } - - // X-Forwarded-For is appended by proxy - // Check IPs in reverse order and stop when find untrusted proxy - if (i == 0) || (!e.isTrustedProxy(ip)) { - return ipStr, true - } + return "" } - return + return ip } // ContentType returns the Content-Type header of the request. @@ -856,7 +839,7 @@ func (c *Context) Status(code int) { c.Writer.WriteHeader(code) } -// Header is a intelligent shortcut for c.Writer.Header().Set(key, value). +// Header is an intelligent shortcut for c.Writer.Header().Set(key, value). // It writes a header in the response. // If value == "", this method removes the header `c.Writer.Header().Del(key)` func (c *Context) Header(key, value string) { @@ -872,7 +855,7 @@ func (c *Context) GetHeader(key string) string { return c.requestHeader(key) } -// GetRawData return stream data. +// GetRawData returns stream data. func (c *Context) GetRawData() ([]byte, error) { return ioutil.ReadAll(c.Request.Body) } @@ -932,30 +915,30 @@ func (c *Context) Render(code int, r render.Render) { // HTML renders the HTTP template specified by its file name. // It also updates the HTTP code and sets the Content-Type as "text/html". // See http://golang.org/doc/articles/wiki/ -func (c *Context) HTML(code int, name string, obj interface{}) { +func (c *Context) HTML(code int, name string, obj any) { instance := c.engine.HTMLRender.Instance(name, obj) c.Render(code, instance) } // IndentedJSON serializes the given struct as pretty JSON (indented + endlines) into the response body. // It also sets the Content-Type as "application/json". -// WARNING: we recommend to use this only for development purposes since printing pretty JSON is +// WARNING: we recommend using this only for development purposes since printing pretty JSON is // more CPU and bandwidth consuming. Use Context.JSON() instead. -func (c *Context) IndentedJSON(code int, obj interface{}) { +func (c *Context) IndentedJSON(code int, obj any) { c.Render(code, render.IndentedJSON{Data: obj}) } // SecureJSON serializes the given struct as Secure JSON into the response body. // Default prepends "while(1)," to response body if the given struct is array values. // It also sets the Content-Type as "application/json". -func (c *Context) SecureJSON(code int, obj interface{}) { +func (c *Context) SecureJSON(code int, obj any) { c.Render(code, render.SecureJSON{Prefix: c.engine.secureJSONPrefix, Data: obj}) } // JSONP serializes the given struct as JSON into the response body. // It adds padding to response body to request data from a server residing in a different domain than the client. // It also sets the Content-Type as "application/javascript". -func (c *Context) JSONP(code int, obj interface{}) { +func (c *Context) JSONP(code int, obj any) { callback := c.DefaultQuery("callback", "") if callback == "" { c.Render(code, render.JSON{Data: obj}) @@ -966,44 +949,49 @@ func (c *Context) JSONP(code int, obj interface{}) { // JSON serializes the given struct as JSON into the response body. // It also sets the Content-Type as "application/json". -func (c *Context) JSON(code int, obj interface{}) { +func (c *Context) JSON(code int, obj any) { c.Render(code, render.JSON{Data: obj}) } // AsciiJSON serializes the given struct as JSON into the response body with unicode to ASCII string. // It also sets the Content-Type as "application/json". -func (c *Context) AsciiJSON(code int, obj interface{}) { +func (c *Context) AsciiJSON(code int, obj any) { c.Render(code, render.AsciiJSON{Data: obj}) } // PureJSON serializes the given struct as JSON into the response body. // PureJSON, unlike JSON, does not replace special html characters with their unicode entities. -func (c *Context) PureJSON(code int, obj interface{}) { +func (c *Context) PureJSON(code int, obj any) { c.Render(code, render.PureJSON{Data: obj}) } // XML serializes the given struct as XML into the response body. // It also sets the Content-Type as "application/xml". -func (c *Context) XML(code int, obj interface{}) { +func (c *Context) XML(code int, obj any) { c.Render(code, render.XML{Data: obj}) } // YAML serializes the given struct as YAML into the response body. -func (c *Context) YAML(code int, obj interface{}) { +func (c *Context) YAML(code int, obj any) { c.Render(code, render.YAML{Data: obj}) } +// TOML serializes the given struct as TOML into the response body. +func (c *Context) TOML(code int, obj interface{}) { + c.Render(code, render.TOML{Data: obj}) +} + // ProtoBuf serializes the given struct as ProtoBuf into the response body. -func (c *Context) ProtoBuf(code int, obj interface{}) { +func (c *Context) ProtoBuf(code int, obj any) { c.Render(code, render.ProtoBuf{Data: obj}) } // String writes the given string into the response body. -func (c *Context) String(code int, format string, values ...interface{}) { +func (c *Context) String(code int, format string, values ...any) { c.Render(code, render.String{Format: format, Data: values}) } -// Redirect returns a HTTP redirect to the specific location. +// Redirect returns an HTTP redirect to the specific location. func (c *Context) Redirect(code int, location string) { c.Render(-1, render.Redirect{ Code: code, @@ -1049,12 +1037,16 @@ func (c *Context) FileFromFS(filepath string, fs http.FileSystem) { // FileAttachment writes the specified file into the body stream in an efficient way // On the client side, the file will typically be downloaded with the given filename func (c *Context) FileAttachment(filepath, filename string) { - c.Writer.Header().Set("Content-Disposition", fmt.Sprintf("attachment; filename=\"%s\"", filename)) + if isASCII(filename) { + c.Writer.Header().Set("Content-Disposition", `attachment; filename="`+filename+`"`) + } else { + c.Writer.Header().Set("Content-Disposition", `attachment; filename*=UTF-8''`+url.QueryEscape(filename)) + } http.ServeFile(c.Writer, c.Request, filepath) } // SSEvent writes a Server-Sent Event into the body stream. -func (c *Context) SSEvent(name string, message interface{}) { +func (c *Context) SSEvent(name string, message any) { c.Render(-1, sse.Event{ Event: name, Data: message, @@ -1088,14 +1080,15 @@ func (c *Context) Stream(step func(w io.Writer) bool) bool { type Negotiate struct { Offered []string HTMLName string - HTMLData interface{} - JSONData interface{} - XMLData interface{} - YAMLData interface{} - Data interface{} + HTMLData any + JSONData any + XMLData any + YAMLData any + Data any + TOMLData any } -// Negotiate calls different Render according acceptable Accept format. +// Negotiate calls different Render according to acceptable Accept format. func (c *Context) Negotiate(code int, config Negotiate) { switch c.NegotiateFormat(config.Offered...) { case binding.MIMEJSON: @@ -1114,6 +1107,10 @@ func (c *Context) Negotiate(code int, config Negotiate) { data := chooseData(config.YAMLData, config.Data) c.YAML(code, data) + case binding.MIMETOML: + data := chooseData(config.TOMLData, config.Data) + c.TOML(code, data) + default: c.AbortWithError(http.StatusNotAcceptable, errors.New("the accepted formats are not offered by the server")) // nolint: errcheck } @@ -1159,34 +1156,47 @@ func (c *Context) SetAccepted(formats ...string) { /***** GOLANG.ORG/X/NET/CONTEXT *****/ /************************************/ -// Deadline always returns that there is no deadline (ok==false), -// maybe you want to use Request.Context().Deadline() instead. +// Deadline returns that there is no deadline (ok==false) when c.Request has no Context. func (c *Context) Deadline() (deadline time.Time, ok bool) { - return + if !c.engine.ContextWithFallback || c.Request == nil || c.Request.Context() == nil { + return + } + return c.Request.Context().Deadline() } -// Done always returns nil (chan which will wait forever), -// if you want to abort your work when the connection was closed -// you should use Request.Context().Done() instead. +// Done returns nil (chan which will wait forever) when c.Request has no Context. func (c *Context) Done() <-chan struct{} { - return nil + if !c.engine.ContextWithFallback || c.Request == nil || c.Request.Context() == nil { + return nil + } + return c.Request.Context().Done() } -// Err always returns nil, maybe you want to use Request.Context().Err() instead. +// Err returns nil when c.Request has no Context. func (c *Context) Err() error { - return nil + if !c.engine.ContextWithFallback || c.Request == nil || c.Request.Context() == nil { + return nil + } + return c.Request.Context().Err() } // Value returns the value associated with this context for key, or nil // if no value is associated with key. Successive calls to Value with // the same key returns the same result. -func (c *Context) Value(key interface{}) interface{} { +func (c *Context) Value(key any) any { if key == 0 { return c.Request } + if key == ContextKey { + return c + } if keyAsString, ok := key.(string); ok { - val, _ := c.Get(keyAsString) - return val + if val, exists := c.Get(keyAsString); exists { + return val + } } - return nil + if !c.engine.ContextWithFallback || c.Request == nil || c.Request.Context() == nil { + return nil + } + return c.Request.Context().Value(key) } diff --git a/vendor/github.com/gin-gonic/gin/context_appengine.go b/vendor/github.com/gin-gonic/gin/context_appengine.go index 8bf938961..931313f61 100644 --- a/vendor/github.com/gin-gonic/gin/context_appengine.go +++ b/vendor/github.com/gin-gonic/gin/context_appengine.go @@ -1,4 +1,4 @@ -// Copyright 2017 Manu Martinez-Almeida. All rights reserved. +// Copyright 2017 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. diff --git a/vendor/github.com/gin-gonic/gin/debug.go b/vendor/github.com/gin-gonic/gin/debug.go index 9bacc6857..25fd7c87f 100644 --- a/vendor/github.com/gin-gonic/gin/debug.go +++ b/vendor/github.com/gin-gonic/gin/debug.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -12,7 +12,7 @@ import ( "strings" ) -const ginSupportMinGoVer = 13 +const ginSupportMinGoVer = 14 // IsDebugging returns true if the framework is running in debug mode. // Use SetMode(gin.ReleaseMode) to disable debug mode. @@ -47,7 +47,7 @@ func debugPrintLoadTemplate(tmpl *template.Template) { } } -func debugPrint(format string, values ...interface{}) { +func debugPrint(format string, values ...any) { if IsDebugging() { if !strings.HasSuffix(format, "\n") { format += "\n" @@ -67,7 +67,7 @@ func getMinVer(v string) (uint64, error) { func debugPrintWARNINGDefault() { if v, e := getMinVer(runtime.Version()); e == nil && v <= ginSupportMinGoVer { - debugPrint(`[WARNING] Now Gin requires Go 1.13+. + debugPrint(`[WARNING] Now Gin requires Go 1.14+. `) } @@ -95,9 +95,7 @@ at initialization. ie. before any route is registered or the router is listening } func debugPrintError(err error) { - if err != nil { - if IsDebugging() { - fmt.Fprintf(DefaultErrorWriter, "[GIN-debug] [ERROR] %v\n", err) - } + if err != nil && IsDebugging() { + fmt.Fprintf(DefaultErrorWriter, "[GIN-debug] [ERROR] %v\n", err) } } diff --git a/vendor/github.com/gin-gonic/gin/deprecated.go b/vendor/github.com/gin-gonic/gin/deprecated.go index ab4474296..fdad85547 100644 --- a/vendor/github.com/gin-gonic/gin/deprecated.go +++ b/vendor/github.com/gin-gonic/gin/deprecated.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -12,7 +12,7 @@ import ( // BindWith binds the passed struct pointer using the specified binding engine. // See the binding package. -func (c *Context) BindWith(obj interface{}, b binding.Binding) error { +func (c *Context) BindWith(obj any, b binding.Binding) error { log.Println(`BindWith(\"interface{}, binding.Binding\") error is going to be deprecated, please check issue #662 and either use MustBindWith() if you want HTTP 400 to be automatically returned if any error occur, or use diff --git a/vendor/github.com/gin-gonic/gin/errors.go b/vendor/github.com/gin-gonic/gin/errors.go index 0f276c13d..2853ce8ed 100644 --- a/vendor/github.com/gin-gonic/gin/errors.go +++ b/vendor/github.com/gin-gonic/gin/errors.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -34,7 +34,7 @@ const ( type Error struct { Err error Type ErrorType - Meta interface{} + Meta any } type errorMsgs []*Error @@ -48,13 +48,13 @@ func (msg *Error) SetType(flags ErrorType) *Error { } // SetMeta sets the error's meta data. -func (msg *Error) SetMeta(data interface{}) *Error { +func (msg *Error) SetMeta(data any) *Error { msg.Meta = data return msg } // JSON creates a properly formatted JSON -func (msg *Error) JSON() interface{} { +func (msg *Error) JSON() any { jsonData := H{} if msg.Meta != nil { value := reflect.ValueOf(msg.Meta) @@ -122,7 +122,7 @@ func (a errorMsgs) Last() *Error { return nil } -// Errors returns an array will all the error messages. +// Errors returns an array with all the error messages. // Example: // c.Error(errors.New("first")) // c.Error(errors.New("second")) @@ -139,14 +139,14 @@ func (a errorMsgs) Errors() []string { return errorStrings } -func (a errorMsgs) JSON() interface{} { +func (a errorMsgs) JSON() any { switch length := len(a); length { case 0: return nil case 1: return a.Last().JSON() default: - jsonData := make([]interface{}, length) + jsonData := make([]any, length) for i, err := range a { jsonData[i] = err.JSON() } diff --git a/vendor/github.com/gin-gonic/gin/fs.go b/vendor/github.com/gin-gonic/gin/fs.go index 007d9b755..64274735e 100644 --- a/vendor/github.com/gin-gonic/gin/fs.go +++ b/vendor/github.com/gin-gonic/gin/fs.go @@ -1,4 +1,4 @@ -// Copyright 2017 Manu Martinez-Almeida. All rights reserved. +// Copyright 2017 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -17,7 +17,7 @@ type neuteredReaddirFile struct { http.File } -// Dir returns a http.Filesystem that can be used by http.FileServer(). It is used internally +// Dir returns a http.FileSystem that can be used by http.FileServer(). It is used internally // in router.Static(). // if listDirectory == true, then it works the same as http.Dir() otherwise it returns // a filesystem that prevents http.FileServer() to list the directory files. diff --git a/vendor/github.com/gin-gonic/gin/gin.go b/vendor/github.com/gin-gonic/gin/gin.go index 58e76f41f..f9324299b 100644 --- a/vendor/github.com/gin-gonic/gin/gin.go +++ b/vendor/github.com/gin-gonic/gin/gin.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -11,12 +11,13 @@ import ( "net/http" "os" "path" - "reflect" "strings" "sync" "github.com/gin-gonic/gin/internal/bytesconv" "github.com/gin-gonic/gin/render" + "golang.org/x/net/http2" + "golang.org/x/net/http2/h2c" ) const defaultMultipartMemory = 32 << 20 // 32 MB @@ -28,15 +29,24 @@ var ( var defaultPlatform string -var defaultTrustedCIDRs = []*net.IPNet{{IP: net.IP{0x0, 0x0, 0x0, 0x0}, Mask: net.IPMask{0x0, 0x0, 0x0, 0x0}}} // 0.0.0.0/0 +var defaultTrustedCIDRs = []*net.IPNet{ + { // 0.0.0.0/0 (IPv4) + IP: net.IP{0x0, 0x0, 0x0, 0x0}, + Mask: net.IPMask{0x0, 0x0, 0x0, 0x0}, + }, + { // ::/0 (IPv6) + IP: net.IP{0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0}, + Mask: net.IPMask{0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0, 0x0}, + }, +} // HandlerFunc defines the handler used by gin middleware as return value. type HandlerFunc func(*Context) -// HandlersChain defines a HandlerFunc array. +// HandlersChain defines a HandlerFunc slice. type HandlersChain []HandlerFunc -// Last returns the last handler in the chain. ie. the last handler is the main one. +// Last returns the last handler in the chain. i.e. the last handler is the main one. func (c HandlersChain) Last() HandlerFunc { if length := len(c); length > 0 { return c[length-1] @@ -52,15 +62,15 @@ type RouteInfo struct { HandlerFunc HandlerFunc } -// RoutesInfo defines a RouteInfo array. +// RoutesInfo defines a RouteInfo slice. type RoutesInfo []RouteInfo // Trusted platforms const ( - // When running on Google App Engine. Trust X-Appengine-Remote-Addr + // PlatformGoogleAppEngine when running on Google App Engine. Trust X-Appengine-Remote-Addr // for determining the client's IP PlatformGoogleAppEngine = "X-Appengine-Remote-Addr" - // When using Cloudflare's CDN. Trust CF-Connecting-IP for determining + // PlatformCloudflare when using Cloudflare's CDN. Trust CF-Connecting-IP for determining // the client's IP PlatformCloudflare = "CF-Connecting-IP" ) @@ -70,14 +80,14 @@ const ( type Engine struct { RouterGroup - // Enables automatic redirection if the current route can't be matched but a + // RedirectTrailingSlash enables automatic redirection if the current route can't be matched but a // handler for the path with (without) the trailing slash exists. // For example if /foo/ is requested but a route only exists for /foo, the // client is redirected to /foo with http status code 301 for GET requests // and 307 for all other request methods. RedirectTrailingSlash bool - // If enabled, the router tries to fix the current request path, if no + // RedirectFixedPath if enabled, the router tries to fix the current request path, if no // handle is registered for it. // First superfluous path elements like ../ or // are removed. // Afterwards the router does a case-insensitive lookup of the cleaned path. @@ -88,7 +98,7 @@ type Engine struct { // RedirectTrailingSlash is independent of this option. RedirectFixedPath bool - // If enabled, the router checks if another method is allowed for the + // HandleMethodNotAllowed if enabled, the router checks if another method is allowed for the // current route, if the current request can not be routed. // If this is the case, the request is answered with 'Method Not Allowed' // and HTTP status code 405. @@ -96,21 +106,22 @@ type Engine struct { // handler. HandleMethodNotAllowed bool - // If enabled, client IP will be parsed from the request's headers that + // ForwardedByClientIP if enabled, client IP will be parsed from the request's headers that // match those stored at `(*gin.Engine).RemoteIPHeaders`. If no IP was // fetched, it falls back to the IP obtained from // `(*gin.Context).Request.RemoteAddr`. ForwardedByClientIP bool - // DEPRECATED: USE `TrustedPlatform` WITH VALUE `gin.GoogleAppEngine` INSTEAD + // AppEngine was deprecated. + // Deprecated: USE `TrustedPlatform` WITH VALUE `gin.PlatformGoogleAppEngine` INSTEAD // #726 #755 If enabled, it will trust some headers starting with // 'X-AppEngine...' for better integration with that PaaS. AppEngine bool - // If enabled, the url.RawPath will be used to find parameters. + // UseRawPath if enabled, the url.RawPath will be used to find parameters. UseRawPath bool - // If true, the path value will be unescaped. + // UnescapePathValues if true, the path value will be unescaped. // If UseRawPath is false (by default), the UnescapePathValues effectively is true, // as url.Path gonna be used, which is already unescaped. UnescapePathValues bool @@ -119,20 +130,26 @@ type Engine struct { // See the PR #1817 and issue #1644 RemoveExtraSlash bool - // List of headers used to obtain the client IP when + // RemoteIPHeaders list of headers used to obtain the client IP when // `(*gin.Engine).ForwardedByClientIP` is `true` and // `(*gin.Context).Request.RemoteAddr` is matched by at least one of the // network origins of list defined by `(*gin.Engine).SetTrustedProxies()`. RemoteIPHeaders []string - // If set to a constant of value gin.Platform*, trusts the headers set by + // TrustedPlatform if set to a constant of value gin.Platform*, trusts the headers set by // that platform, for example to determine the client IP TrustedPlatform string - // Value of 'maxMemory' param that is given to http.Request's ParseMultipartForm + // MaxMultipartMemory value of 'maxMemory' param that is given to http.Request's ParseMultipartForm // method call. MaxMultipartMemory int64 + // UseH2C enable h2c support. + UseH2C bool + + // ContextWithFallback enable fallback Context.Deadline(), Context.Done(), Context.Err() and Context.Value() when Context.Request.Context() is not nil. + ContextWithFallback bool + delims render.Delims secureJSONPrefix string HTMLRender render.HTMLRender @@ -152,7 +169,7 @@ type Engine struct { var _ IRouter = &Engine{} // New returns a new blank Engine instance without any middleware attached. -// By default the configuration is: +// By default, the configuration is: // - RedirectTrailingSlash: true // - RedirectFixedPath: false // - HandleMethodNotAllowed: false @@ -181,11 +198,11 @@ func New() *Engine { trees: make(methodTrees, 0, 9), delims: render.Delims{Left: "{{", Right: "}}"}, secureJSONPrefix: "while(1);", - trustedProxies: []string{"0.0.0.0/0"}, + trustedProxies: []string{"0.0.0.0/0", "::/0"}, trustedCIDRs: defaultTrustedCIDRs, } engine.RouterGroup.engine = engine - engine.pool.New = func() interface{} { + engine.pool.New = func() any { return engine.allocateContext() } return engine @@ -199,13 +216,22 @@ func Default() *Engine { return engine } +func (engine *Engine) Handler() http.Handler { + if !engine.UseH2C { + return engine + } + + h2s := &http2.Server{} + return h2c.NewHandler(engine, h2s) +} + func (engine *Engine) allocateContext() *Context { v := make(Params, 0, engine.maxParams) skippedNodes := make([]skippedNode, 0, engine.maxSections) return &Context{engine: engine, params: &v, skippedNodes: &skippedNodes} } -// Delims sets template left and right delims and returns a Engine instance. +// Delims sets template left and right delims and returns an Engine instance. func (engine *Engine) Delims(left, right string) *Engine { engine.delims = render.Delims{Left: left, Right: right} return engine @@ -259,7 +285,7 @@ func (engine *Engine) SetFuncMap(funcMap template.FuncMap) { engine.FuncMap = funcMap } -// NoRoute adds handlers for NoRoute. It return a 404 code by default. +// NoRoute adds handlers for NoRoute. It returns a 404 code by default. func (engine *Engine) NoRoute(handlers ...HandlerFunc) { engine.noRoute = handlers engine.rebuild404Handlers() @@ -271,7 +297,7 @@ func (engine *Engine) NoMethod(handlers ...HandlerFunc) { engine.rebuild405Handlers() } -// Use attaches a global middleware to the router. ie. the middleware attached though Use() will be +// Use attaches a global middleware to the router. i.e. the middleware attached through Use() will be // included in the handlers chain for every single request. Even 404, 405, static files... // For example, this is the right place for a logger or error management middleware. func (engine *Engine) Use(middleware ...HandlerFunc) IRoutes { @@ -353,7 +379,7 @@ func (engine *Engine) Run(addr ...string) (err error) { address := resolveAddress(addr) debugPrint("Listening and serving HTTP on %s\n", address) - err = http.ListenAndServe(address, engine) + err = http.ListenAndServe(address, engine.Handler()) return } @@ -399,9 +425,9 @@ func (engine *Engine) SetTrustedProxies(trustedProxies []string) error { return engine.parseTrustedProxies() } -// isUnsafeTrustedProxies compares Engine.trustedCIDRs and defaultTrustedCIDRs, it's not safe if equal (returns true) +// isUnsafeTrustedProxies checks if Engine.trustedCIDRs contains all IPs, it's not safe if it has (returns true) func (engine *Engine) isUnsafeTrustedProxies() bool { - return reflect.DeepEqual(engine.trustedCIDRs, defaultTrustedCIDRs) + return engine.isTrustedProxy(net.ParseIP("0.0.0.0")) || engine.isTrustedProxy(net.ParseIP("::")) } // parseTrustedProxies parse Engine.trustedProxies to Engine.trustedCIDRs @@ -411,6 +437,41 @@ func (engine *Engine) parseTrustedProxies() error { return err } +// isTrustedProxy will check whether the IP address is included in the trusted list according to Engine.trustedCIDRs +func (engine *Engine) isTrustedProxy(ip net.IP) bool { + if engine.trustedCIDRs == nil { + return false + } + for _, cidr := range engine.trustedCIDRs { + if cidr.Contains(ip) { + return true + } + } + return false +} + +// validateHeader will parse X-Forwarded-For header and return the trusted client IP address +func (engine *Engine) validateHeader(header string) (clientIP string, valid bool) { + if header == "" { + return "", false + } + items := strings.Split(header, ",") + for i := len(items) - 1; i >= 0; i-- { + ipStr := strings.TrimSpace(items[i]) + ip := net.ParseIP(ipStr) + if ip == nil { + break + } + + // X-Forwarded-For is appended by proxy + // Check IPs in reverse order and stop when find untrusted proxy + if (i == 0) || (!engine.isTrustedProxy(ip)) { + return ipStr, true + } + } + return "", false +} + // parseIP parse a string representation of an IP and returns a net.IP with the // minimum byte representation or nil if input is invalid. func parseIP(ip string) net.IP { @@ -437,12 +498,12 @@ func (engine *Engine) RunTLS(addr, certFile, keyFile string) (err error) { "Please check https://pkg.go.dev/github.com/gin-gonic/gin#readme-don-t-trust-all-proxies for details.") } - err = http.ListenAndServeTLS(addr, certFile, keyFile, engine) + err = http.ListenAndServeTLS(addr, certFile, keyFile, engine.Handler()) return } // RunUnix attaches the router to a http.Server and starts listening and serving HTTP requests -// through the specified unix socket (ie. a file). +// through the specified unix socket (i.e. a file). // Note: this method will block the calling goroutine indefinitely unless an error happens. func (engine *Engine) RunUnix(file string) (err error) { debugPrint("Listening and serving HTTP on unix:/%s", file) @@ -460,7 +521,7 @@ func (engine *Engine) RunUnix(file string) (err error) { defer listener.Close() defer os.Remove(file) - err = http.Serve(listener, engine) + err = http.Serve(listener, engine.Handler()) return } @@ -497,7 +558,7 @@ func (engine *Engine) RunListener(listener net.Listener) (err error) { "Please check https://pkg.go.dev/github.com/gin-gonic/gin#readme-don-t-trust-all-proxies for details.") } - err = http.Serve(listener, engine) + err = http.Serve(listener, engine.Handler()) return } @@ -513,9 +574,9 @@ func (engine *Engine) ServeHTTP(w http.ResponseWriter, req *http.Request) { engine.pool.Put(c) } -// HandleContext re-enter a context that has been rewritten. +// HandleContext re-enters a context that has been rewritten. // This can be done by setting c.Request.URL.Path to your new target. -// Disclaimer: You can loop yourself to death with this, use wisely. +// Disclaimer: You can loop yourself to deal with this, use wisely. func (engine *Engine) HandleContext(c *Context) { oldIndexValue := c.index c.reset() @@ -556,7 +617,7 @@ func (engine *Engine) handleHTTPRequest(c *Context) { c.writermem.WriteHeaderNow() return } - if httpMethod != "CONNECT" && rPath != "/" { + if httpMethod != http.MethodConnect && rPath != "/" { if value.tsr && engine.RedirectTrailingSlash { redirectTrailingSlash(c) return diff --git a/vendor/github.com/gin-gonic/gin/internal/json/go_json.go b/vendor/github.com/gin-gonic/gin/internal/json/go_json.go new file mode 100644 index 000000000..23f717265 --- /dev/null +++ b/vendor/github.com/gin-gonic/gin/internal/json/go_json.go @@ -0,0 +1,23 @@ +// Copyright 2017 Bo-Yi Wu. All rights reserved. +// Use of this source code is governed by a MIT style +// license that can be found in the LICENSE file. + +//go:build go_json +// +build go_json + +package json + +import json "github.com/goccy/go-json" + +var ( + // Marshal is exported by gin/json package. + Marshal = json.Marshal + // Unmarshal is exported by gin/json package. + Unmarshal = json.Unmarshal + // MarshalIndent is exported by gin/json package. + MarshalIndent = json.MarshalIndent + // NewDecoder is exported by gin/json package. + NewDecoder = json.NewDecoder + // NewEncoder is exported by gin/json package. + NewEncoder = json.NewEncoder +) diff --git a/vendor/github.com/gin-gonic/gin/internal/json/json.go b/vendor/github.com/gin-gonic/gin/internal/json/json.go index 172aeb241..a26d7db2e 100644 --- a/vendor/github.com/gin-gonic/gin/internal/json/json.go +++ b/vendor/github.com/gin-gonic/gin/internal/json/json.go @@ -1,9 +1,9 @@ -// Copyright 2017 Bo-Yi Wu. All rights reserved. +// Copyright 2017 Bo-Yi Wu. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. -//go:build !jsoniter -// +build !jsoniter +//go:build !jsoniter && !go_json +// +build !jsoniter,!go_json package json diff --git a/vendor/github.com/gin-gonic/gin/internal/json/jsoniter.go b/vendor/github.com/gin-gonic/gin/internal/json/jsoniter.go index 232f8dcad..853b1a901 100644 --- a/vendor/github.com/gin-gonic/gin/internal/json/jsoniter.go +++ b/vendor/github.com/gin-gonic/gin/internal/json/jsoniter.go @@ -1,4 +1,4 @@ -// Copyright 2017 Bo-Yi Wu. All rights reserved. +// Copyright 2017 Bo-Yi Wu. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. diff --git a/vendor/github.com/gin-gonic/gin/logger.go b/vendor/github.com/gin-gonic/gin/logger.go index d361b74d3..cd1e7fa6e 100644 --- a/vendor/github.com/gin-gonic/gin/logger.go +++ b/vendor/github.com/gin-gonic/gin/logger.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -44,7 +44,7 @@ type LoggerConfig struct { // Optional. Default value is gin.DefaultWriter. Output io.Writer - // SkipPaths is a url path array which logs are not written. + // SkipPaths is an url path array which logs are not written. // Optional. SkipPaths []string } @@ -70,12 +70,12 @@ type LogFormatterParams struct { Path string // ErrorMessage is set if error has occurred in processing the request. ErrorMessage string - // isTerm shows whether does gin's output descriptor refers to a terminal. + // isTerm shows whether gin's output descriptor refers to a terminal. isTerm bool // BodySize is the size of the Response Body BodySize int // Keys are the keys set on the request's context. - Keys map[string]interface{} + Keys map[string]any } // StatusCodeColor is the ANSI color for appropriately logging http status code to a terminal. @@ -138,8 +138,7 @@ var defaultLogFormatter = func(param LogFormatterParams) string { } if param.Latency > time.Minute { - // Truncate in a golang < 1.8 safe way - param.Latency = param.Latency - param.Latency%time.Second + param.Latency = param.Latency.Truncate(time.Second) } return fmt.Sprintf("[GIN] %v |%s %3d %s| %13v | %15s |%s %-7s %s %#v\n%s", param.TimeStamp.Format("2006/01/02 - 15:04:05"), @@ -162,12 +161,12 @@ func ForceConsoleColor() { consoleColorMode = forceColor } -// ErrorLogger returns a handlerfunc for any error type. +// ErrorLogger returns a HandlerFunc for any error type. func ErrorLogger() HandlerFunc { return ErrorLoggerT(ErrorTypeAny) } -// ErrorLoggerT returns a handlerfunc for a given error type. +// ErrorLoggerT returns a HandlerFunc for a given error type. func ErrorLoggerT(typ ErrorType) HandlerFunc { return func(c *Context) { c.Next() @@ -179,7 +178,7 @@ func ErrorLoggerT(typ ErrorType) HandlerFunc { } // Logger instances a Logger middleware that will write the logs to gin.DefaultWriter. -// By default gin.DefaultWriter = os.Stdout. +// By default, gin.DefaultWriter = os.Stdout. func Logger() HandlerFunc { return LoggerWithConfig(LoggerConfig{}) } diff --git a/vendor/github.com/gin-gonic/gin/mode.go b/vendor/github.com/gin-gonic/gin/mode.go index c8813aff2..545fdaaf8 100644 --- a/vendor/github.com/gin-gonic/gin/mode.go +++ b/vendor/github.com/gin-gonic/gin/mode.go @@ -1,10 +1,11 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. package gin import ( + "flag" "io" "os" @@ -41,8 +42,10 @@ var DefaultWriter io.Writer = os.Stdout // DefaultErrorWriter is the default io.Writer used by Gin to debug errors var DefaultErrorWriter io.Writer = os.Stderr -var ginMode = debugCode -var modeName = DebugMode +var ( + ginMode = debugCode + modeName = DebugMode +) func init() { mode := os.Getenv(EnvGinMode) @@ -52,7 +55,11 @@ func init() { // SetMode sets gin mode according to input string. func SetMode(value string) { if value == "" { - value = DebugMode + if flag.Lookup("test.v") != nil { + value = TestMode + } else { + value = DebugMode + } } switch value { @@ -86,7 +93,7 @@ func EnableJsonDecoderDisallowUnknownFields() { binding.EnableDecoderDisallowUnknownFields = true } -// Mode returns currently gin mode. +// Mode returns current gin mode. func Mode() string { return modeName } diff --git a/vendor/github.com/gin-gonic/gin/recovery.go b/vendor/github.com/gin-gonic/gin/recovery.go index 563f5aaa8..abb645105 100644 --- a/vendor/github.com/gin-gonic/gin/recovery.go +++ b/vendor/github.com/gin-gonic/gin/recovery.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -6,6 +6,7 @@ package gin import ( "bytes" + "errors" "fmt" "io" "io/ioutil" @@ -27,14 +28,14 @@ var ( ) // RecoveryFunc defines the function passable to CustomRecovery. -type RecoveryFunc func(c *Context, err interface{}) +type RecoveryFunc func(c *Context, err any) // Recovery returns a middleware that recovers from any panics and writes a 500 if there was one. func Recovery() HandlerFunc { return RecoveryWithWriter(DefaultErrorWriter) } -//CustomRecovery returns a middleware that recovers from any panics and calls the provided handle func to handle it. +// CustomRecovery returns a middleware that recovers from any panics and calls the provided handle func to handle it. func CustomRecovery(handle RecoveryFunc) HandlerFunc { return RecoveryWithWriter(DefaultErrorWriter, handle) } @@ -60,7 +61,8 @@ func CustomRecoveryWithWriter(out io.Writer, handle RecoveryFunc) HandlerFunc { // condition that warrants a panic stack trace. var brokenPipe bool if ne, ok := err.(*net.OpError); ok { - if se, ok := ne.Err.(*os.SyscallError); ok { + var se *os.SyscallError + if errors.As(ne, &se) { if strings.Contains(strings.ToLower(se.Error()), "broken pipe") || strings.Contains(strings.ToLower(se.Error()), "connection reset by peer") { brokenPipe = true } @@ -100,7 +102,7 @@ func CustomRecoveryWithWriter(out io.Writer, handle RecoveryFunc) HandlerFunc { } } -func defaultHandleRecovery(c *Context, err interface{}) { +func defaultHandleRecovery(c *Context, err any) { c.AbortWithStatus(http.StatusInternalServerError) } @@ -153,7 +155,7 @@ func function(pc uintptr) []byte { // runtime/debug.*T·ptrmethod // and want // *T.ptrmethod - // Also the package path might contains dot (e.g. code.google.com/...), + // Also the package path might contain dot (e.g. code.google.com/...), // so first eliminate the path prefix if lastSlash := bytes.LastIndex(name, slash); lastSlash >= 0 { name = name[lastSlash+1:] @@ -165,7 +167,7 @@ func function(pc uintptr) []byte { return name } +// timeFormat returns a customized time string for logger. func timeFormat(t time.Time) string { - timeString := t.Format("2006/01/02 - 15:04:05") - return timeString + return t.Format("2006/01/02 - 15:04:05") } diff --git a/vendor/github.com/gin-gonic/gin/render/any.go b/vendor/github.com/gin-gonic/gin/render/any.go new file mode 100644 index 000000000..b19ad45d9 --- /dev/null +++ b/vendor/github.com/gin-gonic/gin/render/any.go @@ -0,0 +1,10 @@ +// Copyright 2021 Gin Core Team. All rights reserved. +// Use of this source code is governed by a MIT style +// license that can be found in the LICENSE file. + +//go:build !go1.18 +// +build !go1.18 + +package render + +type any = interface{} diff --git a/vendor/github.com/gin-gonic/gin/render/data.go b/vendor/github.com/gin-gonic/gin/render/data.go index 6ba657ba0..a653ea309 100644 --- a/vendor/github.com/gin-gonic/gin/render/data.go +++ b/vendor/github.com/gin-gonic/gin/render/data.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. diff --git a/vendor/github.com/gin-gonic/gin/render/html.go b/vendor/github.com/gin-gonic/gin/render/html.go index 6696ece99..c308408d2 100644 --- a/vendor/github.com/gin-gonic/gin/render/html.go +++ b/vendor/github.com/gin-gonic/gin/render/html.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -20,7 +20,7 @@ type Delims struct { // HTMLRender interface is to be implemented by HTMLProduction and HTMLDebug. type HTMLRender interface { // Instance returns an HTML instance. - Instance(string, interface{}) Render + Instance(string, any) Render } // HTMLProduction contains template reference and its delims. @@ -41,13 +41,13 @@ type HTMLDebug struct { type HTML struct { Template *template.Template Name string - Data interface{} + Data any } var htmlContentType = []string{"text/html; charset=utf-8"} // Instance (HTMLProduction) returns an HTML instance which it realizes Render interface. -func (r HTMLProduction) Instance(name string, data interface{}) Render { +func (r HTMLProduction) Instance(name string, data any) Render { return HTML{ Template: r.Template, Name: name, @@ -56,7 +56,7 @@ func (r HTMLProduction) Instance(name string, data interface{}) Render { } // Instance (HTMLDebug) returns an HTML instance which it realizes Render interface. -func (r HTMLDebug) Instance(name string, data interface{}) Render { +func (r HTMLDebug) Instance(name string, data any) Render { return HTML{ Template: r.loadTemplate(), Name: name, diff --git a/vendor/github.com/gin-gonic/gin/render/json.go b/vendor/github.com/gin-gonic/gin/render/json.go index 418630939..af678e80d 100644 --- a/vendor/github.com/gin-gonic/gin/render/json.go +++ b/vendor/github.com/gin-gonic/gin/render/json.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -16,39 +16,41 @@ import ( // JSON contains the given interface object. type JSON struct { - Data interface{} + Data any } // IndentedJSON contains the given interface object. type IndentedJSON struct { - Data interface{} + Data any } // SecureJSON contains the given interface object and its prefix. type SecureJSON struct { Prefix string - Data interface{} + Data any } // JsonpJSON contains the given interface object its callback. type JsonpJSON struct { Callback string - Data interface{} + Data any } // AsciiJSON contains the given interface object. type AsciiJSON struct { - Data interface{} + Data any } // PureJSON contains the given interface object. type PureJSON struct { - Data interface{} + Data any } -var jsonContentType = []string{"application/json; charset=utf-8"} -var jsonpContentType = []string{"application/javascript; charset=utf-8"} -var jsonAsciiContentType = []string{"application/json"} +var ( + jsonContentType = []string{"application/json; charset=utf-8"} + jsonpContentType = []string{"application/javascript; charset=utf-8"} + jsonASCIIContentType = []string{"application/json"} +) // Render (JSON) writes data with custom ContentType. func (r JSON) Render(w http.ResponseWriter) (err error) { @@ -64,7 +66,7 @@ func (r JSON) WriteContentType(w http.ResponseWriter) { } // WriteJSON marshals the given interface object and writes it with custom ContentType. -func WriteJSON(w http.ResponseWriter, obj interface{}) error { +func WriteJSON(w http.ResponseWriter, obj any) error { writeContentType(w, jsonContentType) jsonBytes, err := json.Marshal(obj) if err != nil { @@ -100,8 +102,7 @@ func (r SecureJSON) Render(w http.ResponseWriter) error { // if the jsonBytes is array values if bytes.HasPrefix(jsonBytes, bytesconv.StringToBytes("[")) && bytes.HasSuffix(jsonBytes, bytesconv.StringToBytes("]")) { - _, err = w.Write(bytesconv.StringToBytes(r.Prefix)) - if err != nil { + if _, err = w.Write(bytesconv.StringToBytes(r.Prefix)); err != nil { return err } } @@ -128,20 +129,19 @@ func (r JsonpJSON) Render(w http.ResponseWriter) (err error) { } callback := template.JSEscapeString(r.Callback) - _, err = w.Write(bytesconv.StringToBytes(callback)) - if err != nil { + if _, err = w.Write(bytesconv.StringToBytes(callback)); err != nil { return err } - _, err = w.Write(bytesconv.StringToBytes("(")) - if err != nil { + + if _, err = w.Write(bytesconv.StringToBytes("(")); err != nil { return err } - _, err = w.Write(ret) - if err != nil { + + if _, err = w.Write(ret); err != nil { return err } - _, err = w.Write(bytesconv.StringToBytes(");")) - if err != nil { + + if _, err = w.Write(bytesconv.StringToBytes(");")); err != nil { return err } @@ -176,7 +176,7 @@ func (r AsciiJSON) Render(w http.ResponseWriter) (err error) { // WriteContentType (AsciiJSON) writes JSON ContentType. func (r AsciiJSON) WriteContentType(w http.ResponseWriter) { - writeContentType(w, jsonAsciiContentType) + writeContentType(w, jsonASCIIContentType) } // Render (PureJSON) writes custom ContentType and encodes the given interface object. diff --git a/vendor/github.com/gin-gonic/gin/render/msgpack.go b/vendor/github.com/gin-gonic/gin/render/msgpack.go index 6ef5b6e51..e0f30f7a9 100644 --- a/vendor/github.com/gin-gonic/gin/render/msgpack.go +++ b/vendor/github.com/gin-gonic/gin/render/msgpack.go @@ -1,4 +1,4 @@ -// Copyright 2017 Manu Martinez-Almeida. All rights reserved. +// Copyright 2017 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -13,13 +13,15 @@ import ( "github.com/ugorji/go/codec" ) +// Check interface implemented here to support go build tag nomsgpack. +// See: https://github.com/gin-gonic/gin/pull/1852/ var ( _ Render = MsgPack{} ) // MsgPack contains the given interface object. type MsgPack struct { - Data interface{} + Data any } var msgpackContentType = []string{"application/msgpack; charset=utf-8"} @@ -35,7 +37,7 @@ func (r MsgPack) Render(w http.ResponseWriter) error { } // WriteMsgPack writes MsgPack ContentType and encodes the given interface object. -func WriteMsgPack(w http.ResponseWriter, obj interface{}) error { +func WriteMsgPack(w http.ResponseWriter, obj any) error { writeContentType(w, msgpackContentType) var mh codec.MsgpackHandle return codec.NewEncoder(w, &mh).Encode(obj) diff --git a/vendor/github.com/gin-gonic/gin/render/protobuf.go b/vendor/github.com/gin-gonic/gin/render/protobuf.go index 15aca9959..9331c4058 100644 --- a/vendor/github.com/gin-gonic/gin/render/protobuf.go +++ b/vendor/github.com/gin-gonic/gin/render/protobuf.go @@ -1,4 +1,4 @@ -// Copyright 2018 Gin Core Team. All rights reserved. +// Copyright 2018 Gin Core Team. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -7,12 +7,12 @@ package render import ( "net/http" - "github.com/golang/protobuf/proto" + "google.golang.org/protobuf/proto" ) // ProtoBuf contains the given interface object. type ProtoBuf struct { - Data interface{} + Data any } var protobufContentType = []string{"application/x-protobuf"} diff --git a/vendor/github.com/gin-gonic/gin/render/reader.go b/vendor/github.com/gin-gonic/gin/render/reader.go index d5282e492..5752d8d85 100644 --- a/vendor/github.com/gin-gonic/gin/render/reader.go +++ b/vendor/github.com/gin-gonic/gin/render/reader.go @@ -1,4 +1,4 @@ -// Copyright 2018 Gin Core Team. All rights reserved. +// Copyright 2018 Gin Core Team. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. diff --git a/vendor/github.com/gin-gonic/gin/render/redirect.go b/vendor/github.com/gin-gonic/gin/render/redirect.go index c006691ca..70e3a47e8 100644 --- a/vendor/github.com/gin-gonic/gin/render/redirect.go +++ b/vendor/github.com/gin-gonic/gin/render/redirect.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. diff --git a/vendor/github.com/gin-gonic/gin/render/render.go b/vendor/github.com/gin-gonic/gin/render/render.go index bcd568bfb..7955000c6 100644 --- a/vendor/github.com/gin-gonic/gin/render/render.go +++ b/vendor/github.com/gin-gonic/gin/render/render.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -30,6 +30,7 @@ var ( _ Render = Reader{} _ Render = AsciiJSON{} _ Render = ProtoBuf{} + _ Render = TOML{} ) func writeContentType(w http.ResponseWriter, value []string) { diff --git a/vendor/github.com/gin-gonic/gin/render/text.go b/vendor/github.com/gin-gonic/gin/render/text.go index 461b720af..77eafdfd8 100644 --- a/vendor/github.com/gin-gonic/gin/render/text.go +++ b/vendor/github.com/gin-gonic/gin/render/text.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -14,7 +14,7 @@ import ( // String contains the given interface object slice and its format. type String struct { Format string - Data []interface{} + Data []any } var plainContentType = []string{"text/plain; charset=utf-8"} @@ -30,7 +30,7 @@ func (r String) WriteContentType(w http.ResponseWriter) { } // WriteString writes data according to its format and write custom ContentType. -func WriteString(w http.ResponseWriter, format string, data []interface{}) (err error) { +func WriteString(w http.ResponseWriter, format string, data []any) (err error) { writeContentType(w, plainContentType) if len(data) > 0 { _, err = fmt.Fprintf(w, format, data...) diff --git a/vendor/github.com/gin-gonic/gin/render/toml.go b/vendor/github.com/gin-gonic/gin/render/toml.go new file mode 100644 index 000000000..40f044c88 --- /dev/null +++ b/vendor/github.com/gin-gonic/gin/render/toml.go @@ -0,0 +1,36 @@ +// Copyright 2022 Gin Core Team. All rights reserved. +// Use of this source code is governed by a MIT style +// license that can be found in the LICENSE file. + +package render + +import ( + "net/http" + + "github.com/pelletier/go-toml/v2" +) + +// TOML contains the given interface object. +type TOML struct { + Data any +} + +var TOMLContentType = []string{"application/toml; charset=utf-8"} + +// Render (TOML) marshals the given interface object and writes data with custom ContentType. +func (r TOML) Render(w http.ResponseWriter) error { + r.WriteContentType(w) + + bytes, err := toml.Marshal(r.Data) + if err != nil { + return err + } + + _, err = w.Write(bytes) + return err +} + +// WriteContentType (TOML) writes TOML ContentType for response. +func (r TOML) WriteContentType(w http.ResponseWriter) { + writeContentType(w, TOMLContentType) +} diff --git a/vendor/github.com/gin-gonic/gin/render/xml.go b/vendor/github.com/gin-gonic/gin/render/xml.go index cc5390a2d..6af890179 100644 --- a/vendor/github.com/gin-gonic/gin/render/xml.go +++ b/vendor/github.com/gin-gonic/gin/render/xml.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -11,7 +11,7 @@ import ( // XML contains the given interface object. type XML struct { - Data interface{} + Data any } var xmlContentType = []string{"application/xml; charset=utf-8"} diff --git a/vendor/github.com/gin-gonic/gin/render/yaml.go b/vendor/github.com/gin-gonic/gin/render/yaml.go index 0df783608..4f0ac01f6 100644 --- a/vendor/github.com/gin-gonic/gin/render/yaml.go +++ b/vendor/github.com/gin-gonic/gin/render/yaml.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -12,7 +12,7 @@ import ( // YAML contains the given interface object. type YAML struct { - Data interface{} + Data any } var yamlContentType = []string{"application/x-yaml; charset=utf-8"} diff --git a/vendor/github.com/gin-gonic/gin/response_writer.go b/vendor/github.com/gin-gonic/gin/response_writer.go index 26826689a..77c7ed8fd 100644 --- a/vendor/github.com/gin-gonic/gin/response_writer.go +++ b/vendor/github.com/gin-gonic/gin/response_writer.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -23,23 +23,23 @@ type ResponseWriter interface { http.Flusher http.CloseNotifier - // Returns the HTTP response status code of the current request. + // Status returns the HTTP response status code of the current request. Status() int - // Returns the number of bytes already written into the response http body. + // Size returns the number of bytes already written into the response http body. // See Written() Size() int - // Writes the string into the response body. + // WriteString writes the string into the response body. WriteString(string) (int, error) - // Returns true if the response body was already written. + // Written returns true if the response body was already written. Written() bool - // Forces to write the http header (status code + headers). + // WriteHeaderNow forces to write the http header (status code + headers). WriteHeaderNow() - // get the http.Pusher for server push + // Pusher get the http.Pusher for server push Pusher() http.Pusher } @@ -107,12 +107,12 @@ func (w *responseWriter) Hijack() (net.Conn, *bufio.ReadWriter, error) { return w.ResponseWriter.(http.Hijacker).Hijack() } -// CloseNotify implements the http.CloseNotify interface. +// CloseNotify implements the http.CloseNotifier interface. func (w *responseWriter) CloseNotify() <-chan bool { return w.ResponseWriter.(http.CloseNotifier).CloseNotify() } -// Flush implements the http.Flush interface. +// Flush implements the http.Flusher interface. func (w *responseWriter) Flush() { w.WriteHeaderNow() w.ResponseWriter.(http.Flusher).Flush() diff --git a/vendor/github.com/gin-gonic/gin/routergroup.go b/vendor/github.com/gin-gonic/gin/routergroup.go index 15d9930d3..3c082d932 100644 --- a/vendor/github.com/gin-gonic/gin/routergroup.go +++ b/vendor/github.com/gin-gonic/gin/routergroup.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -11,6 +11,18 @@ import ( "strings" ) +var ( + // regEnLetter matches english letters for http method name + regEnLetter = regexp.MustCompile("^[A-Z]+$") + + // anyMethods for RouterGroup Any method + anyMethods = []string{ + http.MethodGet, http.MethodPost, http.MethodPut, http.MethodPatch, + http.MethodHead, http.MethodOptions, http.MethodDelete, http.MethodConnect, + http.MethodTrace, + } +) + // IRouter defines all router handle interface includes single and group router. type IRouter interface { IRoutes @@ -32,6 +44,7 @@ type IRoutes interface { HEAD(string, ...HandlerFunc) IRoutes StaticFile(string, string) IRoutes + StaticFileFS(string, string, http.FileSystem) IRoutes Static(string, string) IRoutes StaticFS(string, http.FileSystem) IRoutes } @@ -87,7 +100,7 @@ func (group *RouterGroup) handle(httpMethod, relativePath string, handlers Handl // frequently used, non-standardized or custom methods (e.g. for internal // communication with a proxy). func (group *RouterGroup) Handle(httpMethod, relativePath string, handlers ...HandlerFunc) IRoutes { - if matches, err := regexp.MatchString("^[A-Z]+$", httpMethod); !matches || err != nil { + if matched := regEnLetter.MatchString(httpMethod); !matched { panic("http method " + httpMethod + " is not valid") } return group.handle(httpMethod, relativePath, handlers) @@ -131,27 +144,34 @@ func (group *RouterGroup) HEAD(relativePath string, handlers ...HandlerFunc) IRo // Any registers a route that matches all the HTTP methods. // GET, POST, PUT, PATCH, HEAD, OPTIONS, DELETE, CONNECT, TRACE. func (group *RouterGroup) Any(relativePath string, handlers ...HandlerFunc) IRoutes { - group.handle(http.MethodGet, relativePath, handlers) - group.handle(http.MethodPost, relativePath, handlers) - group.handle(http.MethodPut, relativePath, handlers) - group.handle(http.MethodPatch, relativePath, handlers) - group.handle(http.MethodHead, relativePath, handlers) - group.handle(http.MethodOptions, relativePath, handlers) - group.handle(http.MethodDelete, relativePath, handlers) - group.handle(http.MethodConnect, relativePath, handlers) - group.handle(http.MethodTrace, relativePath, handlers) + for _, method := range anyMethods { + group.handle(method, relativePath, handlers) + } + return group.returnObj() } // StaticFile registers a single route in order to serve a single file of the local filesystem. // router.StaticFile("favicon.ico", "./resources/favicon.ico") func (group *RouterGroup) StaticFile(relativePath, filepath string) IRoutes { + return group.staticFileHandler(relativePath, func(c *Context) { + c.File(filepath) + }) +} + +// StaticFileFS works just like `StaticFile` but a custom `http.FileSystem` can be used instead.. +// router.StaticFileFS("favicon.ico", "./resources/favicon.ico", Dir{".", false}) +// Gin by default user: gin.Dir() +func (group *RouterGroup) StaticFileFS(relativePath, filepath string, fs http.FileSystem) IRoutes { + return group.staticFileHandler(relativePath, func(c *Context) { + c.FileFromFS(filepath, fs) + }) +} + +func (group *RouterGroup) staticFileHandler(relativePath string, handler HandlerFunc) IRoutes { if strings.Contains(relativePath, ":") || strings.Contains(relativePath, "*") { panic("URL parameters can not be used when serving a static file") } - handler := func(c *Context) { - c.File(filepath) - } group.GET(relativePath, handler) group.HEAD(relativePath, handler) return group.returnObj() @@ -209,9 +229,7 @@ func (group *RouterGroup) createStaticHandler(relativePath string, fs http.FileS func (group *RouterGroup) combineHandlers(handlers HandlersChain) HandlersChain { finalSize := len(group.Handlers) + len(handlers) - if finalSize >= int(abortIndex) { - panic("too many handlers") - } + assert1(finalSize < int(abortIndex), "too many handlers") mergedHandlers := make(HandlersChain, finalSize) copy(mergedHandlers, group.Handlers) copy(mergedHandlers[len(group.Handlers):], handlers) diff --git a/vendor/github.com/gin-gonic/gin/test_helpers.go b/vendor/github.com/gin-gonic/gin/test_helpers.go index 3a7a5ddf6..b3be93b4e 100644 --- a/vendor/github.com/gin-gonic/gin/test_helpers.go +++ b/vendor/github.com/gin-gonic/gin/test_helpers.go @@ -1,4 +1,4 @@ -// Copyright 2017 Manu Martinez-Almeida. All rights reserved. +// Copyright 2017 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. diff --git a/vendor/github.com/gin-gonic/gin/tree.go b/vendor/github.com/gin-gonic/gin/tree.go index 158a33908..88100eec8 100644 --- a/vendor/github.com/gin-gonic/gin/tree.go +++ b/vendor/github.com/gin-gonic/gin/tree.go @@ -31,8 +31,8 @@ type Param struct { // It is therefore safe to read values by the index. type Params []Param -// Get returns the value of the first Param which key matches the given name. -// If no matching Param is found, an empty string is returned. +// Get returns the value of the first Param which key matches the given name and a boolean true. +// If no matching Param is found, an empty string is returned and a boolean false . func (ps Params) Get(name string) (string, bool) { for _, entry := range ps { if entry.Key == name { @@ -81,7 +81,7 @@ func longestCommonPrefix(a, b string) int { return i } -// addChild will add a child node, keeping wildcards at the end +// addChild will add a child node, keeping wildcardChild at the end func (n *node) addChild(child *node) { if n.wildChild && len(n.children) > 0 { wildcardChild := n.children[len(n.children)-1] @@ -107,8 +107,7 @@ func countSections(path string) uint16 { type nodeType uint8 const ( - static nodeType = iota // default - root + root nodeType = iota + 1 param catchAll ) @@ -297,7 +296,7 @@ func (n *node) insertChild(path string, fullPath string, handlers HandlersChain) break } - // The wildcard name must not contain ':' and '*' + // The wildcard name must only contain one ':' or '*' character if !valid { panic("only one wildcard per path segment is allowed, has: '" + wildcard + "' in path '" + fullPath + "'") @@ -326,7 +325,7 @@ func (n *node) insertChild(path string, fullPath string, handlers HandlersChain) n.priority++ // if the path doesn't end with the wildcard, then there - // will be another non-wildcard subpath starting with '/' + // will be another subpath starting with '/' if len(wildcard) < len(path) { path = path[len(wildcard):] @@ -350,7 +349,12 @@ func (n *node) insertChild(path string, fullPath string, handlers HandlersChain) } if len(n.path) > 0 && n.path[len(n.path)-1] == '/' { - panic("catch-all conflicts with existing handle for the path segment root in path '" + fullPath + "'") + pathSeg := strings.SplitN(n.children[0].path, "/", 2)[0] + panic("catch-all wildcard '" + path + + "' in new path '" + fullPath + + "' conflicts with existing path segment '" + pathSeg + + "' in existing prefix '" + n.path + pathSeg + + "'") } // currently fixed width 1 for '/' @@ -531,7 +535,7 @@ walk: // Outer loop for walking the tree // No handle found. Check if a handle for this path + a // trailing slash exists for TSR recommendation n = n.children[0] - value.tsr = n.path == "/" && n.handlers != nil + value.tsr = (n.path == "/" && n.handlers != nil) || (n.path == "" && n.indices == "/") } return diff --git a/vendor/github.com/gin-gonic/gin/utils.go b/vendor/github.com/gin-gonic/gin/utils.go index c32f0eeb0..4021a2ab4 100644 --- a/vendor/github.com/gin-gonic/gin/utils.go +++ b/vendor/github.com/gin-gonic/gin/utils.go @@ -1,4 +1,4 @@ -// Copyright 2014 Manu Martinez-Almeida. All rights reserved. +// Copyright 2014 Manu Martinez-Almeida. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. @@ -12,13 +12,14 @@ import ( "reflect" "runtime" "strings" + "unicode" ) // BindKey indicates a default bind key. const BindKey = "_gin-gonic/gin/bindkey" // Bind is a helper function for given interface object and returns a Gin middleware. -func Bind(val interface{}) HandlerFunc { +func Bind(val any) HandlerFunc { value := reflect.ValueOf(val) if value.Kind() == reflect.Ptr { panic(`Bind struct can not be a pointer. Example: @@ -50,7 +51,7 @@ func WrapH(h http.Handler) HandlerFunc { } // H is a shortcut for map[string]interface{} -type H map[string]interface{} +type H map[string]any // MarshalXML allows type H to be used with xml.Marshal. func (h H) MarshalXML(e *xml.Encoder, start xml.StartElement) error { @@ -89,7 +90,7 @@ func filterFlags(content string) string { return content } -func chooseData(custom, wildcard interface{}) interface{} { +func chooseData(custom, wildcard any) any { if custom != nil { return custom } @@ -120,7 +121,7 @@ func lastChar(str string) uint8 { return str[len(str)-1] } -func nameOfFunction(f interface{}) string { +func nameOfFunction(f any) string { return runtime.FuncForPC(reflect.ValueOf(f).Pointer()).Name() } @@ -151,3 +152,13 @@ func resolveAddress(addr []string) string { panic("too many parameters") } } + +// https://stackoverflow.com/questions/53069040/checking-a-string-contains-only-ascii-characters +func isASCII(s string) bool { + for i := 0; i < len(s); i++ { + if s[i] > unicode.MaxASCII { + return false + } + } + return true +} diff --git a/vendor/github.com/gin-gonic/gin/version.go b/vendor/github.com/gin-gonic/gin/version.go index 4b69b9b91..632ca7d1d 100644 --- a/vendor/github.com/gin-gonic/gin/version.go +++ b/vendor/github.com/gin-gonic/gin/version.go @@ -1,8 +1,8 @@ -// Copyright 2018 Gin Core Team. All rights reserved. +// Copyright 2018 Gin Core Team. All rights reserved. // Use of this source code is governed by a MIT style // license that can be found in the LICENSE file. package gin // Version is the current gin framework's version. -const Version = "v1.7.7" +const Version = "v1.8.1" diff --git a/vendor/github.com/goccy/go-json/.codecov.yml b/vendor/github.com/goccy/go-json/.codecov.yml new file mode 100644 index 000000000..e98134570 --- /dev/null +++ b/vendor/github.com/goccy/go-json/.codecov.yml @@ -0,0 +1,32 @@ +codecov: + require_ci_to_pass: yes + +coverage: + precision: 2 + round: down + range: "70...100" + + status: + project: + default: + target: 70% + threshold: 2% + patch: off + changes: no + +parsers: + gcov: + branch_detection: + conditional: yes + loop: yes + method: no + macro: no + +comment: + layout: "header,diff" + behavior: default + require_changes: no + +ignore: + - internal/encoder/vm_color + - internal/encoder/vm_color_indent diff --git a/vendor/github.com/goccy/go-json/.gitignore b/vendor/github.com/goccy/go-json/.gitignore new file mode 100644 index 000000000..378283829 --- /dev/null +++ b/vendor/github.com/goccy/go-json/.gitignore @@ -0,0 +1,2 @@ +cover.html +cover.out diff --git a/vendor/github.com/goccy/go-json/.golangci.yml b/vendor/github.com/goccy/go-json/.golangci.yml new file mode 100644 index 000000000..57ae5a528 --- /dev/null +++ b/vendor/github.com/goccy/go-json/.golangci.yml @@ -0,0 +1,83 @@ +run: + skip-files: + - encode_optype.go + - ".*_test\\.go$" + +linters-settings: + govet: + enable-all: true + disable: + - shadow + +linters: + enable-all: true + disable: + - dogsled + - dupl + - exhaustive + - exhaustivestruct + - errorlint + - forbidigo + - funlen + - gci + - gochecknoglobals + - gochecknoinits + - gocognit + - gocritic + - gocyclo + - godot + - godox + - goerr113 + - gofumpt + - gomnd + - gosec + - ifshort + - lll + - makezero + - nakedret + - nestif + - nlreturn + - paralleltest + - testpackage + - thelper + - wrapcheck + - interfacer + - lll + - nakedret + - nestif + - nlreturn + - testpackage + - wsl + - varnamelen + - nilnil + - ireturn + - govet + - forcetypeassert + - cyclop + - containedctx + - revive + +issues: + exclude-rules: + # not needed + - path: /*.go + text: "ST1003: should not use underscores in package names" + linters: + - stylecheck + - path: /*.go + text: "don't use an underscore in package name" + linters: + - golint + - path: rtype.go + linters: + - golint + - stylecheck + - path: error.go + linters: + - staticcheck + + # Maximum issues count per one linter. Set to 0 to disable. Default is 50. + max-issues-per-linter: 0 + + # Maximum count of issues with the same text. Set to 0 to disable. Default is 3. + max-same-issues: 0 diff --git a/vendor/github.com/goccy/go-json/CHANGELOG.md b/vendor/github.com/goccy/go-json/CHANGELOG.md new file mode 100644 index 000000000..d63009fd7 --- /dev/null +++ b/vendor/github.com/goccy/go-json/CHANGELOG.md @@ -0,0 +1,393 @@ +# v0.9.11 - 2022/08/18 + +### Fix bugs + +* Fix unexpected behavior when buffer ends with backslash ( #383 ) +* Fix stream decoding of escaped character ( #387 ) + +# v0.9.10 - 2022/07/15 + +### Fix bugs + +* Fix boundary exception of type caching ( #382 ) + +# v0.9.9 - 2022/07/15 + +### Fix bugs + +* Fix encoding of directed interface with typed nil ( #377 ) +* Fix embedded primitive type encoding using alias ( #378 ) +* Fix slice/array type encoding with types implementing MarshalJSON ( #379 ) +* Fix unicode decoding when the expected buffer state is not met after reading ( #380 ) + +# v0.9.8 - 2022/06/30 + +### Fix bugs + +* Fix decoding of surrogate-pair ( #365 ) +* Fix handling of embedded primitive type ( #366 ) +* Add validation of escape sequence for decoder ( #367 ) +* Fix stream tokenizing respecting UseNumber ( #369 ) +* Fix encoding when struct pointer type that implements Marshal JSON is embedded ( #375 ) + +### Improve performance + +* Improve performance of linkRecursiveCode ( #368 ) + +# v0.9.7 - 2022/04/22 + +### Fix bugs + +#### Encoder + +* Add filtering process for encoding on slow path ( #355 ) +* Fix encoding of interface{} with pointer type ( #363 ) + +#### Decoder + +* Fix map key decoder that implements UnmarshalJSON ( #353 ) +* Fix decoding of []uint8 type ( #361 ) + +### New features + +* Add DebugWith option for encoder ( #356 ) + +# v0.9.6 - 2022/03/22 + +### Fix bugs + +* Correct the handling of the minimum value of int type for decoder ( #344 ) +* Fix bugs of stream decoder's bufferSize ( #349 ) +* Add a guard to use typeptr more safely ( #351 ) + +### Improve decoder performance + +* Improve escapeString's performance ( #345 ) + +### Others + +* Update go version for CI ( #347 ) + +# v0.9.5 - 2022/03/04 + +### Fix bugs + +* Fix panic when decoding time.Time with context ( #328 ) +* Fix reading the next character in buffer to nul consideration ( #338 ) +* Fix incorrect handling on skipValue ( #341 ) + +### Improve decoder performance + +* Improve performance when a payload contains escape sequence ( #334 ) + +# v0.9.4 - 2022/01/21 + +* Fix IsNilForMarshaler for string type with omitempty ( #323 ) +* Fix the case where the embedded field is at the end ( #326 ) + +# v0.9.3 - 2022/01/14 + +* Fix logic of removing struct field for decoder ( #322 ) + +# v0.9.2 - 2022/01/14 + +* Add invalid decoder to delay type error judgment at decode ( #321 ) + +# v0.9.1 - 2022/01/11 + +* Fix encoding of MarshalText/MarshalJSON operation with head offset ( #319 ) + +# v0.9.0 - 2022/01/05 + +### New feature + +* Supports dynamic filtering of struct fields ( #314 ) + +### Improve encoding performance + +* Improve map encoding performance ( #310 ) +* Optimize encoding path for escaped string ( #311 ) +* Add encoding option for performance ( #312 ) + +### Fix bugs + +* Fix panic at encoding map value on 1.18 ( #310 ) +* Fix MarshalIndent for interface type ( #317 ) + +# v0.8.1 - 2021/12/05 + +* Fix operation conversion from PtrHead to Head in Recursive type ( #305 ) + +# v0.8.0 - 2021/12/02 + +* Fix embedded field conflict behavior ( #300 ) +* Refactor compiler for encoder ( #301 #302 ) + +# v0.7.10 - 2021/10/16 + +* Fix conversion from pointer to uint64 ( #294 ) + +# v0.7.9 - 2021/09/28 + +* Fix encoding of nil value about interface type that has method ( #291 ) + +# v0.7.8 - 2021/09/01 + +* Fix mapassign_faststr for indirect struct type ( #283 ) +* Fix encoding of not empty interface type ( #284 ) +* Fix encoding of empty struct interface type ( #286 ) + +# v0.7.7 - 2021/08/25 + +* Fix invalid utf8 on stream decoder ( #279 ) +* Fix buffer length bug on string stream decoder ( #280 ) + +Thank you @orisano !! + +# v0.7.6 - 2021/08/13 + +* Fix nil slice assignment ( #276 ) +* Improve error message ( #277 ) + +# v0.7.5 - 2021/08/12 + +* Fix encoding of embedded struct with tags ( #265 ) +* Fix encoding of embedded struct that isn't first field ( #272 ) +* Fix decoding of binary type with escaped char ( #273 ) + +# v0.7.4 - 2021/07/06 + +* Fix encoding of indirect layout structure ( #264 ) + +# v0.7.3 - 2021/06/29 + +* Fix encoding of pointer type in empty interface ( #262 ) + +# v0.7.2 - 2021/06/26 + +### Fix decoder + +* Add decoder for func type to fix decoding of nil function value ( #257 ) +* Fix stream decoding of []byte type ( #258 ) + +### Performance + +* Improve decoding performance of map[string]interface{} type ( use `mapassign_faststr` ) ( #256 ) +* Improve encoding performance of empty interface type ( remove recursive calling of `vm.Run` ) ( #259 ) + +### Benchmark + +* Add bytedance/sonic as benchmark target ( #254 ) + +# v0.7.1 - 2021/06/18 + +### Fix decoder + +* Fix error when unmarshal empty array ( #253 ) + +# v0.7.0 - 2021/06/12 + +### Support context for MarshalJSON and UnmarshalJSON ( #248 ) + +* json.MarshalContext(context.Context, interface{}, ...json.EncodeOption) ([]byte, error) +* json.NewEncoder(io.Writer).EncodeContext(context.Context, interface{}, ...json.EncodeOption) error +* json.UnmarshalContext(context.Context, []byte, interface{}, ...json.DecodeOption) error +* json.NewDecoder(io.Reader).DecodeContext(context.Context, interface{}) error + +```go +type MarshalerContext interface { + MarshalJSON(context.Context) ([]byte, error) +} + +type UnmarshalerContext interface { + UnmarshalJSON(context.Context, []byte) error +} +``` + +### Add DecodeFieldPriorityFirstWin option ( #242 ) + +In the default behavior, go-json, like encoding/json, will reflect the result of the last evaluation when a field with the same name exists. I've added new options to allow you to change this behavior. `json.DecodeFieldPriorityFirstWin` option reflects the result of the first evaluation if a field with the same name exists. This behavior has a performance advantage as it allows the subsequent strings to be skipped if all fields have been evaluated. + +### Fix encoder + +* Fix indent number contains recursive type ( #249 ) +* Fix encoding of using empty interface as map key ( #244 ) + +### Fix decoder + +* Fix decoding fields containing escaped characters ( #237 ) + +### Refactor + +* Move some tests to subdirectory ( #243 ) +* Refactor package layout for decoder ( #238 ) + +# v0.6.1 - 2021/06/02 + +### Fix encoder + +* Fix value of totalLength for encoding ( #236 ) + +# v0.6.0 - 2021/06/01 + +### Support Colorize option for encoding (#233) + +```go +b, err := json.MarshalWithOption(v, json.Colorize(json.DefaultColorScheme)) +if err != nil { + ... +} +fmt.Println(string(b)) // print colored json +``` + +### Refactor + +* Fix opcode layout - Adjust memory layout of the opcode to 128 bytes in a 64-bit environment ( #230 ) +* Refactor encode option ( #231 ) +* Refactor escape string ( #232 ) + +# v0.5.1 - 2021/5/20 + +### Optimization + +* Add type addrShift to enable bigger encoder/decoder cache ( #213 ) + +### Fix decoder + +* Keep original reference of slice element ( #229 ) + +### Refactor + +* Refactor Debug mode for encoding ( #226 ) +* Generate VM sources for encoding ( #227 ) +* Refactor validator for null/true/false for decoding ( #221 ) + +# v0.5.0 - 2021/5/9 + +### Supports using omitempty and string tags at the same time ( #216 ) + +### Fix decoder + +* Fix stream decoder for unicode char ( #215 ) +* Fix decoding of slice element ( #219 ) +* Fix calculating of buffer length for stream decoder ( #220 ) + +### Refactor + +* replace skipWhiteSpace goto by loop ( #212 ) + +# v0.4.14 - 2021/5/4 + +### Benchmark + +* Add valyala/fastjson to benchmark ( #193 ) +* Add benchmark task for CI ( #211 ) + +### Fix decoder + +* Fix decoding of slice with unmarshal json type ( #198 ) +* Fix decoding of null value for interface type that does not implement Unmarshaler ( #205 ) +* Fix decoding of null value to []byte by json.Unmarshal ( #206 ) +* Fix decoding of backslash char at the end of string ( #207 ) +* Fix stream decoder for null/true/false value ( #208 ) +* Fix stream decoder for slow reader ( #211 ) + +### Performance + +* If cap of slice is enough, reuse slice data for compatibility with encoding/json ( #200 ) + +# v0.4.13 - 2021/4/20 + +### Fix json.Compact and json.Indent + +* Support validation the input buffer for json.Compact and json.Indent ( #189 ) +* Optimize json.Compact and json.Indent ( improve memory footprint ) ( #190 ) + +# v0.4.12 - 2021/4/15 + +### Fix encoder + +* Fix unnecessary indent for empty slice type ( #181 ) +* Fix encoding of omitempty feature for the slice or interface type ( #183 ) +* Fix encoding custom types zero values with omitempty when marshaller exists ( #187 ) + +### Fix decoder + +* Fix decoder for invalid top level value ( #184 ) +* Fix decoder for invalid number value ( #185 ) + +# v0.4.11 - 2021/4/3 + +* Improve decoder performance for interface type + +# v0.4.10 - 2021/4/2 + +### Fix encoder + +* Fixed a bug when encoding slice and map containing recursive structures +* Fixed a logic to determine if indirect reference + +# v0.4.9 - 2021/3/29 + +### Add debug mode + +If you use `json.MarshalWithOption(v, json.Debug())` and `panic` occurred in `go-json`, produces debug information to console. + +### Support a new feature to compatible with encoding/json + +- invalid UTF-8 is coerced to valid UTF-8 ( without performance down ) + +### Fix encoder + +- Fixed handling of MarshalJSON of function type + +### Fix decoding of slice of pointer type + +If there is a pointer value, go-json will use it. (This behavior is necessary to achieve the ability to prioritize pre-filled values). However, since slices are reused internally, there was a bug that referred to the previous pointer value. Therefore, it is not necessary to refer to the pointer value in advance for the slice element, so we explicitly initialize slice element by `nil`. + +# v0.4.8 - 2021/3/21 + +### Reduce memory usage at compile time + +* go-json have used about 2GB of memory at compile time, but now it can compile with about less than 550MB. + +### Fix any encoder's bug + +* Add many test cases for encoder +* Fix composite type ( slice/array/map ) +* Fix pointer types +* Fix encoding of MarshalJSON or MarshalText or json.Number type + +### Refactor encoder + +* Change package layout for reducing memory usage at compile +* Remove anonymous and only operation +* Remove root property from encodeCompileContext and opcode + +### Fix CI + +* Add Go 1.16 +* Remove Go 1.13 +* Fix `make cover` task + +### Number/Delim/Token/RawMessage use the types defined in encoding/json by type alias + +# v0.4.7 - 2021/02/22 + +### Fix decoder + +* Fix decoding of deep recursive structure +* Fix decoding of embedded unexported pointer field +* Fix invalid test case +* Fix decoding of invalid value +* Fix decoding of prefilled value +* Fix not being able to return UnmarshalTypeError when it should be returned +* Fix decoding of null value +* Fix decoding of type of null string +* Use pre allocated pointer if exists it at decoding + +### Reduce memory usage at compile + +* Integrate int/int8/int16/int32/int64 and uint/uint8/uint16/uint32/uint64 operation to reduce memory usage at compile + +### Remove unnecessary optype diff --git a/vendor/github.com/mitchellh/go-homedir/LICENSE b/vendor/github.com/goccy/go-json/LICENSE index f9c841a51..6449c8bff 100644 --- a/vendor/github.com/mitchellh/go-homedir/LICENSE +++ b/vendor/github.com/goccy/go-json/LICENSE @@ -1,6 +1,6 @@ -The MIT License (MIT) +MIT License -Copyright (c) 2013 Mitchell Hashimoto +Copyright (c) 2020 Masaaki Goshima Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the "Software"), to deal @@ -9,13 +9,13 @@ to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions: -The above copyright notice and this permission notice shall be included in -all copies or substantial portions of the Software. +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -THE SOFTWARE. +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. diff --git a/vendor/github.com/goccy/go-json/Makefile b/vendor/github.com/goccy/go-json/Makefile new file mode 100644 index 000000000..363563ab9 --- /dev/null +++ b/vendor/github.com/goccy/go-json/Makefile @@ -0,0 +1,39 @@ +PKG := github.com/goccy/go-json + +BIN_DIR := $(CURDIR)/bin +PKGS := $(shell go list ./... | grep -v internal/cmd|grep -v test) +COVER_PKGS := $(foreach pkg,$(PKGS),$(subst $(PKG),.,$(pkg))) + +COMMA := , +EMPTY := +SPACE := $(EMPTY) $(EMPTY) +COVERPKG_OPT := $(subst $(SPACE),$(COMMA),$(COVER_PKGS)) + +$(BIN_DIR): + @mkdir -p $(BIN_DIR) + +.PHONY: cover +cover: + go test -coverpkg=$(COVERPKG_OPT) -coverprofile=cover.out ./... + +.PHONY: cover-html +cover-html: cover + go tool cover -html=cover.out + +.PHONY: lint +lint: golangci-lint + golangci-lint run + +golangci-lint: | $(BIN_DIR) + @{ \ + set -e; \ + GOLANGCI_LINT_TMP_DIR=$$(mktemp -d); \ + cd $$GOLANGCI_LINT_TMP_DIR; \ + go mod init tmp; \ + GOBIN=$(BIN_DIR) go get github.com/golangci/golangci-lint/cmd/golangci-lint@v1.36.0; \ + rm -rf $$GOLANGCI_LINT_TMP_DIR; \ + } + +.PHONY: generate +generate: + go generate ./internal/... diff --git a/vendor/github.com/goccy/go-json/README.md b/vendor/github.com/goccy/go-json/README.md new file mode 100644 index 000000000..568623773 --- /dev/null +++ b/vendor/github.com/goccy/go-json/README.md @@ -0,0 +1,529 @@ +# go-json + + +[](https://pkg.go.dev/github.com/goccy/go-json?tab=doc) +[](https://codecov.io/gh/goccy/go-json) + +Fast JSON encoder/decoder compatible with encoding/json for Go + +<img width="400px" src="https://user-images.githubusercontent.com/209884/92572337-42b42900-f2bf-11ea-973a-c74a359553a5.png"></img> + +# Roadmap + +``` +* version ( expected release date ) + +* v0.9.0 + | + | while maintaining compatibility with encoding/json, we will add convenient APIs + | + v +* v1.0.0 +``` + +We are accepting requests for features that will be implemented between v0.9.0 and v.1.0.0. +If you have the API you need, please submit your issue [here](https://github.com/goccy/go-json/issues). + +# Features + +- Drop-in replacement of `encoding/json` +- Fast ( See [Benchmark section](https://github.com/goccy/go-json#benchmarks) ) +- Flexible customization with options +- Coloring the encoded string +- Can propagate context.Context to `MarshalJSON` or `UnmarshalJSON` +- Can dynamically filter the fields of the structure type-safely + +# Installation + +``` +go get github.com/goccy/go-json +``` + +# How to use + +Replace import statement from `encoding/json` to `github.com/goccy/go-json` + +``` +-import "encoding/json" ++import "github.com/goccy/go-json" +``` + +# JSON library comparison + +| name | encoder | decoder | compatible with `encoding/json` | +| :----: | :------: | :-----: | :-----------------------------: | +| encoding/json | yes | yes | N/A | +| [json-iterator/go](https://github.com/json-iterator/go) | yes | yes | partial | +| [easyjson](https://github.com/mailru/easyjson) | yes | yes | no | +| [gojay](https://github.com/francoispqt/gojay) | yes | yes | no | +| [segmentio/encoding/json](https://github.com/segmentio/encoding/tree/master/json) | yes | yes | partial | +| [jettison](https://github.com/wI2L/jettison) | yes | no | no | +| [simdjson-go](https://github.com/minio/simdjson-go) | no | yes | no | +| goccy/go-json | yes | yes | yes | + +- `json-iterator/go` isn't compatible with `encoding/json` in many ways (e.g. https://github.com/json-iterator/go/issues/229 ), but it hasn't been supported for a long time. +- `segmentio/encoding/json` is well supported for encoders, but some are not supported for decoder APIs such as `Token` ( streaming decode ) + +## Other libraries + +- [jingo](https://github.com/bet365/jingo) + +I tried the benchmark but it didn't work. +Also, it seems to panic when it receives an unexpected value because there is no error handling... + +- [ffjson](https://github.com/pquerna/ffjson) + +Benchmarking gave very slow results. +It seems that it is assumed that the user will use the buffer pool properly. +Also, development seems to have already stopped + +# Benchmarks + +``` +$ cd benchmarks +$ go test -bench . +``` + +## Encode + +<img width="700px" src="https://user-images.githubusercontent.com/209884/107126758-0845cb00-68f5-11eb-8db7-086fcf9bcfaa.png"></img> +<img width="700px" src="https://user-images.githubusercontent.com/209884/107126757-07ad3480-68f5-11eb-87aa-858cc5eacfcb.png"></img> + +## Decode + +<img width="700" alt="" src="https://user-images.githubusercontent.com/209884/107979944-bd1d6d80-7002-11eb-944b-9d17b6674e3f.png"> +<img width="700" alt="" src="https://user-images.githubusercontent.com/209884/107979931-b989e680-7002-11eb-87a0-66fc22d90dd4.png"> +<img width="700" alt="" src="https://user-images.githubusercontent.com/209884/107979940-bc84d700-7002-11eb-9647-869bbc25c9d9.png"> + + +# Fuzzing + +[go-json-fuzz](https://github.com/goccy/go-json-fuzz) is the repository for fuzzing tests. +If you run the test in this repository and find a bug, please commit to corpus to go-json-fuzz and report the issue to [go-json](https://github.com/goccy/go-json/issues). + +# How it works + +`go-json` is very fast in both encoding and decoding compared to other libraries. +It's easier to implement by using automatic code generation for performance or by using a dedicated interface, but `go-json` dares to stick to compatibility with `encoding/json` and is the simple interface. Despite this, we are developing with the aim of being the fastest library. + +Here, we explain the various speed-up techniques implemented by `go-json`. + +## Basic technique + +The techniques listed here are the ones used by most of the libraries listed above. + +### Buffer reuse + +Since the only value required for the result of `json.Marshal(interface{}) ([]byte, error)` is `[]byte`, the only value that must be allocated during encoding is the return value `[]byte` . + +Also, as the number of allocations increases, the performance will be affected, so the number of allocations should be kept as low as possible when creating `[]byte`. + +Therefore, there is a technique to reduce the number of times a new buffer must be allocated by reusing the buffer used for the previous encoding by using `sync.Pool`. + +Finally, you allocate a buffer that is as long as the resulting buffer and copy the contents into it, you only need to allocate the buffer once in theory. + +```go +type buffer struct { + data []byte +} + +var bufPool = sync.Pool{ + New: func() interface{} { + return &buffer{data: make([]byte, 0, 1024)} + }, +} + +buf := bufPool.Get().(*buffer) +data := encode(buf.data) // reuse buf.data + +newBuf := make([]byte, len(data)) +copy(newBuf, buf) + +buf.data = data +bufPool.Put(buf) +``` + +### Elimination of reflection + +As you know, the reflection operation is very slow. + +Therefore, using the fact that the address position where the type information is stored is fixed for each binary ( we call this `typeptr` ), +we can use the address in the type information to call a pre-built optimized process. + +For example, you can get the address to the type information from `interface{}` as follows and you can use that information to call a process that does not have reflection. + +To process without reflection, pass a pointer (`unsafe.Pointer`) to the value is stored. + +```go + +type emptyInterface struct { + typ unsafe.Pointer + ptr unsafe.Pointer +} + +var typeToEncoder = map[uintptr]func(unsafe.Pointer)([]byte, error){} + +func Marshal(v interface{}) ([]byte, error) { + iface := (*emptyInterface)(unsafe.Pointer(&v) + typeptr := uintptr(iface.typ) + if enc, exists := typeToEncoder[typeptr]; exists { + return enc(iface.ptr) + } + ... +} +``` + +※ In reality, `typeToEncoder` can be referenced by multiple goroutines, so exclusive control is required. + +## Unique speed-up technique + +## Encoder + +### Do not escape arguments of `Marshal` + +`json.Marshal` and `json.Unmarshal` receive `interface{}` value and they perform type determination dynamically to process. +In normal case, you need to use the `reflect` library to determine the type dynamically, but since `reflect.Type` is defined as `interface`, when you call the method of `reflect.Type`, The reflect's argument is escaped. + +Therefore, the arguments for `Marshal` and `Unmarshal` are always escape to the heap. +However, `go-json` can use the feature of `reflect.Type` while avoiding escaping. + +`reflect.Type` is defined as `interface`, but in reality `reflect.Type` is implemented only by the structure `rtype` defined in the `reflect` package. +For this reason, to date `reflect.Type` is the same as `*reflect.rtype`. + +Therefore, by directly handling `*reflect.rtype`, which is an implementation of `reflect.Type`, it is possible to avoid escaping because it changes from `interface` to using `struct`. + +The technique for working with `*reflect.rtype` directly from `go-json` is implemented at [rtype.go](https://github.com/goccy/go-json/blob/master/internal/runtime/rtype.go) + +Also, the same technique is cut out as a library ( https://github.com/goccy/go-reflect ) + +Initially this feature was the default behavior of `go-json`. +But after careful testing, I found that I passed a large value to `json.Marshal()` and if the argument could not be assigned to the stack, it could not be properly escaped to the heap (a bug in the Go compiler). + +Therefore, this feature will be provided as an **optional** until this issue is resolved. + +To use it, add `NoEscape` like `MarshalNoEscape()` + +### Encoding using opcode sequence + +I explained that you can use `typeptr` to call a pre-built process from type information. + +In other libraries, this dedicated process is processed by making it an function calling like anonymous function, but function calls are inherently slow processes and should be avoided as much as possible. + +Therefore, `go-json` adopted the Instruction-based execution processing system, which is also used to implement virtual machines for programming language. + +If it is the first type to encode, create the opcode ( instruction ) sequence required for encoding. +From the second time onward, use `typeptr` to get the cached pre-built opcode sequence and encode it based on it. An example of the opcode sequence is shown below. + +```go +json.Marshal(struct{ + X int `json:"x"` + Y string `json:"y"` +}{X: 1, Y: "hello"}) +``` + +When encoding a structure like the one above, create a sequence of opcodes like this: + +``` +- opStructFieldHead ( `{` ) +- opStructFieldInt ( `"x": 1,` ) +- opStructFieldString ( `"y": "hello"` ) +- opStructEnd ( `}` ) +- opEnd +``` + +※ When processing each operation, write the letters on the right. + +In addition, each opcode is managed by the following structure ( +Pseudo code ). + +```go +type opType int +const ( + opStructFieldHead opType = iota + opStructFieldInt + opStructFieldStirng + opStructEnd + opEnd +) +type opcode struct { + op opType + key []byte + next *opcode +} +``` + +The process of encoding using the opcode sequence is roughly implemented as follows. + +```go +func encode(code *opcode, b []byte, p unsafe.Pointer) ([]byte, error) { + for { + switch code.op { + case opStructFieldHead: + b = append(b, '{') + code = code.next + case opStructFieldInt: + b = append(b, code.key...) + b = appendInt((*int)(unsafe.Pointer(uintptr(p)+code.offset))) + code = code.next + case opStructFieldString: + b = append(b, code.key...) + b = appendString((*string)(unsafe.Pointer(uintptr(p)+code.offset))) + code = code.next + case opStructEnd: + b = append(b, '}') + code = code.next + case opEnd: + goto END + } + } +END: + return b, nil +} +``` + +In this way, the huge `switch-case` is used to encode by manipulating the linked list opcodes to avoid unnecessary function calls. + +### Opcode sequence optimization + +One of the advantages of encoding using the opcode sequence is the ease of optimization. +The opcode sequence mentioned above is actually converted into the following optimized operations and used. + +``` +- opStructFieldHeadInt ( `{"x": 1,` ) +- opStructEndString ( `"y": "hello"}` ) +- opEnd +``` + +It has been reduced from 5 opcodes to 3 opcodes ! +Reducing the number of opcodees means reducing the number of branches with `switch-case`. +In other words, the closer the number of operations is to 1, the faster the processing can be performed. + +In `go-json`, optimization to reduce the number of opcodes itself like the above and it speeds up by preparing opcodes with optimized paths. + +### Change recursive call from CALL to JMP + +Recursive processing is required during encoding if the type is defined recursively as follows: + +```go +type T struct { + X int + U *U +} + +type U struct { + T *T +} + +b, err := json.Marshal(&T{ + X: 1, + U: &U{ + T: &T{ + X: 2, + }, + }, +}) +fmt.Println(string(b)) // {"X":1,"U":{"T":{"X":2,"U":null}}} +``` + +In `go-json`, recursive processing is processed by the operation type of ` opStructFieldRecursive`. + +In this operation, after acquiring the opcode sequence used for recursive processing, the function is **not** called recursively as it is, but the necessary values are saved by itself and implemented by moving to the next operation. + +The technique of implementing recursive processing with the `JMP` operation while avoiding the `CALL` operation is a famous technique for implementing a high-speed virtual machine. + +For more details, please refer to [the article](https://engineering.mercari.com/blog/entry/1599563768-081104c850) ( but Japanese only ). + +### Dispatch by typeptr from map to slice + +When retrieving the data cached from the type information by `typeptr`, we usually use map. +Map requires exclusive control, so use `sync.Map` for a naive implementation. + +However, this is slow, so it's a good idea to use the `atomic` package for exclusive control as implemented by `segmentio/encoding/json` ( https://github.com/segmentio/encoding/blob/master/json/codec.go#L41-L55 ). + +This implementation slows down the set instead of speeding up the get, but it works well because of the nature of the library, it encodes much more for the same type. + +However, as a result of profiling, I noticed that `runtime.mapaccess2` accounts for a significant percentage of the execution time. So I thought if I could change the lookup from map to slice. + +There is an API named `typelinks` defined in the `runtime` package that the `reflect` package uses internally. +This allows you to get all the type information defined in the binary at runtime. + +The fact that all type information can be acquired means that by constructing slices in advance with the acquired total number of type information, it is possible to look up with the value of `typeptr` without worrying about out-of-range access. + +However, if there is too much type information, it will use a lot of memory, so by default we will only use this optimization if the slice size fits within **2Mib** . + +If this approach is not available, it will fall back to the `atomic` based process described above. + +If you want to know more, please refer to the implementation [here](https://github.com/goccy/go-json/blob/master/internal/runtime/type.go#L36-L100) + +## Decoder + +### Dispatch by typeptr from map to slice + +Like the encoder, the decoder also uses typeptr to call the dedicated process. + +### Faster termination character inspection using NUL character + +In order to decode, you have to traverse the input buffer character by position. +At that time, if you check whether the buffer has reached the end, it will be very slow. + +`buf` : `[]byte` type variable. holds the string passed to the decoder +`cursor` : `int64` type variable. holds the current read position + +```go +buflen := len(buf) +for ; cursor < buflen; cursor++ { // compare cursor and buflen at all times, it is so slow. + switch buf[cursor] { + case ' ', '\n', '\r', '\t': + } +} +``` + +Therefore, by adding the `NUL` (`\000`) character to the end of the read buffer as shown below, it is possible to check the termination character at the same time as other characters. + +```go +for { + switch buf[cursor] { + case ' ', '\n', '\r', '\t': + case '\000': + return nil + } + cursor++ +} +``` + +### Use Boundary Check Elimination + +Due to the `NUL` character optimization, the Go compiler does a boundary check every time, even though `buf[cursor]` does not cause out-of-range access. + +Therefore, `go-json` eliminates boundary check by fetching characters for hotspot by pointer operation. For example, the following code. + +```go +func char(ptr unsafe.Pointer, offset int64) byte { + return *(*byte)(unsafe.Pointer(uintptr(ptr) + uintptr(offset))) +} + +p := (*sliceHeader)(&unsafe.Pointer(buf)).data +for { + switch char(p, cursor) { + case ' ', '\n', '\r', '\t': + case '\000': + return nil + } + cursor++ +} +``` + +### Checking the existence of fields of struct using Bitmaps + +I found by the profiling result, in the struct decode, lookup process for field was taking a long time. + +For example, consider decoding a string like `{"a":1,"b":2,"c":3}` into the following structure: + +```go +type T struct { + A int `json:"a"` + B int `json:"b"` + C int `json:"c"` +} +``` + +At this time, it was found that it takes a lot of time to acquire the decoding process corresponding to the field from the field name as shown below during the decoding process. + +```go +fieldName := decodeKey(buf, cursor) // "a" or "b" or "c" +decoder, exists := fieldToDecoderMap[fieldName] // so slow +if exists { + decoder(buf, cursor) +} else { + skipValue(buf, cursor) +} +``` + +To improve this process, `json-iterator/go` is optimized so that it can be branched by switch-case when the number of fields in the structure is 10 or less (switch-case is faster than map). However, there is a risk of hash collision because the value hashed by the FNV algorithm is used for conditional branching. Also, `gojay` processes this part at high speed by letting the library user yourself write `switch-case`. + + +`go-json` considers and implements a new approach that is different from these. I call this **bitmap field optimization**. + +The range of values per character can be represented by `[256]byte`. Also, if the number of fields in the structure is 8 or less, `int8` type can represent the state of each field. +In other words, it has the following structure. + +- Base ( 8bit ): `00000000` +- Key "a": `00000001` ( assign key "a" to the first bit ) +- Key "b": `00000010` ( assign key "b" to the second bit ) +- Key "c": `00000100` ( assign key "c" to the third bit ) + +Bitmap structure is the following + +``` + | key index(0) | +------------------------ + 0 | 00000000 | + 1 | 00000000 | +~~ | | +97 (a) | 00000001 | +98 (b) | 00000010 | +99 (c) | 00000100 | +~~ | | +255 | 00000000 | +``` + +You can think of this as a Bitmap with a height of `256` and a width of the maximum string length in the field name. +In other words, it can be represented by the following type . + +```go +[maxFieldKeyLength][256]int8 +``` + +When decoding a field character, check whether the corresponding character exists by referring to the pre-built bitmap like the following. + +```go +var curBit int8 = math.MaxInt8 // 11111111 + +c := char(buf, cursor) +bit := bitmap[keyIdx][c] +curBit &= bit +if curBit == 0 { + // not found field +} +``` + +If `curBit` is not `0` until the end of the field string, then the string is +You may have hit one of the fields. +But the possibility is that if the decoded string is shorter than the field string, you will get a false hit. + +- input: `{"a":1}` +```go +type T struct { + X int `json:"abc"` +} +``` +※ Since `a` is shorter than `abc`, it can decode to the end of the field character without `curBit` being 0. + +Rest assured. In this case, it doesn't matter because you can tell if you hit by comparing the string length of `a` with the string length of `abc`. + +Finally, calculate the position of the bit where `1` is set and get the corresponding value, and you're done. + +Using this technique, field lookups are possible with only bitwise operations and access to slices. + +`go-json` uses a similar technique for fields with 9 or more and 16 or less fields. At this time, Bitmap is constructed as `[maxKeyLen][256]int16` type. + +Currently, this optimization is not performed when the maximum length of the field name is long (specifically, 64 bytes or more) in addition to the limitation of the number of fields from the viewpoint of saving memory usage. + +### Others + +I have done a lot of other optimizations. I will find time to write about them. If you have any questions about what's written here or other optimizations, please visit the `#go-json` channel on `gophers.slack.com` . + +## Reference + +Regarding the story of go-json, there are the following articles in Japanese only. + +- https://speakerdeck.com/goccy/zui-su-falsejsonraiburariwoqiu-mete +- https://engineering.mercari.com/blog/entry/1599563768-081104c850/ + +# Looking for Sponsors + +I'm looking for sponsors this library. This library is being developed as a personal project in my spare time. If you want a quick response or problem resolution when using this library in your project, please register as a [sponsor](https://github.com/sponsors/goccy). I will cooperate as much as possible. Of course, this library is developed as an MIT license, so you can use it freely for free. + +# License + +MIT diff --git a/vendor/github.com/goccy/go-json/color.go b/vendor/github.com/goccy/go-json/color.go new file mode 100644 index 000000000..e80b22b48 --- /dev/null +++ b/vendor/github.com/goccy/go-json/color.go @@ -0,0 +1,68 @@ +package json + +import ( + "fmt" + + "github.com/goccy/go-json/internal/encoder" +) + +type ( + ColorFormat = encoder.ColorFormat + ColorScheme = encoder.ColorScheme +) + +const escape = "\x1b" + +type colorAttr int + +//nolint:deadcode,varcheck +const ( + fgBlackColor colorAttr = iota + 30 + fgRedColor + fgGreenColor + fgYellowColor + fgBlueColor + fgMagentaColor + fgCyanColor + fgWhiteColor +) + +//nolint:deadcode,varcheck +const ( + fgHiBlackColor colorAttr = iota + 90 + fgHiRedColor + fgHiGreenColor + fgHiYellowColor + fgHiBlueColor + fgHiMagentaColor + fgHiCyanColor + fgHiWhiteColor +) + +func createColorFormat(attr colorAttr) ColorFormat { + return ColorFormat{ + Header: wrapColor(attr), + Footer: resetColor(), + } +} + +func wrapColor(attr colorAttr) string { + return fmt.Sprintf("%s[%dm", escape, attr) +} + +func resetColor() string { + return wrapColor(colorAttr(0)) +} + +var ( + DefaultColorScheme = &ColorScheme{ + Int: createColorFormat(fgHiMagentaColor), + Uint: createColorFormat(fgHiMagentaColor), + Float: createColorFormat(fgHiMagentaColor), + Bool: createColorFormat(fgHiYellowColor), + String: createColorFormat(fgHiGreenColor), + Binary: createColorFormat(fgHiRedColor), + ObjectKey: createColorFormat(fgHiCyanColor), + Null: createColorFormat(fgBlueColor), + } +) diff --git a/vendor/github.com/goccy/go-json/decode.go b/vendor/github.com/goccy/go-json/decode.go new file mode 100644 index 000000000..d99749d05 --- /dev/null +++ b/vendor/github.com/goccy/go-json/decode.go @@ -0,0 +1,232 @@ +package json + +import ( + "context" + "fmt" + "io" + "reflect" + "unsafe" + + "github.com/goccy/go-json/internal/decoder" + "github.com/goccy/go-json/internal/errors" + "github.com/goccy/go-json/internal/runtime" +) + +type Decoder struct { + s *decoder.Stream +} + +const ( + nul = '\000' +) + +type emptyInterface struct { + typ *runtime.Type + ptr unsafe.Pointer +} + +func unmarshal(data []byte, v interface{}, optFuncs ...DecodeOptionFunc) error { + src := make([]byte, len(data)+1) // append nul byte to the end + copy(src, data) + + header := (*emptyInterface)(unsafe.Pointer(&v)) + + if err := validateType(header.typ, uintptr(header.ptr)); err != nil { + return err + } + dec, err := decoder.CompileToGetDecoder(header.typ) + if err != nil { + return err + } + ctx := decoder.TakeRuntimeContext() + ctx.Buf = src + ctx.Option.Flags = 0 + for _, optFunc := range optFuncs { + optFunc(ctx.Option) + } + cursor, err := dec.Decode(ctx, 0, 0, header.ptr) + if err != nil { + decoder.ReleaseRuntimeContext(ctx) + return err + } + decoder.ReleaseRuntimeContext(ctx) + return validateEndBuf(src, cursor) +} + +func unmarshalContext(ctx context.Context, data []byte, v interface{}, optFuncs ...DecodeOptionFunc) error { + src := make([]byte, len(data)+1) // append nul byte to the end + copy(src, data) + + header := (*emptyInterface)(unsafe.Pointer(&v)) + + if err := validateType(header.typ, uintptr(header.ptr)); err != nil { + return err + } + dec, err := decoder.CompileToGetDecoder(header.typ) + if err != nil { + return err + } + rctx := decoder.TakeRuntimeContext() + rctx.Buf = src + rctx.Option.Flags = 0 + rctx.Option.Flags |= decoder.ContextOption + rctx.Option.Context = ctx + for _, optFunc := range optFuncs { + optFunc(rctx.Option) + } + cursor, err := dec.Decode(rctx, 0, 0, header.ptr) + if err != nil { + decoder.ReleaseRuntimeContext(rctx) + return err + } + decoder.ReleaseRuntimeContext(rctx) + return validateEndBuf(src, cursor) +} + +func unmarshalNoEscape(data []byte, v interface{}, optFuncs ...DecodeOptionFunc) error { + src := make([]byte, len(data)+1) // append nul byte to the end + copy(src, data) + + header := (*emptyInterface)(unsafe.Pointer(&v)) + + if err := validateType(header.typ, uintptr(header.ptr)); err != nil { + return err + } + dec, err := decoder.CompileToGetDecoder(header.typ) + if err != nil { + return err + } + + ctx := decoder.TakeRuntimeContext() + ctx.Buf = src + ctx.Option.Flags = 0 + for _, optFunc := range optFuncs { + optFunc(ctx.Option) + } + cursor, err := dec.Decode(ctx, 0, 0, noescape(header.ptr)) + if err != nil { + decoder.ReleaseRuntimeContext(ctx) + return err + } + decoder.ReleaseRuntimeContext(ctx) + return validateEndBuf(src, cursor) +} + +func validateEndBuf(src []byte, cursor int64) error { + for { + switch src[cursor] { + case ' ', '\t', '\n', '\r': + cursor++ + continue + case nul: + return nil + } + return errors.ErrSyntax( + fmt.Sprintf("invalid character '%c' after top-level value", src[cursor]), + cursor+1, + ) + } +} + +//nolint:staticcheck +//go:nosplit +func noescape(p unsafe.Pointer) unsafe.Pointer { + x := uintptr(p) + return unsafe.Pointer(x ^ 0) +} + +func validateType(typ *runtime.Type, p uintptr) error { + if typ == nil || typ.Kind() != reflect.Ptr || p == 0 { + return &InvalidUnmarshalError{Type: runtime.RType2Type(typ)} + } + return nil +} + +// NewDecoder returns a new decoder that reads from r. +// +// The decoder introduces its own buffering and may +// read data from r beyond the JSON values requested. +func NewDecoder(r io.Reader) *Decoder { + s := decoder.NewStream(r) + return &Decoder{ + s: s, + } +} + +// Buffered returns a reader of the data remaining in the Decoder's +// buffer. The reader is valid until the next call to Decode. +func (d *Decoder) Buffered() io.Reader { + return d.s.Buffered() +} + +// Decode reads the next JSON-encoded value from its +// input and stores it in the value pointed to by v. +// +// See the documentation for Unmarshal for details about +// the conversion of JSON into a Go value. +func (d *Decoder) Decode(v interface{}) error { + return d.DecodeWithOption(v) +} + +// DecodeContext reads the next JSON-encoded value from its +// input and stores it in the value pointed to by v with context.Context. +func (d *Decoder) DecodeContext(ctx context.Context, v interface{}) error { + d.s.Option.Flags |= decoder.ContextOption + d.s.Option.Context = ctx + return d.DecodeWithOption(v) +} + +func (d *Decoder) DecodeWithOption(v interface{}, optFuncs ...DecodeOptionFunc) error { + header := (*emptyInterface)(unsafe.Pointer(&v)) + typ := header.typ + ptr := uintptr(header.ptr) + typeptr := uintptr(unsafe.Pointer(typ)) + // noescape trick for header.typ ( reflect.*rtype ) + copiedType := *(**runtime.Type)(unsafe.Pointer(&typeptr)) + + if err := validateType(copiedType, ptr); err != nil { + return err + } + + dec, err := decoder.CompileToGetDecoder(typ) + if err != nil { + return err + } + if err := d.s.PrepareForDecode(); err != nil { + return err + } + s := d.s + for _, optFunc := range optFuncs { + optFunc(s.Option) + } + if err := dec.DecodeStream(s, 0, header.ptr); err != nil { + return err + } + s.Reset() + return nil +} + +func (d *Decoder) More() bool { + return d.s.More() +} + +func (d *Decoder) Token() (Token, error) { + return d.s.Token() +} + +// DisallowUnknownFields causes the Decoder to return an error when the destination +// is a struct and the input contains object keys which do not match any +// non-ignored, exported fields in the destination. +func (d *Decoder) DisallowUnknownFields() { + d.s.DisallowUnknownFields = true +} + +func (d *Decoder) InputOffset() int64 { + return d.s.TotalOffset() +} + +// UseNumber causes the Decoder to unmarshal a number into an interface{} as a +// Number instead of as a float64. +func (d *Decoder) UseNumber() { + d.s.UseNumber = true +} diff --git a/vendor/github.com/goccy/go-json/docker-compose.yml b/vendor/github.com/goccy/go-json/docker-compose.yml new file mode 100644 index 000000000..db40c79ad --- /dev/null +++ b/vendor/github.com/goccy/go-json/docker-compose.yml @@ -0,0 +1,13 @@ +version: '2' +services: + go-json: + image: golang:1.18 + volumes: + - '.:/go/src/go-json' + deploy: + resources: + limits: + memory: 620M + working_dir: /go/src/go-json + command: | + sh -c "go test -c . && ls go-json.test" diff --git a/vendor/github.com/goccy/go-json/encode.go b/vendor/github.com/goccy/go-json/encode.go new file mode 100644 index 000000000..4bd899f38 --- /dev/null +++ b/vendor/github.com/goccy/go-json/encode.go @@ -0,0 +1,326 @@ +package json + +import ( + "context" + "io" + "os" + "unsafe" + + "github.com/goccy/go-json/internal/encoder" + "github.com/goccy/go-json/internal/encoder/vm" + "github.com/goccy/go-json/internal/encoder/vm_color" + "github.com/goccy/go-json/internal/encoder/vm_color_indent" + "github.com/goccy/go-json/internal/encoder/vm_indent" +) + +// An Encoder writes JSON values to an output stream. +type Encoder struct { + w io.Writer + enabledIndent bool + enabledHTMLEscape bool + prefix string + indentStr string +} + +// NewEncoder returns a new encoder that writes to w. +func NewEncoder(w io.Writer) *Encoder { + return &Encoder{w: w, enabledHTMLEscape: true} +} + +// Encode writes the JSON encoding of v to the stream, followed by a newline character. +// +// See the documentation for Marshal for details about the conversion of Go values to JSON. +func (e *Encoder) Encode(v interface{}) error { + return e.EncodeWithOption(v) +} + +// EncodeWithOption call Encode with EncodeOption. +func (e *Encoder) EncodeWithOption(v interface{}, optFuncs ...EncodeOptionFunc) error { + ctx := encoder.TakeRuntimeContext() + ctx.Option.Flag = 0 + + err := e.encodeWithOption(ctx, v, optFuncs...) + + encoder.ReleaseRuntimeContext(ctx) + return err +} + +// EncodeContext call Encode with context.Context and EncodeOption. +func (e *Encoder) EncodeContext(ctx context.Context, v interface{}, optFuncs ...EncodeOptionFunc) error { + rctx := encoder.TakeRuntimeContext() + rctx.Option.Flag = 0 + rctx.Option.Flag |= encoder.ContextOption + rctx.Option.Context = ctx + + err := e.encodeWithOption(rctx, v, optFuncs...) + + encoder.ReleaseRuntimeContext(rctx) + return err +} + +func (e *Encoder) encodeWithOption(ctx *encoder.RuntimeContext, v interface{}, optFuncs ...EncodeOptionFunc) error { + if e.enabledHTMLEscape { + ctx.Option.Flag |= encoder.HTMLEscapeOption + } + ctx.Option.Flag |= encoder.NormalizeUTF8Option + ctx.Option.DebugOut = os.Stdout + for _, optFunc := range optFuncs { + optFunc(ctx.Option) + } + var ( + buf []byte + err error + ) + if e.enabledIndent { + buf, err = encodeIndent(ctx, v, e.prefix, e.indentStr) + } else { + buf, err = encode(ctx, v) + } + if err != nil { + return err + } + if e.enabledIndent { + buf = buf[:len(buf)-2] + } else { + buf = buf[:len(buf)-1] + } + buf = append(buf, '\n') + if _, err := e.w.Write(buf); err != nil { + return err + } + return nil +} + +// SetEscapeHTML specifies whether problematic HTML characters should be escaped inside JSON quoted strings. +// The default behavior is to escape &, <, and > to \u0026, \u003c, and \u003e to avoid certain safety problems that can arise when embedding JSON in HTML. +// +// In non-HTML settings where the escaping interferes with the readability of the output, SetEscapeHTML(false) disables this behavior. +func (e *Encoder) SetEscapeHTML(on bool) { + e.enabledHTMLEscape = on +} + +// SetIndent instructs the encoder to format each subsequent encoded value as if indented by the package-level function Indent(dst, src, prefix, indent). +// Calling SetIndent("", "") disables indentation. +func (e *Encoder) SetIndent(prefix, indent string) { + if prefix == "" && indent == "" { + e.enabledIndent = false + return + } + e.prefix = prefix + e.indentStr = indent + e.enabledIndent = true +} + +func marshalContext(ctx context.Context, v interface{}, optFuncs ...EncodeOptionFunc) ([]byte, error) { + rctx := encoder.TakeRuntimeContext() + rctx.Option.Flag = 0 + rctx.Option.Flag = encoder.HTMLEscapeOption | encoder.NormalizeUTF8Option | encoder.ContextOption + rctx.Option.Context = ctx + for _, optFunc := range optFuncs { + optFunc(rctx.Option) + } + + buf, err := encode(rctx, v) + if err != nil { + encoder.ReleaseRuntimeContext(rctx) + return nil, err + } + + // this line exists to escape call of `runtime.makeslicecopy` . + // if use `make([]byte, len(buf)-1)` and `copy(copied, buf)`, + // dst buffer size and src buffer size are differrent. + // in this case, compiler uses `runtime.makeslicecopy`, but it is slow. + buf = buf[:len(buf)-1] + copied := make([]byte, len(buf)) + copy(copied, buf) + + encoder.ReleaseRuntimeContext(rctx) + return copied, nil +} + +func marshal(v interface{}, optFuncs ...EncodeOptionFunc) ([]byte, error) { + ctx := encoder.TakeRuntimeContext() + + ctx.Option.Flag = 0 + ctx.Option.Flag |= (encoder.HTMLEscapeOption | encoder.NormalizeUTF8Option) + for _, optFunc := range optFuncs { + optFunc(ctx.Option) + } + + buf, err := encode(ctx, v) + if err != nil { + encoder.ReleaseRuntimeContext(ctx) + return nil, err + } + + // this line exists to escape call of `runtime.makeslicecopy` . + // if use `make([]byte, len(buf)-1)` and `copy(copied, buf)`, + // dst buffer size and src buffer size are differrent. + // in this case, compiler uses `runtime.makeslicecopy`, but it is slow. + buf = buf[:len(buf)-1] + copied := make([]byte, len(buf)) + copy(copied, buf) + + encoder.ReleaseRuntimeContext(ctx) + return copied, nil +} + +func marshalNoEscape(v interface{}) ([]byte, error) { + ctx := encoder.TakeRuntimeContext() + + ctx.Option.Flag = 0 + ctx.Option.Flag |= (encoder.HTMLEscapeOption | encoder.NormalizeUTF8Option) + + buf, err := encodeNoEscape(ctx, v) + if err != nil { + encoder.ReleaseRuntimeContext(ctx) + return nil, err + } + + // this line exists to escape call of `runtime.makeslicecopy` . + // if use `make([]byte, len(buf)-1)` and `copy(copied, buf)`, + // dst buffer size and src buffer size are differrent. + // in this case, compiler uses `runtime.makeslicecopy`, but it is slow. + buf = buf[:len(buf)-1] + copied := make([]byte, len(buf)) + copy(copied, buf) + + encoder.ReleaseRuntimeContext(ctx) + return copied, nil +} + +func marshalIndent(v interface{}, prefix, indent string, optFuncs ...EncodeOptionFunc) ([]byte, error) { + ctx := encoder.TakeRuntimeContext() + + ctx.Option.Flag = 0 + ctx.Option.Flag |= (encoder.HTMLEscapeOption | encoder.NormalizeUTF8Option | encoder.IndentOption) + for _, optFunc := range optFuncs { + optFunc(ctx.Option) + } + + buf, err := encodeIndent(ctx, v, prefix, indent) + if err != nil { + encoder.ReleaseRuntimeContext(ctx) + return nil, err + } + + buf = buf[:len(buf)-2] + copied := make([]byte, len(buf)) + copy(copied, buf) + + encoder.ReleaseRuntimeContext(ctx) + return copied, nil +} + +func encode(ctx *encoder.RuntimeContext, v interface{}) ([]byte, error) { + b := ctx.Buf[:0] + if v == nil { + b = encoder.AppendNull(ctx, b) + b = encoder.AppendComma(ctx, b) + return b, nil + } + header := (*emptyInterface)(unsafe.Pointer(&v)) + typ := header.typ + + typeptr := uintptr(unsafe.Pointer(typ)) + codeSet, err := encoder.CompileToGetCodeSet(ctx, typeptr) + if err != nil { + return nil, err + } + + p := uintptr(header.ptr) + ctx.Init(p, codeSet.CodeLength) + ctx.KeepRefs = append(ctx.KeepRefs, header.ptr) + + buf, err := encodeRunCode(ctx, b, codeSet) + if err != nil { + return nil, err + } + ctx.Buf = buf + return buf, nil +} + +func encodeNoEscape(ctx *encoder.RuntimeContext, v interface{}) ([]byte, error) { + b := ctx.Buf[:0] + if v == nil { + b = encoder.AppendNull(ctx, b) + b = encoder.AppendComma(ctx, b) + return b, nil + } + header := (*emptyInterface)(unsafe.Pointer(&v)) + typ := header.typ + + typeptr := uintptr(unsafe.Pointer(typ)) + codeSet, err := encoder.CompileToGetCodeSet(ctx, typeptr) + if err != nil { + return nil, err + } + + p := uintptr(header.ptr) + ctx.Init(p, codeSet.CodeLength) + buf, err := encodeRunCode(ctx, b, codeSet) + if err != nil { + return nil, err + } + + ctx.Buf = buf + return buf, nil +} + +func encodeIndent(ctx *encoder.RuntimeContext, v interface{}, prefix, indent string) ([]byte, error) { + b := ctx.Buf[:0] + if v == nil { + b = encoder.AppendNull(ctx, b) + b = encoder.AppendCommaIndent(ctx, b) + return b, nil + } + header := (*emptyInterface)(unsafe.Pointer(&v)) + typ := header.typ + + typeptr := uintptr(unsafe.Pointer(typ)) + codeSet, err := encoder.CompileToGetCodeSet(ctx, typeptr) + if err != nil { + return nil, err + } + + p := uintptr(header.ptr) + ctx.Init(p, codeSet.CodeLength) + buf, err := encodeRunIndentCode(ctx, b, codeSet, prefix, indent) + + ctx.KeepRefs = append(ctx.KeepRefs, header.ptr) + + if err != nil { + return nil, err + } + + ctx.Buf = buf + return buf, nil +} + +func encodeRunCode(ctx *encoder.RuntimeContext, b []byte, codeSet *encoder.OpcodeSet) ([]byte, error) { + if (ctx.Option.Flag & encoder.DebugOption) != 0 { + if (ctx.Option.Flag & encoder.ColorizeOption) != 0 { + return vm_color.DebugRun(ctx, b, codeSet) + } + return vm.DebugRun(ctx, b, codeSet) + } + if (ctx.Option.Flag & encoder.ColorizeOption) != 0 { + return vm_color.Run(ctx, b, codeSet) + } + return vm.Run(ctx, b, codeSet) +} + +func encodeRunIndentCode(ctx *encoder.RuntimeContext, b []byte, codeSet *encoder.OpcodeSet, prefix, indent string) ([]byte, error) { + ctx.Prefix = []byte(prefix) + ctx.IndentStr = []byte(indent) + if (ctx.Option.Flag & encoder.DebugOption) != 0 { + if (ctx.Option.Flag & encoder.ColorizeOption) != 0 { + return vm_color_indent.DebugRun(ctx, b, codeSet) + } + return vm_indent.DebugRun(ctx, b, codeSet) + } + if (ctx.Option.Flag & encoder.ColorizeOption) != 0 { + return vm_color_indent.Run(ctx, b, codeSet) + } + return vm_indent.Run(ctx, b, codeSet) +} diff --git a/vendor/github.com/goccy/go-json/error.go b/vendor/github.com/goccy/go-json/error.go new file mode 100644 index 000000000..94c1339a0 --- /dev/null +++ b/vendor/github.com/goccy/go-json/error.go @@ -0,0 +1,39 @@ +package json + +import ( + "github.com/goccy/go-json/internal/errors" +) + +// Before Go 1.2, an InvalidUTF8Error was returned by Marshal when +// attempting to encode a string value with invalid UTF-8 sequences. +// As of Go 1.2, Marshal instead coerces the string to valid UTF-8 by +// replacing invalid bytes with the Unicode replacement rune U+FFFD. +// +// Deprecated: No longer used; kept for compatibility. +type InvalidUTF8Error = errors.InvalidUTF8Error + +// An InvalidUnmarshalError describes an invalid argument passed to Unmarshal. +// (The argument to Unmarshal must be a non-nil pointer.) +type InvalidUnmarshalError = errors.InvalidUnmarshalError + +// A MarshalerError represents an error from calling a MarshalJSON or MarshalText method. +type MarshalerError = errors.MarshalerError + +// A SyntaxError is a description of a JSON syntax error. +type SyntaxError = errors.SyntaxError + +// An UnmarshalFieldError describes a JSON object key that +// led to an unexported (and therefore unwritable) struct field. +// +// Deprecated: No longer used; kept for compatibility. +type UnmarshalFieldError = errors.UnmarshalFieldError + +// An UnmarshalTypeError describes a JSON value that was +// not appropriate for a value of a specific Go type. +type UnmarshalTypeError = errors.UnmarshalTypeError + +// An UnsupportedTypeError is returned by Marshal when attempting +// to encode an unsupported value type. +type UnsupportedTypeError = errors.UnsupportedTypeError + +type UnsupportedValueError = errors.UnsupportedValueError diff --git a/vendor/github.com/goccy/go-json/internal/decoder/anonymous_field.go b/vendor/github.com/goccy/go-json/internal/decoder/anonymous_field.go new file mode 100644 index 000000000..030cb7a97 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/anonymous_field.go @@ -0,0 +1,37 @@ +package decoder + +import ( + "unsafe" + + "github.com/goccy/go-json/internal/runtime" +) + +type anonymousFieldDecoder struct { + structType *runtime.Type + offset uintptr + dec Decoder +} + +func newAnonymousFieldDecoder(structType *runtime.Type, offset uintptr, dec Decoder) *anonymousFieldDecoder { + return &anonymousFieldDecoder{ + structType: structType, + offset: offset, + dec: dec, + } +} + +func (d *anonymousFieldDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { + if *(*unsafe.Pointer)(p) == nil { + *(*unsafe.Pointer)(p) = unsafe_New(d.structType) + } + p = *(*unsafe.Pointer)(p) + return d.dec.DecodeStream(s, depth, unsafe.Pointer(uintptr(p)+d.offset)) +} + +func (d *anonymousFieldDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + if *(*unsafe.Pointer)(p) == nil { + *(*unsafe.Pointer)(p) = unsafe_New(d.structType) + } + p = *(*unsafe.Pointer)(p) + return d.dec.Decode(ctx, cursor, depth, unsafe.Pointer(uintptr(p)+d.offset)) +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/array.go b/vendor/github.com/goccy/go-json/internal/decoder/array.go new file mode 100644 index 000000000..21f1fd585 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/array.go @@ -0,0 +1,169 @@ +package decoder + +import ( + "unsafe" + + "github.com/goccy/go-json/internal/errors" + "github.com/goccy/go-json/internal/runtime" +) + +type arrayDecoder struct { + elemType *runtime.Type + size uintptr + valueDecoder Decoder + alen int + structName string + fieldName string + zeroValue unsafe.Pointer +} + +func newArrayDecoder(dec Decoder, elemType *runtime.Type, alen int, structName, fieldName string) *arrayDecoder { + zeroValue := *(*unsafe.Pointer)(unsafe_New(elemType)) + return &arrayDecoder{ + valueDecoder: dec, + elemType: elemType, + size: elemType.Size(), + alen: alen, + structName: structName, + fieldName: fieldName, + zeroValue: zeroValue, + } +} + +func (d *arrayDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { + depth++ + if depth > maxDecodeNestingDepth { + return errors.ErrExceededMaxDepth(s.char(), s.cursor) + } + + for { + switch s.char() { + case ' ', '\n', '\t', '\r': + case 'n': + if err := nullBytes(s); err != nil { + return err + } + return nil + case '[': + idx := 0 + s.cursor++ + if s.skipWhiteSpace() == ']' { + for idx < d.alen { + *(*unsafe.Pointer)(unsafe.Pointer(uintptr(p) + uintptr(idx)*d.size)) = d.zeroValue + idx++ + } + s.cursor++ + return nil + } + for { + if idx < d.alen { + if err := d.valueDecoder.DecodeStream(s, depth, unsafe.Pointer(uintptr(p)+uintptr(idx)*d.size)); err != nil { + return err + } + } else { + if err := s.skipValue(depth); err != nil { + return err + } + } + idx++ + switch s.skipWhiteSpace() { + case ']': + for idx < d.alen { + *(*unsafe.Pointer)(unsafe.Pointer(uintptr(p) + uintptr(idx)*d.size)) = d.zeroValue + idx++ + } + s.cursor++ + return nil + case ',': + s.cursor++ + continue + case nul: + if s.read() { + s.cursor++ + continue + } + goto ERROR + default: + goto ERROR + } + } + case nul: + if s.read() { + continue + } + goto ERROR + default: + goto ERROR + } + s.cursor++ + } +ERROR: + return errors.ErrUnexpectedEndOfJSON("array", s.totalOffset()) +} + +func (d *arrayDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + buf := ctx.Buf + depth++ + if depth > maxDecodeNestingDepth { + return 0, errors.ErrExceededMaxDepth(buf[cursor], cursor) + } + + for { + switch buf[cursor] { + case ' ', '\n', '\t', '\r': + cursor++ + continue + case 'n': + if err := validateNull(buf, cursor); err != nil { + return 0, err + } + cursor += 4 + return cursor, nil + case '[': + idx := 0 + cursor++ + cursor = skipWhiteSpace(buf, cursor) + if buf[cursor] == ']' { + for idx < d.alen { + *(*unsafe.Pointer)(unsafe.Pointer(uintptr(p) + uintptr(idx)*d.size)) = d.zeroValue + idx++ + } + cursor++ + return cursor, nil + } + for { + if idx < d.alen { + c, err := d.valueDecoder.Decode(ctx, cursor, depth, unsafe.Pointer(uintptr(p)+uintptr(idx)*d.size)) + if err != nil { + return 0, err + } + cursor = c + } else { + c, err := skipValue(buf, cursor, depth) + if err != nil { + return 0, err + } + cursor = c + } + idx++ + cursor = skipWhiteSpace(buf, cursor) + switch buf[cursor] { + case ']': + for idx < d.alen { + *(*unsafe.Pointer)(unsafe.Pointer(uintptr(p) + uintptr(idx)*d.size)) = d.zeroValue + idx++ + } + cursor++ + return cursor, nil + case ',': + cursor++ + continue + default: + return 0, errors.ErrInvalidCharacter(buf[cursor], "array", cursor) + } + } + default: + return 0, errors.ErrUnexpectedEndOfJSON("array", cursor) + } + } +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/bool.go b/vendor/github.com/goccy/go-json/internal/decoder/bool.go new file mode 100644 index 000000000..455042a53 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/bool.go @@ -0,0 +1,78 @@ +package decoder + +import ( + "unsafe" + + "github.com/goccy/go-json/internal/errors" +) + +type boolDecoder struct { + structName string + fieldName string +} + +func newBoolDecoder(structName, fieldName string) *boolDecoder { + return &boolDecoder{structName: structName, fieldName: fieldName} +} + +func (d *boolDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { + c := s.skipWhiteSpace() + for { + switch c { + case 't': + if err := trueBytes(s); err != nil { + return err + } + **(**bool)(unsafe.Pointer(&p)) = true + return nil + case 'f': + if err := falseBytes(s); err != nil { + return err + } + **(**bool)(unsafe.Pointer(&p)) = false + return nil + case 'n': + if err := nullBytes(s); err != nil { + return err + } + return nil + case nul: + if s.read() { + c = s.char() + continue + } + goto ERROR + } + break + } +ERROR: + return errors.ErrUnexpectedEndOfJSON("bool", s.totalOffset()) +} + +func (d *boolDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + buf := ctx.Buf + cursor = skipWhiteSpace(buf, cursor) + switch buf[cursor] { + case 't': + if err := validateTrue(buf, cursor); err != nil { + return 0, err + } + cursor += 4 + **(**bool)(unsafe.Pointer(&p)) = true + return cursor, nil + case 'f': + if err := validateFalse(buf, cursor); err != nil { + return 0, err + } + cursor += 5 + **(**bool)(unsafe.Pointer(&p)) = false + return cursor, nil + case 'n': + if err := validateNull(buf, cursor); err != nil { + return 0, err + } + cursor += 4 + return cursor, nil + } + return 0, errors.ErrUnexpectedEndOfJSON("bool", cursor) +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/bytes.go b/vendor/github.com/goccy/go-json/internal/decoder/bytes.go new file mode 100644 index 000000000..92c7dcf64 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/bytes.go @@ -0,0 +1,113 @@ +package decoder + +import ( + "encoding/base64" + "unsafe" + + "github.com/goccy/go-json/internal/errors" + "github.com/goccy/go-json/internal/runtime" +) + +type bytesDecoder struct { + typ *runtime.Type + sliceDecoder Decoder + stringDecoder *stringDecoder + structName string + fieldName string +} + +func byteUnmarshalerSliceDecoder(typ *runtime.Type, structName string, fieldName string) Decoder { + var unmarshalDecoder Decoder + switch { + case runtime.PtrTo(typ).Implements(unmarshalJSONType): + unmarshalDecoder = newUnmarshalJSONDecoder(runtime.PtrTo(typ), structName, fieldName) + case runtime.PtrTo(typ).Implements(unmarshalTextType): + unmarshalDecoder = newUnmarshalTextDecoder(runtime.PtrTo(typ), structName, fieldName) + default: + unmarshalDecoder, _ = compileUint8(typ, structName, fieldName) + } + return newSliceDecoder(unmarshalDecoder, typ, 1, structName, fieldName) +} + +func newBytesDecoder(typ *runtime.Type, structName string, fieldName string) *bytesDecoder { + return &bytesDecoder{ + typ: typ, + sliceDecoder: byteUnmarshalerSliceDecoder(typ, structName, fieldName), + stringDecoder: newStringDecoder(structName, fieldName), + structName: structName, + fieldName: fieldName, + } +} + +func (d *bytesDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { + bytes, err := d.decodeStreamBinary(s, depth, p) + if err != nil { + return err + } + if bytes == nil { + s.reset() + return nil + } + decodedLen := base64.StdEncoding.DecodedLen(len(bytes)) + buf := make([]byte, decodedLen) + n, err := base64.StdEncoding.Decode(buf, bytes) + if err != nil { + return err + } + *(*[]byte)(p) = buf[:n] + s.reset() + return nil +} + +func (d *bytesDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + bytes, c, err := d.decodeBinary(ctx, cursor, depth, p) + if err != nil { + return 0, err + } + if bytes == nil { + return c, nil + } + cursor = c + decodedLen := base64.StdEncoding.DecodedLen(len(bytes)) + b := make([]byte, decodedLen) + n, err := base64.StdEncoding.Decode(b, bytes) + if err != nil { + return 0, err + } + *(*[]byte)(p) = b[:n] + return cursor, nil +} + +func (d *bytesDecoder) decodeStreamBinary(s *Stream, depth int64, p unsafe.Pointer) ([]byte, error) { + c := s.skipWhiteSpace() + if c == '[' { + if d.sliceDecoder == nil { + return nil, &errors.UnmarshalTypeError{ + Type: runtime.RType2Type(d.typ), + Offset: s.totalOffset(), + } + } + err := d.sliceDecoder.DecodeStream(s, depth, p) + return nil, err + } + return d.stringDecoder.decodeStreamByte(s) +} + +func (d *bytesDecoder) decodeBinary(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) ([]byte, int64, error) { + buf := ctx.Buf + cursor = skipWhiteSpace(buf, cursor) + if buf[cursor] == '[' { + if d.sliceDecoder == nil { + return nil, 0, &errors.UnmarshalTypeError{ + Type: runtime.RType2Type(d.typ), + Offset: cursor, + } + } + c, err := d.sliceDecoder.Decode(ctx, cursor, depth, p) + if err != nil { + return nil, 0, err + } + return nil, c, nil + } + return d.stringDecoder.decodeByte(buf, cursor) +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/compile.go b/vendor/github.com/goccy/go-json/internal/decoder/compile.go new file mode 100644 index 000000000..fab643764 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/compile.go @@ -0,0 +1,487 @@ +package decoder + +import ( + "encoding/json" + "fmt" + "reflect" + "strings" + "sync/atomic" + "unicode" + "unsafe" + + "github.com/goccy/go-json/internal/runtime" +) + +var ( + jsonNumberType = reflect.TypeOf(json.Number("")) + typeAddr *runtime.TypeAddr + cachedDecoderMap unsafe.Pointer // map[uintptr]decoder + cachedDecoder []Decoder +) + +func init() { + typeAddr = runtime.AnalyzeTypeAddr() + if typeAddr == nil { + typeAddr = &runtime.TypeAddr{} + } + cachedDecoder = make([]Decoder, typeAddr.AddrRange>>typeAddr.AddrShift+1) +} + +func loadDecoderMap() map[uintptr]Decoder { + p := atomic.LoadPointer(&cachedDecoderMap) + return *(*map[uintptr]Decoder)(unsafe.Pointer(&p)) +} + +func storeDecoder(typ uintptr, dec Decoder, m map[uintptr]Decoder) { + newDecoderMap := make(map[uintptr]Decoder, len(m)+1) + newDecoderMap[typ] = dec + + for k, v := range m { + newDecoderMap[k] = v + } + + atomic.StorePointer(&cachedDecoderMap, *(*unsafe.Pointer)(unsafe.Pointer(&newDecoderMap))) +} + +func compileToGetDecoderSlowPath(typeptr uintptr, typ *runtime.Type) (Decoder, error) { + decoderMap := loadDecoderMap() + if dec, exists := decoderMap[typeptr]; exists { + return dec, nil + } + + dec, err := compileHead(typ, map[uintptr]Decoder{}) + if err != nil { + return nil, err + } + storeDecoder(typeptr, dec, decoderMap) + return dec, nil +} + +func compileHead(typ *runtime.Type, structTypeToDecoder map[uintptr]Decoder) (Decoder, error) { + switch { + case implementsUnmarshalJSONType(runtime.PtrTo(typ)): + return newUnmarshalJSONDecoder(runtime.PtrTo(typ), "", ""), nil + case runtime.PtrTo(typ).Implements(unmarshalTextType): + return newUnmarshalTextDecoder(runtime.PtrTo(typ), "", ""), nil + } + return compile(typ.Elem(), "", "", structTypeToDecoder) +} + +func compile(typ *runtime.Type, structName, fieldName string, structTypeToDecoder map[uintptr]Decoder) (Decoder, error) { + switch { + case implementsUnmarshalJSONType(runtime.PtrTo(typ)): + return newUnmarshalJSONDecoder(runtime.PtrTo(typ), structName, fieldName), nil + case runtime.PtrTo(typ).Implements(unmarshalTextType): + return newUnmarshalTextDecoder(runtime.PtrTo(typ), structName, fieldName), nil + } + + switch typ.Kind() { + case reflect.Ptr: + return compilePtr(typ, structName, fieldName, structTypeToDecoder) + case reflect.Struct: + return compileStruct(typ, structName, fieldName, structTypeToDecoder) + case reflect.Slice: + elem := typ.Elem() + if elem.Kind() == reflect.Uint8 { + return compileBytes(elem, structName, fieldName) + } + return compileSlice(typ, structName, fieldName, structTypeToDecoder) + case reflect.Array: + return compileArray(typ, structName, fieldName, structTypeToDecoder) + case reflect.Map: + return compileMap(typ, structName, fieldName, structTypeToDecoder) + case reflect.Interface: + return compileInterface(typ, structName, fieldName) + case reflect.Uintptr: + return compileUint(typ, structName, fieldName) + case reflect.Int: + return compileInt(typ, structName, fieldName) + case reflect.Int8: + return compileInt8(typ, structName, fieldName) + case reflect.Int16: + return compileInt16(typ, structName, fieldName) + case reflect.Int32: + return compileInt32(typ, structName, fieldName) + case reflect.Int64: + return compileInt64(typ, structName, fieldName) + case reflect.Uint: + return compileUint(typ, structName, fieldName) + case reflect.Uint8: + return compileUint8(typ, structName, fieldName) + case reflect.Uint16: + return compileUint16(typ, structName, fieldName) + case reflect.Uint32: + return compileUint32(typ, structName, fieldName) + case reflect.Uint64: + return compileUint64(typ, structName, fieldName) + case reflect.String: + return compileString(typ, structName, fieldName) + case reflect.Bool: + return compileBool(structName, fieldName) + case reflect.Float32: + return compileFloat32(structName, fieldName) + case reflect.Float64: + return compileFloat64(structName, fieldName) + case reflect.Func: + return compileFunc(typ, structName, fieldName) + } + return newInvalidDecoder(typ, structName, fieldName), nil +} + +func isStringTagSupportedType(typ *runtime.Type) bool { + switch { + case implementsUnmarshalJSONType(runtime.PtrTo(typ)): + return false + case runtime.PtrTo(typ).Implements(unmarshalTextType): + return false + } + switch typ.Kind() { + case reflect.Map: + return false + case reflect.Slice: + return false + case reflect.Array: + return false + case reflect.Struct: + return false + case reflect.Interface: + return false + } + return true +} + +func compileMapKey(typ *runtime.Type, structName, fieldName string, structTypeToDecoder map[uintptr]Decoder) (Decoder, error) { + if runtime.PtrTo(typ).Implements(unmarshalTextType) { + return newUnmarshalTextDecoder(runtime.PtrTo(typ), structName, fieldName), nil + } + if typ.Kind() == reflect.String { + return newStringDecoder(structName, fieldName), nil + } + dec, err := compile(typ, structName, fieldName, structTypeToDecoder) + if err != nil { + return nil, err + } + for { + switch t := dec.(type) { + case *stringDecoder, *interfaceDecoder: + return dec, nil + case *boolDecoder, *intDecoder, *uintDecoder, *numberDecoder: + return newWrappedStringDecoder(typ, dec, structName, fieldName), nil + case *ptrDecoder: + dec = t.dec + default: + return newInvalidDecoder(typ, structName, fieldName), nil + } + } +} + +func compilePtr(typ *runtime.Type, structName, fieldName string, structTypeToDecoder map[uintptr]Decoder) (Decoder, error) { + dec, err := compile(typ.Elem(), structName, fieldName, structTypeToDecoder) + if err != nil { + return nil, err + } + return newPtrDecoder(dec, typ.Elem(), structName, fieldName), nil +} + +func compileInt(typ *runtime.Type, structName, fieldName string) (Decoder, error) { + return newIntDecoder(typ, structName, fieldName, func(p unsafe.Pointer, v int64) { + *(*int)(p) = int(v) + }), nil +} + +func compileInt8(typ *runtime.Type, structName, fieldName string) (Decoder, error) { + return newIntDecoder(typ, structName, fieldName, func(p unsafe.Pointer, v int64) { + *(*int8)(p) = int8(v) + }), nil +} + +func compileInt16(typ *runtime.Type, structName, fieldName string) (Decoder, error) { + return newIntDecoder(typ, structName, fieldName, func(p unsafe.Pointer, v int64) { + *(*int16)(p) = int16(v) + }), nil +} + +func compileInt32(typ *runtime.Type, structName, fieldName string) (Decoder, error) { + return newIntDecoder(typ, structName, fieldName, func(p unsafe.Pointer, v int64) { + *(*int32)(p) = int32(v) + }), nil +} + +func compileInt64(typ *runtime.Type, structName, fieldName string) (Decoder, error) { + return newIntDecoder(typ, structName, fieldName, func(p unsafe.Pointer, v int64) { + *(*int64)(p) = v + }), nil +} + +func compileUint(typ *runtime.Type, structName, fieldName string) (Decoder, error) { + return newUintDecoder(typ, structName, fieldName, func(p unsafe.Pointer, v uint64) { + *(*uint)(p) = uint(v) + }), nil +} + +func compileUint8(typ *runtime.Type, structName, fieldName string) (Decoder, error) { + return newUintDecoder(typ, structName, fieldName, func(p unsafe.Pointer, v uint64) { + *(*uint8)(p) = uint8(v) + }), nil +} + +func compileUint16(typ *runtime.Type, structName, fieldName string) (Decoder, error) { + return newUintDecoder(typ, structName, fieldName, func(p unsafe.Pointer, v uint64) { + *(*uint16)(p) = uint16(v) + }), nil +} + +func compileUint32(typ *runtime.Type, structName, fieldName string) (Decoder, error) { + return newUintDecoder(typ, structName, fieldName, func(p unsafe.Pointer, v uint64) { + *(*uint32)(p) = uint32(v) + }), nil +} + +func compileUint64(typ *runtime.Type, structName, fieldName string) (Decoder, error) { + return newUintDecoder(typ, structName, fieldName, func(p unsafe.Pointer, v uint64) { + *(*uint64)(p) = v + }), nil +} + +func compileFloat32(structName, fieldName string) (Decoder, error) { + return newFloatDecoder(structName, fieldName, func(p unsafe.Pointer, v float64) { + *(*float32)(p) = float32(v) + }), nil +} + +func compileFloat64(structName, fieldName string) (Decoder, error) { + return newFloatDecoder(structName, fieldName, func(p unsafe.Pointer, v float64) { + *(*float64)(p) = v + }), nil +} + +func compileString(typ *runtime.Type, structName, fieldName string) (Decoder, error) { + if typ == runtime.Type2RType(jsonNumberType) { + return newNumberDecoder(structName, fieldName, func(p unsafe.Pointer, v json.Number) { + *(*json.Number)(p) = v + }), nil + } + return newStringDecoder(structName, fieldName), nil +} + +func compileBool(structName, fieldName string) (Decoder, error) { + return newBoolDecoder(structName, fieldName), nil +} + +func compileBytes(typ *runtime.Type, structName, fieldName string) (Decoder, error) { + return newBytesDecoder(typ, structName, fieldName), nil +} + +func compileSlice(typ *runtime.Type, structName, fieldName string, structTypeToDecoder map[uintptr]Decoder) (Decoder, error) { + elem := typ.Elem() + decoder, err := compile(elem, structName, fieldName, structTypeToDecoder) + if err != nil { + return nil, err + } + return newSliceDecoder(decoder, elem, elem.Size(), structName, fieldName), nil +} + +func compileArray(typ *runtime.Type, structName, fieldName string, structTypeToDecoder map[uintptr]Decoder) (Decoder, error) { + elem := typ.Elem() + decoder, err := compile(elem, structName, fieldName, structTypeToDecoder) + if err != nil { + return nil, err + } + return newArrayDecoder(decoder, elem, typ.Len(), structName, fieldName), nil +} + +func compileMap(typ *runtime.Type, structName, fieldName string, structTypeToDecoder map[uintptr]Decoder) (Decoder, error) { + keyDec, err := compileMapKey(typ.Key(), structName, fieldName, structTypeToDecoder) + if err != nil { + return nil, err + } + valueDec, err := compile(typ.Elem(), structName, fieldName, structTypeToDecoder) + if err != nil { + return nil, err + } + return newMapDecoder(typ, typ.Key(), keyDec, typ.Elem(), valueDec, structName, fieldName), nil +} + +func compileInterface(typ *runtime.Type, structName, fieldName string) (Decoder, error) { + return newInterfaceDecoder(typ, structName, fieldName), nil +} + +func compileFunc(typ *runtime.Type, strutName, fieldName string) (Decoder, error) { + return newFuncDecoder(typ, strutName, fieldName), nil +} + +func typeToStructTags(typ *runtime.Type) runtime.StructTags { + tags := runtime.StructTags{} + fieldNum := typ.NumField() + for i := 0; i < fieldNum; i++ { + field := typ.Field(i) + if runtime.IsIgnoredStructField(field) { + continue + } + tags = append(tags, runtime.StructTagFromField(field)) + } + return tags +} + +func compileStruct(typ *runtime.Type, structName, fieldName string, structTypeToDecoder map[uintptr]Decoder) (Decoder, error) { + fieldNum := typ.NumField() + fieldMap := map[string]*structFieldSet{} + typeptr := uintptr(unsafe.Pointer(typ)) + if dec, exists := structTypeToDecoder[typeptr]; exists { + return dec, nil + } + structDec := newStructDecoder(structName, fieldName, fieldMap) + structTypeToDecoder[typeptr] = structDec + structName = typ.Name() + tags := typeToStructTags(typ) + allFields := []*structFieldSet{} + for i := 0; i < fieldNum; i++ { + field := typ.Field(i) + if runtime.IsIgnoredStructField(field) { + continue + } + isUnexportedField := unicode.IsLower([]rune(field.Name)[0]) + tag := runtime.StructTagFromField(field) + dec, err := compile(runtime.Type2RType(field.Type), structName, field.Name, structTypeToDecoder) + if err != nil { + return nil, err + } + if field.Anonymous && !tag.IsTaggedKey { + if stDec, ok := dec.(*structDecoder); ok { + if runtime.Type2RType(field.Type) == typ { + // recursive definition + continue + } + for k, v := range stDec.fieldMap { + if tags.ExistsKey(k) { + continue + } + fieldSet := &structFieldSet{ + dec: v.dec, + offset: field.Offset + v.offset, + isTaggedKey: v.isTaggedKey, + key: k, + keyLen: int64(len(k)), + } + allFields = append(allFields, fieldSet) + } + } else if pdec, ok := dec.(*ptrDecoder); ok { + contentDec := pdec.contentDecoder() + if pdec.typ == typ { + // recursive definition + continue + } + var fieldSetErr error + if isUnexportedField { + fieldSetErr = fmt.Errorf( + "json: cannot set embedded pointer to unexported struct: %v", + field.Type.Elem(), + ) + } + if dec, ok := contentDec.(*structDecoder); ok { + for k, v := range dec.fieldMap { + if tags.ExistsKey(k) { + continue + } + fieldSet := &structFieldSet{ + dec: newAnonymousFieldDecoder(pdec.typ, v.offset, v.dec), + offset: field.Offset, + isTaggedKey: v.isTaggedKey, + key: k, + keyLen: int64(len(k)), + err: fieldSetErr, + } + allFields = append(allFields, fieldSet) + } + } else { + fieldSet := &structFieldSet{ + dec: pdec, + offset: field.Offset, + isTaggedKey: tag.IsTaggedKey, + key: field.Name, + keyLen: int64(len(field.Name)), + } + allFields = append(allFields, fieldSet) + } + } else { + fieldSet := &structFieldSet{ + dec: dec, + offset: field.Offset, + isTaggedKey: tag.IsTaggedKey, + key: field.Name, + keyLen: int64(len(field.Name)), + } + allFields = append(allFields, fieldSet) + } + } else { + if tag.IsString && isStringTagSupportedType(runtime.Type2RType(field.Type)) { + dec = newWrappedStringDecoder(runtime.Type2RType(field.Type), dec, structName, field.Name) + } + var key string + if tag.Key != "" { + key = tag.Key + } else { + key = field.Name + } + fieldSet := &structFieldSet{ + dec: dec, + offset: field.Offset, + isTaggedKey: tag.IsTaggedKey, + key: key, + keyLen: int64(len(key)), + } + allFields = append(allFields, fieldSet) + } + } + for _, set := range filterDuplicatedFields(allFields) { + fieldMap[set.key] = set + lower := strings.ToLower(set.key) + if _, exists := fieldMap[lower]; !exists { + // first win + fieldMap[lower] = set + } + } + delete(structTypeToDecoder, typeptr) + structDec.tryOptimize() + return structDec, nil +} + +func filterDuplicatedFields(allFields []*structFieldSet) []*structFieldSet { + fieldMap := map[string][]*structFieldSet{} + for _, field := range allFields { + fieldMap[field.key] = append(fieldMap[field.key], field) + } + duplicatedFieldMap := map[string]struct{}{} + for k, sets := range fieldMap { + sets = filterFieldSets(sets) + if len(sets) != 1 { + duplicatedFieldMap[k] = struct{}{} + } + } + + filtered := make([]*structFieldSet, 0, len(allFields)) + for _, field := range allFields { + if _, exists := duplicatedFieldMap[field.key]; exists { + continue + } + filtered = append(filtered, field) + } + return filtered +} + +func filterFieldSets(sets []*structFieldSet) []*structFieldSet { + if len(sets) == 1 { + return sets + } + filtered := make([]*structFieldSet, 0, len(sets)) + for _, set := range sets { + if set.isTaggedKey { + filtered = append(filtered, set) + } + } + return filtered +} + +func implementsUnmarshalJSONType(typ *runtime.Type) bool { + return typ.Implements(unmarshalJSONType) || typ.Implements(unmarshalJSONContextType) +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go b/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go new file mode 100644 index 000000000..eb7e2b134 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go @@ -0,0 +1,29 @@ +//go:build !race +// +build !race + +package decoder + +import ( + "unsafe" + + "github.com/goccy/go-json/internal/runtime" +) + +func CompileToGetDecoder(typ *runtime.Type) (Decoder, error) { + typeptr := uintptr(unsafe.Pointer(typ)) + if typeptr > typeAddr.MaxTypeAddr { + return compileToGetDecoderSlowPath(typeptr, typ) + } + + index := (typeptr - typeAddr.BaseTypeAddr) >> typeAddr.AddrShift + if dec := cachedDecoder[index]; dec != nil { + return dec, nil + } + + dec, err := compileHead(typ, map[uintptr]Decoder{}) + if err != nil { + return nil, err + } + cachedDecoder[index] = dec + return dec, nil +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go b/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go new file mode 100644 index 000000000..49cdda4a1 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go @@ -0,0 +1,37 @@ +//go:build race +// +build race + +package decoder + +import ( + "sync" + "unsafe" + + "github.com/goccy/go-json/internal/runtime" +) + +var decMu sync.RWMutex + +func CompileToGetDecoder(typ *runtime.Type) (Decoder, error) { + typeptr := uintptr(unsafe.Pointer(typ)) + if typeptr > typeAddr.MaxTypeAddr { + return compileToGetDecoderSlowPath(typeptr, typ) + } + + index := (typeptr - typeAddr.BaseTypeAddr) >> typeAddr.AddrShift + decMu.RLock() + if dec := cachedDecoder[index]; dec != nil { + decMu.RUnlock() + return dec, nil + } + decMu.RUnlock() + + dec, err := compileHead(typ, map[uintptr]Decoder{}) + if err != nil { + return nil, err + } + decMu.Lock() + cachedDecoder[index] = dec + decMu.Unlock() + return dec, nil +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/context.go b/vendor/github.com/goccy/go-json/internal/decoder/context.go new file mode 100644 index 000000000..cb2ffdafd --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/context.go @@ -0,0 +1,254 @@ +package decoder + +import ( + "sync" + "unsafe" + + "github.com/goccy/go-json/internal/errors" +) + +type RuntimeContext struct { + Buf []byte + Option *Option +} + +var ( + runtimeContextPool = sync.Pool{ + New: func() interface{} { + return &RuntimeContext{ + Option: &Option{}, + } + }, + } +) + +func TakeRuntimeContext() *RuntimeContext { + return runtimeContextPool.Get().(*RuntimeContext) +} + +func ReleaseRuntimeContext(ctx *RuntimeContext) { + runtimeContextPool.Put(ctx) +} + +var ( + isWhiteSpace = [256]bool{} +) + +func init() { + isWhiteSpace[' '] = true + isWhiteSpace['\n'] = true + isWhiteSpace['\t'] = true + isWhiteSpace['\r'] = true +} + +func char(ptr unsafe.Pointer, offset int64) byte { + return *(*byte)(unsafe.Pointer(uintptr(ptr) + uintptr(offset))) +} + +func skipWhiteSpace(buf []byte, cursor int64) int64 { + for isWhiteSpace[buf[cursor]] { + cursor++ + } + return cursor +} + +func skipObject(buf []byte, cursor, depth int64) (int64, error) { + braceCount := 1 + for { + switch buf[cursor] { + case '{': + braceCount++ + depth++ + if depth > maxDecodeNestingDepth { + return 0, errors.ErrExceededMaxDepth(buf[cursor], cursor) + } + case '}': + depth-- + braceCount-- + if braceCount == 0 { + return cursor + 1, nil + } + case '[': + depth++ + if depth > maxDecodeNestingDepth { + return 0, errors.ErrExceededMaxDepth(buf[cursor], cursor) + } + case ']': + depth-- + case '"': + for { + cursor++ + switch buf[cursor] { + case '\\': + cursor++ + if buf[cursor] == nul { + return 0, errors.ErrUnexpectedEndOfJSON("string of object", cursor) + } + case '"': + goto SWITCH_OUT + case nul: + return 0, errors.ErrUnexpectedEndOfJSON("string of object", cursor) + } + } + case nul: + return 0, errors.ErrUnexpectedEndOfJSON("object of object", cursor) + } + SWITCH_OUT: + cursor++ + } +} + +func skipArray(buf []byte, cursor, depth int64) (int64, error) { + bracketCount := 1 + for { + switch buf[cursor] { + case '[': + bracketCount++ + depth++ + if depth > maxDecodeNestingDepth { + return 0, errors.ErrExceededMaxDepth(buf[cursor], cursor) + } + case ']': + bracketCount-- + depth-- + if bracketCount == 0 { + return cursor + 1, nil + } + case '{': + depth++ + if depth > maxDecodeNestingDepth { + return 0, errors.ErrExceededMaxDepth(buf[cursor], cursor) + } + case '}': + depth-- + case '"': + for { + cursor++ + switch buf[cursor] { + case '\\': + cursor++ + if buf[cursor] == nul { + return 0, errors.ErrUnexpectedEndOfJSON("string of object", cursor) + } + case '"': + goto SWITCH_OUT + case nul: + return 0, errors.ErrUnexpectedEndOfJSON("string of object", cursor) + } + } + case nul: + return 0, errors.ErrUnexpectedEndOfJSON("array of object", cursor) + } + SWITCH_OUT: + cursor++ + } +} + +func skipValue(buf []byte, cursor, depth int64) (int64, error) { + for { + switch buf[cursor] { + case ' ', '\t', '\n', '\r': + cursor++ + continue + case '{': + return skipObject(buf, cursor+1, depth+1) + case '[': + return skipArray(buf, cursor+1, depth+1) + case '"': + for { + cursor++ + switch buf[cursor] { + case '\\': + cursor++ + if buf[cursor] == nul { + return 0, errors.ErrUnexpectedEndOfJSON("string of object", cursor) + } + case '"': + return cursor + 1, nil + case nul: + return 0, errors.ErrUnexpectedEndOfJSON("string of object", cursor) + } + } + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + for { + cursor++ + if floatTable[buf[cursor]] { + continue + } + break + } + return cursor, nil + case 't': + if err := validateTrue(buf, cursor); err != nil { + return 0, err + } + cursor += 4 + return cursor, nil + case 'f': + if err := validateFalse(buf, cursor); err != nil { + return 0, err + } + cursor += 5 + return cursor, nil + case 'n': + if err := validateNull(buf, cursor); err != nil { + return 0, err + } + cursor += 4 + return cursor, nil + default: + return cursor, errors.ErrUnexpectedEndOfJSON("null", cursor) + } + } +} + +func validateTrue(buf []byte, cursor int64) error { + if cursor+3 >= int64(len(buf)) { + return errors.ErrUnexpectedEndOfJSON("true", cursor) + } + if buf[cursor+1] != 'r' { + return errors.ErrInvalidCharacter(buf[cursor+1], "true", cursor) + } + if buf[cursor+2] != 'u' { + return errors.ErrInvalidCharacter(buf[cursor+2], "true", cursor) + } + if buf[cursor+3] != 'e' { + return errors.ErrInvalidCharacter(buf[cursor+3], "true", cursor) + } + return nil +} + +func validateFalse(buf []byte, cursor int64) error { + if cursor+4 >= int64(len(buf)) { + return errors.ErrUnexpectedEndOfJSON("false", cursor) + } + if buf[cursor+1] != 'a' { + return errors.ErrInvalidCharacter(buf[cursor+1], "false", cursor) + } + if buf[cursor+2] != 'l' { + return errors.ErrInvalidCharacter(buf[cursor+2], "false", cursor) + } + if buf[cursor+3] != 's' { + return errors.ErrInvalidCharacter(buf[cursor+3], "false", cursor) + } + if buf[cursor+4] != 'e' { + return errors.ErrInvalidCharacter(buf[cursor+4], "false", cursor) + } + return nil +} + +func validateNull(buf []byte, cursor int64) error { + if cursor+3 >= int64(len(buf)) { + return errors.ErrUnexpectedEndOfJSON("null", cursor) + } + if buf[cursor+1] != 'u' { + return errors.ErrInvalidCharacter(buf[cursor+1], "null", cursor) + } + if buf[cursor+2] != 'l' { + return errors.ErrInvalidCharacter(buf[cursor+2], "null", cursor) + } + if buf[cursor+3] != 'l' { + return errors.ErrInvalidCharacter(buf[cursor+3], "null", cursor) + } + return nil +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/float.go b/vendor/github.com/goccy/go-json/internal/decoder/float.go new file mode 100644 index 000000000..dfb7168da --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/float.go @@ -0,0 +1,158 @@ +package decoder + +import ( + "strconv" + "unsafe" + + "github.com/goccy/go-json/internal/errors" +) + +type floatDecoder struct { + op func(unsafe.Pointer, float64) + structName string + fieldName string +} + +func newFloatDecoder(structName, fieldName string, op func(unsafe.Pointer, float64)) *floatDecoder { + return &floatDecoder{op: op, structName: structName, fieldName: fieldName} +} + +var ( + floatTable = [256]bool{ + '0': true, + '1': true, + '2': true, + '3': true, + '4': true, + '5': true, + '6': true, + '7': true, + '8': true, + '9': true, + '.': true, + 'e': true, + 'E': true, + '+': true, + '-': true, + } + + validEndNumberChar = [256]bool{ + nul: true, + ' ': true, + '\t': true, + '\r': true, + '\n': true, + ',': true, + ':': true, + '}': true, + ']': true, + } +) + +func floatBytes(s *Stream) []byte { + start := s.cursor + for { + s.cursor++ + if floatTable[s.char()] { + continue + } else if s.char() == nul { + if s.read() { + s.cursor-- // for retry current character + continue + } + } + break + } + return s.buf[start:s.cursor] +} + +func (d *floatDecoder) decodeStreamByte(s *Stream) ([]byte, error) { + for { + switch s.char() { + case ' ', '\n', '\t', '\r': + s.cursor++ + continue + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + return floatBytes(s), nil + case 'n': + if err := nullBytes(s); err != nil { + return nil, err + } + return nil, nil + case nul: + if s.read() { + continue + } + goto ERROR + default: + goto ERROR + } + } +ERROR: + return nil, errors.ErrUnexpectedEndOfJSON("float", s.totalOffset()) +} + +func (d *floatDecoder) decodeByte(buf []byte, cursor int64) ([]byte, int64, error) { + for { + switch buf[cursor] { + case ' ', '\n', '\t', '\r': + cursor++ + continue + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + start := cursor + cursor++ + for floatTable[buf[cursor]] { + cursor++ + } + num := buf[start:cursor] + return num, cursor, nil + case 'n': + if err := validateNull(buf, cursor); err != nil { + return nil, 0, err + } + cursor += 4 + return nil, cursor, nil + default: + return nil, 0, errors.ErrUnexpectedEndOfJSON("float", cursor) + } + } +} + +func (d *floatDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { + bytes, err := d.decodeStreamByte(s) + if err != nil { + return err + } + if bytes == nil { + return nil + } + str := *(*string)(unsafe.Pointer(&bytes)) + f64, err := strconv.ParseFloat(str, 64) + if err != nil { + return errors.ErrSyntax(err.Error(), s.totalOffset()) + } + d.op(p, f64) + return nil +} + +func (d *floatDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + buf := ctx.Buf + bytes, c, err := d.decodeByte(buf, cursor) + if err != nil { + return 0, err + } + if bytes == nil { + return c, nil + } + cursor = c + if !validEndNumberChar[buf[cursor]] { + return 0, errors.ErrUnexpectedEndOfJSON("float", cursor) + } + s := *(*string)(unsafe.Pointer(&bytes)) + f64, err := strconv.ParseFloat(s, 64) + if err != nil { + return 0, errors.ErrSyntax(err.Error(), cursor) + } + d.op(p, f64) + return cursor, nil +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/func.go b/vendor/github.com/goccy/go-json/internal/decoder/func.go new file mode 100644 index 000000000..ee3563711 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/func.go @@ -0,0 +1,141 @@ +package decoder + +import ( + "bytes" + "unsafe" + + "github.com/goccy/go-json/internal/errors" + "github.com/goccy/go-json/internal/runtime" +) + +type funcDecoder struct { + typ *runtime.Type + structName string + fieldName string +} + +func newFuncDecoder(typ *runtime.Type, structName, fieldName string) *funcDecoder { + fnDecoder := &funcDecoder{typ, structName, fieldName} + return fnDecoder +} + +func (d *funcDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { + s.skipWhiteSpace() + start := s.cursor + if err := s.skipValue(depth); err != nil { + return err + } + src := s.buf[start:s.cursor] + if len(src) > 0 { + switch src[0] { + case '"': + return &errors.UnmarshalTypeError{ + Value: "string", + Type: runtime.RType2Type(d.typ), + Offset: s.totalOffset(), + } + case '[': + return &errors.UnmarshalTypeError{ + Value: "array", + Type: runtime.RType2Type(d.typ), + Offset: s.totalOffset(), + } + case '{': + return &errors.UnmarshalTypeError{ + Value: "object", + Type: runtime.RType2Type(d.typ), + Offset: s.totalOffset(), + } + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + return &errors.UnmarshalTypeError{ + Value: "number", + Type: runtime.RType2Type(d.typ), + Offset: s.totalOffset(), + } + case 'n': + if err := nullBytes(s); err != nil { + return err + } + *(*unsafe.Pointer)(p) = nil + return nil + case 't': + if err := trueBytes(s); err == nil { + return &errors.UnmarshalTypeError{ + Value: "boolean", + Type: runtime.RType2Type(d.typ), + Offset: s.totalOffset(), + } + } + case 'f': + if err := falseBytes(s); err == nil { + return &errors.UnmarshalTypeError{ + Value: "boolean", + Type: runtime.RType2Type(d.typ), + Offset: s.totalOffset(), + } + } + } + } + return errors.ErrInvalidBeginningOfValue(s.buf[s.cursor], s.totalOffset()) +} + +func (d *funcDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + buf := ctx.Buf + cursor = skipWhiteSpace(buf, cursor) + start := cursor + end, err := skipValue(buf, cursor, depth) + if err != nil { + return 0, err + } + src := buf[start:end] + if len(src) > 0 { + switch src[0] { + case '"': + return 0, &errors.UnmarshalTypeError{ + Value: "string", + Type: runtime.RType2Type(d.typ), + Offset: start, + } + case '[': + return 0, &errors.UnmarshalTypeError{ + Value: "array", + Type: runtime.RType2Type(d.typ), + Offset: start, + } + case '{': + return 0, &errors.UnmarshalTypeError{ + Value: "object", + Type: runtime.RType2Type(d.typ), + Offset: start, + } + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + return 0, &errors.UnmarshalTypeError{ + Value: "number", + Type: runtime.RType2Type(d.typ), + Offset: start, + } + case 'n': + if bytes.Equal(src, nullbytes) { + *(*unsafe.Pointer)(p) = nil + return end, nil + } + case 't': + if err := validateTrue(buf, start); err == nil { + return 0, &errors.UnmarshalTypeError{ + Value: "boolean", + Type: runtime.RType2Type(d.typ), + Offset: start, + } + } + case 'f': + if err := validateFalse(buf, start); err == nil { + return 0, &errors.UnmarshalTypeError{ + Value: "boolean", + Type: runtime.RType2Type(d.typ), + Offset: start, + } + } + } + } + return cursor, errors.ErrInvalidBeginningOfValue(buf[cursor], cursor) +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/int.go b/vendor/github.com/goccy/go-json/internal/decoder/int.go new file mode 100644 index 000000000..509b753d6 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/int.go @@ -0,0 +1,242 @@ +package decoder + +import ( + "fmt" + "reflect" + "unsafe" + + "github.com/goccy/go-json/internal/errors" + "github.com/goccy/go-json/internal/runtime" +) + +type intDecoder struct { + typ *runtime.Type + kind reflect.Kind + op func(unsafe.Pointer, int64) + structName string + fieldName string +} + +func newIntDecoder(typ *runtime.Type, structName, fieldName string, op func(unsafe.Pointer, int64)) *intDecoder { + return &intDecoder{ + typ: typ, + kind: typ.Kind(), + op: op, + structName: structName, + fieldName: fieldName, + } +} + +func (d *intDecoder) typeError(buf []byte, offset int64) *errors.UnmarshalTypeError { + return &errors.UnmarshalTypeError{ + Value: fmt.Sprintf("number %s", string(buf)), + Type: runtime.RType2Type(d.typ), + Struct: d.structName, + Field: d.fieldName, + Offset: offset, + } +} + +var ( + pow10i64 = [...]int64{ + 1e00, 1e01, 1e02, 1e03, 1e04, 1e05, 1e06, 1e07, 1e08, 1e09, + 1e10, 1e11, 1e12, 1e13, 1e14, 1e15, 1e16, 1e17, 1e18, + } + pow10i64Len = len(pow10i64) +) + +func (d *intDecoder) parseInt(b []byte) (int64, error) { + isNegative := false + if b[0] == '-' { + b = b[1:] + isNegative = true + } + maxDigit := len(b) + if maxDigit > pow10i64Len { + return 0, fmt.Errorf("invalid length of number") + } + sum := int64(0) + for i := 0; i < maxDigit; i++ { + c := int64(b[i]) - 48 + digitValue := pow10i64[maxDigit-i-1] + sum += c * digitValue + } + if isNegative { + return -1 * sum, nil + } + return sum, nil +} + +var ( + numTable = [256]bool{ + '0': true, + '1': true, + '2': true, + '3': true, + '4': true, + '5': true, + '6': true, + '7': true, + '8': true, + '9': true, + } +) + +var ( + numZeroBuf = []byte{'0'} +) + +func (d *intDecoder) decodeStreamByte(s *Stream) ([]byte, error) { + for { + switch s.char() { + case ' ', '\n', '\t', '\r': + s.cursor++ + continue + case '-': + start := s.cursor + for { + s.cursor++ + if numTable[s.char()] { + continue + } else if s.char() == nul { + if s.read() { + s.cursor-- // for retry current character + continue + } + } + break + } + num := s.buf[start:s.cursor] + if len(num) < 2 { + goto ERROR + } + return num, nil + case '0': + s.cursor++ + return numZeroBuf, nil + case '1', '2', '3', '4', '5', '6', '7', '8', '9': + start := s.cursor + for { + s.cursor++ + if numTable[s.char()] { + continue + } else if s.char() == nul { + if s.read() { + s.cursor-- // for retry current character + continue + } + } + break + } + num := s.buf[start:s.cursor] + return num, nil + case 'n': + if err := nullBytes(s); err != nil { + return nil, err + } + return nil, nil + case nul: + if s.read() { + continue + } + goto ERROR + default: + return nil, d.typeError([]byte{s.char()}, s.totalOffset()) + } + } +ERROR: + return nil, errors.ErrUnexpectedEndOfJSON("number(integer)", s.totalOffset()) +} + +func (d *intDecoder) decodeByte(buf []byte, cursor int64) ([]byte, int64, error) { + b := (*sliceHeader)(unsafe.Pointer(&buf)).data + for { + switch char(b, cursor) { + case ' ', '\n', '\t', '\r': + cursor++ + continue + case '0': + cursor++ + return numZeroBuf, cursor, nil + case '-', '1', '2', '3', '4', '5', '6', '7', '8', '9': + start := cursor + cursor++ + for numTable[char(b, cursor)] { + cursor++ + } + num := buf[start:cursor] + return num, cursor, nil + case 'n': + if err := validateNull(buf, cursor); err != nil { + return nil, 0, err + } + cursor += 4 + return nil, cursor, nil + default: + return nil, 0, d.typeError([]byte{char(b, cursor)}, cursor) + } + } +} + +func (d *intDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { + bytes, err := d.decodeStreamByte(s) + if err != nil { + return err + } + if bytes == nil { + return nil + } + i64, err := d.parseInt(bytes) + if err != nil { + return d.typeError(bytes, s.totalOffset()) + } + switch d.kind { + case reflect.Int8: + if i64 < -1*(1<<7) || (1<<7) <= i64 { + return d.typeError(bytes, s.totalOffset()) + } + case reflect.Int16: + if i64 < -1*(1<<15) || (1<<15) <= i64 { + return d.typeError(bytes, s.totalOffset()) + } + case reflect.Int32: + if i64 < -1*(1<<31) || (1<<31) <= i64 { + return d.typeError(bytes, s.totalOffset()) + } + } + d.op(p, i64) + s.reset() + return nil +} + +func (d *intDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + bytes, c, err := d.decodeByte(ctx.Buf, cursor) + if err != nil { + return 0, err + } + if bytes == nil { + return c, nil + } + cursor = c + + i64, err := d.parseInt(bytes) + if err != nil { + return 0, d.typeError(bytes, cursor) + } + switch d.kind { + case reflect.Int8: + if i64 < -1*(1<<7) || (1<<7) <= i64 { + return 0, d.typeError(bytes, cursor) + } + case reflect.Int16: + if i64 < -1*(1<<15) || (1<<15) <= i64 { + return 0, d.typeError(bytes, cursor) + } + case reflect.Int32: + if i64 < -1*(1<<31) || (1<<31) <= i64 { + return 0, d.typeError(bytes, cursor) + } + } + d.op(p, i64) + return cursor, nil +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/interface.go b/vendor/github.com/goccy/go-json/internal/decoder/interface.go new file mode 100644 index 000000000..4dbb4be4a --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/interface.go @@ -0,0 +1,458 @@ +package decoder + +import ( + "bytes" + "encoding" + "encoding/json" + "reflect" + "unsafe" + + "github.com/goccy/go-json/internal/errors" + "github.com/goccy/go-json/internal/runtime" +) + +type interfaceDecoder struct { + typ *runtime.Type + structName string + fieldName string + sliceDecoder *sliceDecoder + mapDecoder *mapDecoder + floatDecoder *floatDecoder + numberDecoder *numberDecoder + stringDecoder *stringDecoder +} + +func newEmptyInterfaceDecoder(structName, fieldName string) *interfaceDecoder { + ifaceDecoder := &interfaceDecoder{ + typ: emptyInterfaceType, + structName: structName, + fieldName: fieldName, + floatDecoder: newFloatDecoder(structName, fieldName, func(p unsafe.Pointer, v float64) { + *(*interface{})(p) = v + }), + numberDecoder: newNumberDecoder(structName, fieldName, func(p unsafe.Pointer, v json.Number) { + *(*interface{})(p) = v + }), + stringDecoder: newStringDecoder(structName, fieldName), + } + ifaceDecoder.sliceDecoder = newSliceDecoder( + ifaceDecoder, + emptyInterfaceType, + emptyInterfaceType.Size(), + structName, fieldName, + ) + ifaceDecoder.mapDecoder = newMapDecoder( + interfaceMapType, + stringType, + ifaceDecoder.stringDecoder, + interfaceMapType.Elem(), + ifaceDecoder, + structName, + fieldName, + ) + return ifaceDecoder +} + +func newInterfaceDecoder(typ *runtime.Type, structName, fieldName string) *interfaceDecoder { + emptyIfaceDecoder := newEmptyInterfaceDecoder(structName, fieldName) + stringDecoder := newStringDecoder(structName, fieldName) + return &interfaceDecoder{ + typ: typ, + structName: structName, + fieldName: fieldName, + sliceDecoder: newSliceDecoder( + emptyIfaceDecoder, + emptyInterfaceType, + emptyInterfaceType.Size(), + structName, fieldName, + ), + mapDecoder: newMapDecoder( + interfaceMapType, + stringType, + stringDecoder, + interfaceMapType.Elem(), + emptyIfaceDecoder, + structName, + fieldName, + ), + floatDecoder: newFloatDecoder(structName, fieldName, func(p unsafe.Pointer, v float64) { + *(*interface{})(p) = v + }), + numberDecoder: newNumberDecoder(structName, fieldName, func(p unsafe.Pointer, v json.Number) { + *(*interface{})(p) = v + }), + stringDecoder: stringDecoder, + } +} + +func (d *interfaceDecoder) numDecoder(s *Stream) Decoder { + if s.UseNumber { + return d.numberDecoder + } + return d.floatDecoder +} + +var ( + emptyInterfaceType = runtime.Type2RType(reflect.TypeOf((*interface{})(nil)).Elem()) + interfaceMapType = runtime.Type2RType( + reflect.TypeOf((*map[string]interface{})(nil)).Elem(), + ) + stringType = runtime.Type2RType( + reflect.TypeOf(""), + ) +) + +func decodeStreamUnmarshaler(s *Stream, depth int64, unmarshaler json.Unmarshaler) error { + start := s.cursor + if err := s.skipValue(depth); err != nil { + return err + } + src := s.buf[start:s.cursor] + dst := make([]byte, len(src)) + copy(dst, src) + + if err := unmarshaler.UnmarshalJSON(dst); err != nil { + return err + } + return nil +} + +func decodeStreamUnmarshalerContext(s *Stream, depth int64, unmarshaler unmarshalerContext) error { + start := s.cursor + if err := s.skipValue(depth); err != nil { + return err + } + src := s.buf[start:s.cursor] + dst := make([]byte, len(src)) + copy(dst, src) + + if err := unmarshaler.UnmarshalJSON(s.Option.Context, dst); err != nil { + return err + } + return nil +} + +func decodeUnmarshaler(buf []byte, cursor, depth int64, unmarshaler json.Unmarshaler) (int64, error) { + cursor = skipWhiteSpace(buf, cursor) + start := cursor + end, err := skipValue(buf, cursor, depth) + if err != nil { + return 0, err + } + src := buf[start:end] + dst := make([]byte, len(src)) + copy(dst, src) + + if err := unmarshaler.UnmarshalJSON(dst); err != nil { + return 0, err + } + return end, nil +} + +func decodeUnmarshalerContext(ctx *RuntimeContext, buf []byte, cursor, depth int64, unmarshaler unmarshalerContext) (int64, error) { + cursor = skipWhiteSpace(buf, cursor) + start := cursor + end, err := skipValue(buf, cursor, depth) + if err != nil { + return 0, err + } + src := buf[start:end] + dst := make([]byte, len(src)) + copy(dst, src) + + if err := unmarshaler.UnmarshalJSON(ctx.Option.Context, dst); err != nil { + return 0, err + } + return end, nil +} + +func decodeStreamTextUnmarshaler(s *Stream, depth int64, unmarshaler encoding.TextUnmarshaler, p unsafe.Pointer) error { + start := s.cursor + if err := s.skipValue(depth); err != nil { + return err + } + src := s.buf[start:s.cursor] + if bytes.Equal(src, nullbytes) { + *(*unsafe.Pointer)(p) = nil + return nil + } + + dst := make([]byte, len(src)) + copy(dst, src) + + if err := unmarshaler.UnmarshalText(dst); err != nil { + return err + } + return nil +} + +func decodeTextUnmarshaler(buf []byte, cursor, depth int64, unmarshaler encoding.TextUnmarshaler, p unsafe.Pointer) (int64, error) { + cursor = skipWhiteSpace(buf, cursor) + start := cursor + end, err := skipValue(buf, cursor, depth) + if err != nil { + return 0, err + } + src := buf[start:end] + if bytes.Equal(src, nullbytes) { + *(*unsafe.Pointer)(p) = nil + return end, nil + } + if s, ok := unquoteBytes(src); ok { + src = s + } + if err := unmarshaler.UnmarshalText(src); err != nil { + return 0, err + } + return end, nil +} + +func (d *interfaceDecoder) decodeStreamEmptyInterface(s *Stream, depth int64, p unsafe.Pointer) error { + c := s.skipWhiteSpace() + for { + switch c { + case '{': + var v map[string]interface{} + ptr := unsafe.Pointer(&v) + if err := d.mapDecoder.DecodeStream(s, depth, ptr); err != nil { + return err + } + *(*interface{})(p) = v + return nil + case '[': + var v []interface{} + ptr := unsafe.Pointer(&v) + if err := d.sliceDecoder.DecodeStream(s, depth, ptr); err != nil { + return err + } + *(*interface{})(p) = v + return nil + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + return d.numDecoder(s).DecodeStream(s, depth, p) + case '"': + s.cursor++ + start := s.cursor + for { + switch s.char() { + case '\\': + if _, err := decodeEscapeString(s, nil); err != nil { + return err + } + case '"': + literal := s.buf[start:s.cursor] + s.cursor++ + *(*interface{})(p) = string(literal) + return nil + case nul: + if s.read() { + continue + } + return errors.ErrUnexpectedEndOfJSON("string", s.totalOffset()) + } + s.cursor++ + } + case 't': + if err := trueBytes(s); err != nil { + return err + } + **(**interface{})(unsafe.Pointer(&p)) = true + return nil + case 'f': + if err := falseBytes(s); err != nil { + return err + } + **(**interface{})(unsafe.Pointer(&p)) = false + return nil + case 'n': + if err := nullBytes(s); err != nil { + return err + } + *(*interface{})(p) = nil + return nil + case nul: + if s.read() { + c = s.char() + continue + } + } + break + } + return errors.ErrInvalidBeginningOfValue(c, s.totalOffset()) +} + +type emptyInterface struct { + typ *runtime.Type + ptr unsafe.Pointer +} + +func (d *interfaceDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { + runtimeInterfaceValue := *(*interface{})(unsafe.Pointer(&emptyInterface{ + typ: d.typ, + ptr: p, + })) + rv := reflect.ValueOf(runtimeInterfaceValue) + if rv.NumMethod() > 0 && rv.CanInterface() { + if u, ok := rv.Interface().(unmarshalerContext); ok { + return decodeStreamUnmarshalerContext(s, depth, u) + } + if u, ok := rv.Interface().(json.Unmarshaler); ok { + return decodeStreamUnmarshaler(s, depth, u) + } + if u, ok := rv.Interface().(encoding.TextUnmarshaler); ok { + return decodeStreamTextUnmarshaler(s, depth, u, p) + } + if s.skipWhiteSpace() == 'n' { + if err := nullBytes(s); err != nil { + return err + } + *(*interface{})(p) = nil + return nil + } + return d.errUnmarshalType(rv.Type(), s.totalOffset()) + } + iface := rv.Interface() + ifaceHeader := (*emptyInterface)(unsafe.Pointer(&iface)) + typ := ifaceHeader.typ + if ifaceHeader.ptr == nil || d.typ == typ || typ == nil { + // concrete type is empty interface + return d.decodeStreamEmptyInterface(s, depth, p) + } + if typ.Kind() == reflect.Ptr && typ.Elem() == d.typ || typ.Kind() != reflect.Ptr { + return d.decodeStreamEmptyInterface(s, depth, p) + } + if s.skipWhiteSpace() == 'n' { + if err := nullBytes(s); err != nil { + return err + } + *(*interface{})(p) = nil + return nil + } + decoder, err := CompileToGetDecoder(typ) + if err != nil { + return err + } + return decoder.DecodeStream(s, depth, ifaceHeader.ptr) +} + +func (d *interfaceDecoder) errUnmarshalType(typ reflect.Type, offset int64) *errors.UnmarshalTypeError { + return &errors.UnmarshalTypeError{ + Value: typ.String(), + Type: typ, + Offset: offset, + Struct: d.structName, + Field: d.fieldName, + } +} + +func (d *interfaceDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + buf := ctx.Buf + runtimeInterfaceValue := *(*interface{})(unsafe.Pointer(&emptyInterface{ + typ: d.typ, + ptr: p, + })) + rv := reflect.ValueOf(runtimeInterfaceValue) + if rv.NumMethod() > 0 && rv.CanInterface() { + if u, ok := rv.Interface().(unmarshalerContext); ok { + return decodeUnmarshalerContext(ctx, buf, cursor, depth, u) + } + if u, ok := rv.Interface().(json.Unmarshaler); ok { + return decodeUnmarshaler(buf, cursor, depth, u) + } + if u, ok := rv.Interface().(encoding.TextUnmarshaler); ok { + return decodeTextUnmarshaler(buf, cursor, depth, u, p) + } + cursor = skipWhiteSpace(buf, cursor) + if buf[cursor] == 'n' { + if err := validateNull(buf, cursor); err != nil { + return 0, err + } + cursor += 4 + **(**interface{})(unsafe.Pointer(&p)) = nil + return cursor, nil + } + return 0, d.errUnmarshalType(rv.Type(), cursor) + } + + iface := rv.Interface() + ifaceHeader := (*emptyInterface)(unsafe.Pointer(&iface)) + typ := ifaceHeader.typ + if ifaceHeader.ptr == nil || d.typ == typ || typ == nil { + // concrete type is empty interface + return d.decodeEmptyInterface(ctx, cursor, depth, p) + } + if typ.Kind() == reflect.Ptr && typ.Elem() == d.typ || typ.Kind() != reflect.Ptr { + return d.decodeEmptyInterface(ctx, cursor, depth, p) + } + cursor = skipWhiteSpace(buf, cursor) + if buf[cursor] == 'n' { + if err := validateNull(buf, cursor); err != nil { + return 0, err + } + cursor += 4 + **(**interface{})(unsafe.Pointer(&p)) = nil + return cursor, nil + } + decoder, err := CompileToGetDecoder(typ) + if err != nil { + return 0, err + } + return decoder.Decode(ctx, cursor, depth, ifaceHeader.ptr) +} + +func (d *interfaceDecoder) decodeEmptyInterface(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + buf := ctx.Buf + cursor = skipWhiteSpace(buf, cursor) + switch buf[cursor] { + case '{': + var v map[string]interface{} + ptr := unsafe.Pointer(&v) + cursor, err := d.mapDecoder.Decode(ctx, cursor, depth, ptr) + if err != nil { + return 0, err + } + **(**interface{})(unsafe.Pointer(&p)) = v + return cursor, nil + case '[': + var v []interface{} + ptr := unsafe.Pointer(&v) + cursor, err := d.sliceDecoder.Decode(ctx, cursor, depth, ptr) + if err != nil { + return 0, err + } + **(**interface{})(unsafe.Pointer(&p)) = v + return cursor, nil + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + return d.floatDecoder.Decode(ctx, cursor, depth, p) + case '"': + var v string + ptr := unsafe.Pointer(&v) + cursor, err := d.stringDecoder.Decode(ctx, cursor, depth, ptr) + if err != nil { + return 0, err + } + **(**interface{})(unsafe.Pointer(&p)) = v + return cursor, nil + case 't': + if err := validateTrue(buf, cursor); err != nil { + return 0, err + } + cursor += 4 + **(**interface{})(unsafe.Pointer(&p)) = true + return cursor, nil + case 'f': + if err := validateFalse(buf, cursor); err != nil { + return 0, err + } + cursor += 5 + **(**interface{})(unsafe.Pointer(&p)) = false + return cursor, nil + case 'n': + if err := validateNull(buf, cursor); err != nil { + return 0, err + } + cursor += 4 + **(**interface{})(unsafe.Pointer(&p)) = nil + return cursor, nil + } + return cursor, errors.ErrInvalidBeginningOfValue(buf[cursor], cursor) +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/invalid.go b/vendor/github.com/goccy/go-json/internal/decoder/invalid.go new file mode 100644 index 000000000..1ef50a7d3 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/invalid.go @@ -0,0 +1,45 @@ +package decoder + +import ( + "reflect" + "unsafe" + + "github.com/goccy/go-json/internal/errors" + "github.com/goccy/go-json/internal/runtime" +) + +type invalidDecoder struct { + typ *runtime.Type + kind reflect.Kind + structName string + fieldName string +} + +func newInvalidDecoder(typ *runtime.Type, structName, fieldName string) *invalidDecoder { + return &invalidDecoder{ + typ: typ, + kind: typ.Kind(), + structName: structName, + fieldName: fieldName, + } +} + +func (d *invalidDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { + return &errors.UnmarshalTypeError{ + Value: "object", + Type: runtime.RType2Type(d.typ), + Offset: s.totalOffset(), + Struct: d.structName, + Field: d.fieldName, + } +} + +func (d *invalidDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + return 0, &errors.UnmarshalTypeError{ + Value: "object", + Type: runtime.RType2Type(d.typ), + Offset: cursor, + Struct: d.structName, + Field: d.fieldName, + } +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/map.go b/vendor/github.com/goccy/go-json/internal/decoder/map.go new file mode 100644 index 000000000..cb55ef006 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/map.go @@ -0,0 +1,187 @@ +package decoder + +import ( + "reflect" + "unsafe" + + "github.com/goccy/go-json/internal/errors" + "github.com/goccy/go-json/internal/runtime" +) + +type mapDecoder struct { + mapType *runtime.Type + keyType *runtime.Type + valueType *runtime.Type + canUseAssignFaststrType bool + keyDecoder Decoder + valueDecoder Decoder + structName string + fieldName string +} + +func newMapDecoder(mapType *runtime.Type, keyType *runtime.Type, keyDec Decoder, valueType *runtime.Type, valueDec Decoder, structName, fieldName string) *mapDecoder { + return &mapDecoder{ + mapType: mapType, + keyDecoder: keyDec, + keyType: keyType, + canUseAssignFaststrType: canUseAssignFaststrType(keyType, valueType), + valueType: valueType, + valueDecoder: valueDec, + structName: structName, + fieldName: fieldName, + } +} + +const ( + mapMaxElemSize = 128 +) + +// See detail: https://github.com/goccy/go-json/pull/283 +func canUseAssignFaststrType(key *runtime.Type, value *runtime.Type) bool { + indirectElem := value.Size() > mapMaxElemSize + if indirectElem { + return false + } + return key.Kind() == reflect.String +} + +//go:linkname makemap reflect.makemap +func makemap(*runtime.Type, int) unsafe.Pointer + +//nolint:golint +//go:linkname mapassign_faststr runtime.mapassign_faststr +//go:noescape +func mapassign_faststr(t *runtime.Type, m unsafe.Pointer, s string) unsafe.Pointer + +//go:linkname mapassign reflect.mapassign +//go:noescape +func mapassign(t *runtime.Type, m unsafe.Pointer, k, v unsafe.Pointer) + +func (d *mapDecoder) mapassign(t *runtime.Type, m, k, v unsafe.Pointer) { + if d.canUseAssignFaststrType { + mapV := mapassign_faststr(t, m, *(*string)(k)) + typedmemmove(d.valueType, mapV, v) + } else { + mapassign(t, m, k, v) + } +} + +func (d *mapDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { + depth++ + if depth > maxDecodeNestingDepth { + return errors.ErrExceededMaxDepth(s.char(), s.cursor) + } + + switch s.skipWhiteSpace() { + case 'n': + if err := nullBytes(s); err != nil { + return err + } + **(**unsafe.Pointer)(unsafe.Pointer(&p)) = nil + return nil + case '{': + default: + return errors.ErrExpected("{ character for map value", s.totalOffset()) + } + mapValue := *(*unsafe.Pointer)(p) + if mapValue == nil { + mapValue = makemap(d.mapType, 0) + } + s.cursor++ + if s.equalChar('}') { + *(*unsafe.Pointer)(p) = mapValue + s.cursor++ + return nil + } + for { + k := unsafe_New(d.keyType) + if err := d.keyDecoder.DecodeStream(s, depth, k); err != nil { + return err + } + s.skipWhiteSpace() + if !s.equalChar(':') { + return errors.ErrExpected("colon after object key", s.totalOffset()) + } + s.cursor++ + v := unsafe_New(d.valueType) + if err := d.valueDecoder.DecodeStream(s, depth, v); err != nil { + return err + } + d.mapassign(d.mapType, mapValue, k, v) + s.skipWhiteSpace() + if s.equalChar('}') { + **(**unsafe.Pointer)(unsafe.Pointer(&p)) = mapValue + s.cursor++ + return nil + } + if !s.equalChar(',') { + return errors.ErrExpected("comma after object value", s.totalOffset()) + } + s.cursor++ + } +} + +func (d *mapDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + buf := ctx.Buf + depth++ + if depth > maxDecodeNestingDepth { + return 0, errors.ErrExceededMaxDepth(buf[cursor], cursor) + } + + cursor = skipWhiteSpace(buf, cursor) + buflen := int64(len(buf)) + if buflen < 2 { + return 0, errors.ErrExpected("{} for map", cursor) + } + switch buf[cursor] { + case 'n': + if err := validateNull(buf, cursor); err != nil { + return 0, err + } + cursor += 4 + **(**unsafe.Pointer)(unsafe.Pointer(&p)) = nil + return cursor, nil + case '{': + default: + return 0, errors.ErrExpected("{ character for map value", cursor) + } + cursor++ + cursor = skipWhiteSpace(buf, cursor) + mapValue := *(*unsafe.Pointer)(p) + if mapValue == nil { + mapValue = makemap(d.mapType, 0) + } + if buf[cursor] == '}' { + **(**unsafe.Pointer)(unsafe.Pointer(&p)) = mapValue + cursor++ + return cursor, nil + } + for { + k := unsafe_New(d.keyType) + keyCursor, err := d.keyDecoder.Decode(ctx, cursor, depth, k) + if err != nil { + return 0, err + } + cursor = skipWhiteSpace(buf, keyCursor) + if buf[cursor] != ':' { + return 0, errors.ErrExpected("colon after object key", cursor) + } + cursor++ + v := unsafe_New(d.valueType) + valueCursor, err := d.valueDecoder.Decode(ctx, cursor, depth, v) + if err != nil { + return 0, err + } + d.mapassign(d.mapType, mapValue, k, v) + cursor = skipWhiteSpace(buf, valueCursor) + if buf[cursor] == '}' { + **(**unsafe.Pointer)(unsafe.Pointer(&p)) = mapValue + cursor++ + return cursor, nil + } + if buf[cursor] != ',' { + return 0, errors.ErrExpected("comma after object value", cursor) + } + cursor++ + } +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/number.go b/vendor/github.com/goccy/go-json/internal/decoder/number.go new file mode 100644 index 000000000..bf63773e3 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/number.go @@ -0,0 +1,112 @@ +package decoder + +import ( + "encoding/json" + "strconv" + "unsafe" + + "github.com/goccy/go-json/internal/errors" +) + +type numberDecoder struct { + stringDecoder *stringDecoder + op func(unsafe.Pointer, json.Number) + structName string + fieldName string +} + +func newNumberDecoder(structName, fieldName string, op func(unsafe.Pointer, json.Number)) *numberDecoder { + return &numberDecoder{ + stringDecoder: newStringDecoder(structName, fieldName), + op: op, + structName: structName, + fieldName: fieldName, + } +} + +func (d *numberDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { + bytes, err := d.decodeStreamByte(s) + if err != nil { + return err + } + if _, err := strconv.ParseFloat(*(*string)(unsafe.Pointer(&bytes)), 64); err != nil { + return errors.ErrSyntax(err.Error(), s.totalOffset()) + } + d.op(p, json.Number(string(bytes))) + s.reset() + return nil +} + +func (d *numberDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + bytes, c, err := d.decodeByte(ctx.Buf, cursor) + if err != nil { + return 0, err + } + if _, err := strconv.ParseFloat(*(*string)(unsafe.Pointer(&bytes)), 64); err != nil { + return 0, errors.ErrSyntax(err.Error(), c) + } + cursor = c + s := *(*string)(unsafe.Pointer(&bytes)) + d.op(p, json.Number(s)) + return cursor, nil +} + +func (d *numberDecoder) decodeStreamByte(s *Stream) ([]byte, error) { + start := s.cursor + for { + switch s.char() { + case ' ', '\n', '\t', '\r': + s.cursor++ + continue + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + return floatBytes(s), nil + case 'n': + if err := nullBytes(s); err != nil { + return nil, err + } + return nil, nil + case '"': + return d.stringDecoder.decodeStreamByte(s) + case nul: + if s.read() { + continue + } + goto ERROR + default: + goto ERROR + } + } +ERROR: + if s.cursor == start { + return nil, errors.ErrInvalidBeginningOfValue(s.char(), s.totalOffset()) + } + return nil, errors.ErrUnexpectedEndOfJSON("json.Number", s.totalOffset()) +} + +func (d *numberDecoder) decodeByte(buf []byte, cursor int64) ([]byte, int64, error) { + for { + switch buf[cursor] { + case ' ', '\n', '\t', '\r': + cursor++ + continue + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + start := cursor + cursor++ + for floatTable[buf[cursor]] { + cursor++ + } + num := buf[start:cursor] + return num, cursor, nil + case 'n': + if err := validateNull(buf, cursor); err != nil { + return nil, 0, err + } + cursor += 4 + return nil, cursor, nil + case '"': + return d.stringDecoder.decodeByte(buf, cursor) + default: + return nil, 0, errors.ErrUnexpectedEndOfJSON("json.Number", cursor) + } + } +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/option.go b/vendor/github.com/goccy/go-json/internal/decoder/option.go new file mode 100644 index 000000000..e41f876b0 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/option.go @@ -0,0 +1,15 @@ +package decoder + +import "context" + +type OptionFlags uint8 + +const ( + FirstWinOption OptionFlags = 1 << iota + ContextOption +) + +type Option struct { + Flags OptionFlags + Context context.Context +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/ptr.go b/vendor/github.com/goccy/go-json/internal/decoder/ptr.go new file mode 100644 index 000000000..2c83b9c44 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/ptr.go @@ -0,0 +1,87 @@ +package decoder + +import ( + "unsafe" + + "github.com/goccy/go-json/internal/runtime" +) + +type ptrDecoder struct { + dec Decoder + typ *runtime.Type + structName string + fieldName string +} + +func newPtrDecoder(dec Decoder, typ *runtime.Type, structName, fieldName string) *ptrDecoder { + return &ptrDecoder{ + dec: dec, + typ: typ, + structName: structName, + fieldName: fieldName, + } +} + +func (d *ptrDecoder) contentDecoder() Decoder { + dec, ok := d.dec.(*ptrDecoder) + if !ok { + return d.dec + } + return dec.contentDecoder() +} + +//nolint:golint +//go:linkname unsafe_New reflect.unsafe_New +func unsafe_New(*runtime.Type) unsafe.Pointer + +func (d *ptrDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { + if s.skipWhiteSpace() == nul { + s.read() + } + if s.char() == 'n' { + if err := nullBytes(s); err != nil { + return err + } + *(*unsafe.Pointer)(p) = nil + return nil + } + var newptr unsafe.Pointer + if *(*unsafe.Pointer)(p) == nil { + newptr = unsafe_New(d.typ) + *(*unsafe.Pointer)(p) = newptr + } else { + newptr = *(*unsafe.Pointer)(p) + } + if err := d.dec.DecodeStream(s, depth, newptr); err != nil { + return err + } + return nil +} + +func (d *ptrDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + buf := ctx.Buf + cursor = skipWhiteSpace(buf, cursor) + if buf[cursor] == 'n' { + if err := validateNull(buf, cursor); err != nil { + return 0, err + } + if p != nil { + *(*unsafe.Pointer)(p) = nil + } + cursor += 4 + return cursor, nil + } + var newptr unsafe.Pointer + if *(*unsafe.Pointer)(p) == nil { + newptr = unsafe_New(d.typ) + *(*unsafe.Pointer)(p) = newptr + } else { + newptr = *(*unsafe.Pointer)(p) + } + c, err := d.dec.Decode(ctx, cursor, depth, newptr) + if err != nil { + return 0, err + } + cursor = c + return cursor, nil +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/slice.go b/vendor/github.com/goccy/go-json/internal/decoder/slice.go new file mode 100644 index 000000000..85b6e1119 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/slice.go @@ -0,0 +1,301 @@ +package decoder + +import ( + "reflect" + "sync" + "unsafe" + + "github.com/goccy/go-json/internal/errors" + "github.com/goccy/go-json/internal/runtime" +) + +var ( + sliceType = runtime.Type2RType( + reflect.TypeOf((*sliceHeader)(nil)).Elem(), + ) + nilSlice = unsafe.Pointer(&sliceHeader{}) +) + +type sliceDecoder struct { + elemType *runtime.Type + isElemPointerType bool + valueDecoder Decoder + size uintptr + arrayPool sync.Pool + structName string + fieldName string +} + +// If use reflect.SliceHeader, data type is uintptr. +// In this case, Go compiler cannot trace reference created by newArray(). +// So, define using unsafe.Pointer as data type +type sliceHeader struct { + data unsafe.Pointer + len int + cap int +} + +const ( + defaultSliceCapacity = 2 +) + +func newSliceDecoder(dec Decoder, elemType *runtime.Type, size uintptr, structName, fieldName string) *sliceDecoder { + return &sliceDecoder{ + valueDecoder: dec, + elemType: elemType, + isElemPointerType: elemType.Kind() == reflect.Ptr || elemType.Kind() == reflect.Map, + size: size, + arrayPool: sync.Pool{ + New: func() interface{} { + return &sliceHeader{ + data: newArray(elemType, defaultSliceCapacity), + len: 0, + cap: defaultSliceCapacity, + } + }, + }, + structName: structName, + fieldName: fieldName, + } +} + +func (d *sliceDecoder) newSlice(src *sliceHeader) *sliceHeader { + slice := d.arrayPool.Get().(*sliceHeader) + if src.len > 0 { + // copy original elem + if slice.cap < src.cap { + data := newArray(d.elemType, src.cap) + slice = &sliceHeader{data: data, len: src.len, cap: src.cap} + } else { + slice.len = src.len + } + copySlice(d.elemType, *slice, *src) + } else { + slice.len = 0 + } + return slice +} + +func (d *sliceDecoder) releaseSlice(p *sliceHeader) { + d.arrayPool.Put(p) +} + +//go:linkname copySlice reflect.typedslicecopy +func copySlice(elemType *runtime.Type, dst, src sliceHeader) int + +//go:linkname newArray reflect.unsafe_NewArray +func newArray(*runtime.Type, int) unsafe.Pointer + +//go:linkname typedmemmove reflect.typedmemmove +func typedmemmove(t *runtime.Type, dst, src unsafe.Pointer) + +func (d *sliceDecoder) errNumber(offset int64) *errors.UnmarshalTypeError { + return &errors.UnmarshalTypeError{ + Value: "number", + Type: reflect.SliceOf(runtime.RType2Type(d.elemType)), + Struct: d.structName, + Field: d.fieldName, + Offset: offset, + } +} + +func (d *sliceDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { + depth++ + if depth > maxDecodeNestingDepth { + return errors.ErrExceededMaxDepth(s.char(), s.cursor) + } + + for { + switch s.char() { + case ' ', '\n', '\t', '\r': + s.cursor++ + continue + case 'n': + if err := nullBytes(s); err != nil { + return err + } + typedmemmove(sliceType, p, nilSlice) + return nil + case '[': + s.cursor++ + if s.skipWhiteSpace() == ']' { + dst := (*sliceHeader)(p) + if dst.data == nil { + dst.data = newArray(d.elemType, 0) + } else { + dst.len = 0 + } + s.cursor++ + return nil + } + idx := 0 + slice := d.newSlice((*sliceHeader)(p)) + srcLen := slice.len + capacity := slice.cap + data := slice.data + for { + if capacity <= idx { + src := sliceHeader{data: data, len: idx, cap: capacity} + capacity *= 2 + data = newArray(d.elemType, capacity) + dst := sliceHeader{data: data, len: idx, cap: capacity} + copySlice(d.elemType, dst, src) + } + ep := unsafe.Pointer(uintptr(data) + uintptr(idx)*d.size) + + // if srcLen is greater than idx, keep the original reference + if srcLen <= idx { + if d.isElemPointerType { + **(**unsafe.Pointer)(unsafe.Pointer(&ep)) = nil // initialize elem pointer + } else { + // assign new element to the slice + typedmemmove(d.elemType, ep, unsafe_New(d.elemType)) + } + } + + if err := d.valueDecoder.DecodeStream(s, depth, ep); err != nil { + return err + } + s.skipWhiteSpace() + RETRY: + switch s.char() { + case ']': + slice.cap = capacity + slice.len = idx + 1 + slice.data = data + dst := (*sliceHeader)(p) + dst.len = idx + 1 + if dst.len > dst.cap { + dst.data = newArray(d.elemType, dst.len) + dst.cap = dst.len + } + copySlice(d.elemType, *dst, *slice) + d.releaseSlice(slice) + s.cursor++ + return nil + case ',': + idx++ + case nul: + if s.read() { + goto RETRY + } + slice.cap = capacity + slice.data = data + d.releaseSlice(slice) + goto ERROR + default: + slice.cap = capacity + slice.data = data + d.releaseSlice(slice) + goto ERROR + } + s.cursor++ + } + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + return d.errNumber(s.totalOffset()) + case nul: + if s.read() { + continue + } + goto ERROR + default: + goto ERROR + } + } +ERROR: + return errors.ErrUnexpectedEndOfJSON("slice", s.totalOffset()) +} + +func (d *sliceDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + buf := ctx.Buf + depth++ + if depth > maxDecodeNestingDepth { + return 0, errors.ErrExceededMaxDepth(buf[cursor], cursor) + } + + for { + switch buf[cursor] { + case ' ', '\n', '\t', '\r': + cursor++ + continue + case 'n': + if err := validateNull(buf, cursor); err != nil { + return 0, err + } + cursor += 4 + typedmemmove(sliceType, p, nilSlice) + return cursor, nil + case '[': + cursor++ + cursor = skipWhiteSpace(buf, cursor) + if buf[cursor] == ']' { + dst := (*sliceHeader)(p) + if dst.data == nil { + dst.data = newArray(d.elemType, 0) + } else { + dst.len = 0 + } + cursor++ + return cursor, nil + } + idx := 0 + slice := d.newSlice((*sliceHeader)(p)) + srcLen := slice.len + capacity := slice.cap + data := slice.data + for { + if capacity <= idx { + src := sliceHeader{data: data, len: idx, cap: capacity} + capacity *= 2 + data = newArray(d.elemType, capacity) + dst := sliceHeader{data: data, len: idx, cap: capacity} + copySlice(d.elemType, dst, src) + } + ep := unsafe.Pointer(uintptr(data) + uintptr(idx)*d.size) + // if srcLen is greater than idx, keep the original reference + if srcLen <= idx { + if d.isElemPointerType { + **(**unsafe.Pointer)(unsafe.Pointer(&ep)) = nil // initialize elem pointer + } else { + // assign new element to the slice + typedmemmove(d.elemType, ep, unsafe_New(d.elemType)) + } + } + c, err := d.valueDecoder.Decode(ctx, cursor, depth, ep) + if err != nil { + return 0, err + } + cursor = c + cursor = skipWhiteSpace(buf, cursor) + switch buf[cursor] { + case ']': + slice.cap = capacity + slice.len = idx + 1 + slice.data = data + dst := (*sliceHeader)(p) + dst.len = idx + 1 + if dst.len > dst.cap { + dst.data = newArray(d.elemType, dst.len) + dst.cap = dst.len + } + copySlice(d.elemType, *dst, *slice) + d.releaseSlice(slice) + cursor++ + return cursor, nil + case ',': + idx++ + default: + slice.cap = capacity + slice.data = data + d.releaseSlice(slice) + return 0, errors.ErrInvalidCharacter(buf[cursor], "slice", cursor) + } + cursor++ + } + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + return 0, d.errNumber(cursor) + default: + return 0, errors.ErrUnexpectedEndOfJSON("slice", cursor) + } + } +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/stream.go b/vendor/github.com/goccy/go-json/internal/decoder/stream.go new file mode 100644 index 000000000..a383f7259 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/stream.go @@ -0,0 +1,556 @@ +package decoder + +import ( + "bytes" + "encoding/json" + "io" + "strconv" + "unsafe" + + "github.com/goccy/go-json/internal/errors" +) + +const ( + initBufSize = 512 +) + +type Stream struct { + buf []byte + bufSize int64 + length int64 + r io.Reader + offset int64 + cursor int64 + filledBuffer bool + allRead bool + UseNumber bool + DisallowUnknownFields bool + Option *Option +} + +func NewStream(r io.Reader) *Stream { + return &Stream{ + r: r, + bufSize: initBufSize, + buf: make([]byte, initBufSize), + Option: &Option{}, + } +} + +func (s *Stream) TotalOffset() int64 { + return s.totalOffset() +} + +func (s *Stream) Buffered() io.Reader { + buflen := int64(len(s.buf)) + for i := s.cursor; i < buflen; i++ { + if s.buf[i] == nul { + return bytes.NewReader(s.buf[s.cursor:i]) + } + } + return bytes.NewReader(s.buf[s.cursor:]) +} + +func (s *Stream) PrepareForDecode() error { + for { + switch s.char() { + case ' ', '\t', '\r', '\n': + s.cursor++ + continue + case ',', ':': + s.cursor++ + return nil + case nul: + if s.read() { + continue + } + return io.EOF + } + break + } + return nil +} + +func (s *Stream) totalOffset() int64 { + return s.offset + s.cursor +} + +func (s *Stream) char() byte { + return s.buf[s.cursor] +} + +func (s *Stream) equalChar(c byte) bool { + cur := s.buf[s.cursor] + if cur == nul { + s.read() + cur = s.buf[s.cursor] + } + return cur == c +} + +func (s *Stream) stat() ([]byte, int64, unsafe.Pointer) { + return s.buf, s.cursor, (*sliceHeader)(unsafe.Pointer(&s.buf)).data +} + +func (s *Stream) bufptr() unsafe.Pointer { + return (*sliceHeader)(unsafe.Pointer(&s.buf)).data +} + +func (s *Stream) statForRetry() ([]byte, int64, unsafe.Pointer) { + s.cursor-- // for retry ( because caller progress cursor position in each loop ) + return s.buf, s.cursor, (*sliceHeader)(unsafe.Pointer(&s.buf)).data +} + +func (s *Stream) Reset() { + s.reset() + s.bufSize = int64(len(s.buf)) +} + +func (s *Stream) More() bool { + for { + switch s.char() { + case ' ', '\n', '\r', '\t': + s.cursor++ + continue + case '}', ']': + return false + case nul: + if s.read() { + continue + } + return false + } + break + } + return true +} + +func (s *Stream) Token() (interface{}, error) { + for { + c := s.char() + switch c { + case ' ', '\n', '\r', '\t': + s.cursor++ + case '{', '[', ']', '}': + s.cursor++ + return json.Delim(c), nil + case ',', ':': + s.cursor++ + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + bytes := floatBytes(s) + str := *(*string)(unsafe.Pointer(&bytes)) + if s.UseNumber { + return json.Number(str), nil + } + f64, err := strconv.ParseFloat(str, 64) + if err != nil { + return nil, err + } + return f64, nil + case '"': + bytes, err := stringBytes(s) + if err != nil { + return nil, err + } + return string(bytes), nil + case 't': + if err := trueBytes(s); err != nil { + return nil, err + } + return true, nil + case 'f': + if err := falseBytes(s); err != nil { + return nil, err + } + return false, nil + case 'n': + if err := nullBytes(s); err != nil { + return nil, err + } + return nil, nil + case nul: + if s.read() { + continue + } + goto END + default: + return nil, errors.ErrInvalidCharacter(s.char(), "token", s.totalOffset()) + } + } +END: + return nil, io.EOF +} + +func (s *Stream) reset() { + s.offset += s.cursor + s.buf = s.buf[s.cursor:] + s.length -= s.cursor + s.cursor = 0 +} + +func (s *Stream) readBuf() []byte { + if s.filledBuffer { + s.bufSize *= 2 + remainBuf := s.buf + s.buf = make([]byte, s.bufSize) + copy(s.buf, remainBuf) + } + remainLen := s.length - s.cursor + remainNotNulCharNum := int64(0) + for i := int64(0); i < remainLen; i++ { + if s.buf[s.cursor+i] == nul { + break + } + remainNotNulCharNum++ + } + s.length = s.cursor + remainNotNulCharNum + return s.buf[s.cursor+remainNotNulCharNum:] +} + +func (s *Stream) read() bool { + if s.allRead { + return false + } + buf := s.readBuf() + last := len(buf) - 1 + buf[last] = nul + n, err := s.r.Read(buf[:last]) + s.length += int64(n) + if n == last { + s.filledBuffer = true + } else { + s.filledBuffer = false + } + if err == io.EOF { + s.allRead = true + } else if err != nil { + return false + } + return true +} + +func (s *Stream) skipWhiteSpace() byte { + p := s.bufptr() +LOOP: + c := char(p, s.cursor) + switch c { + case ' ', '\n', '\t', '\r': + s.cursor++ + goto LOOP + case nul: + if s.read() { + p = s.bufptr() + goto LOOP + } + } + return c +} + +func (s *Stream) skipObject(depth int64) error { + braceCount := 1 + _, cursor, p := s.stat() + for { + switch char(p, cursor) { + case '{': + braceCount++ + depth++ + if depth > maxDecodeNestingDepth { + return errors.ErrExceededMaxDepth(s.char(), s.cursor) + } + case '}': + braceCount-- + depth-- + if braceCount == 0 { + s.cursor = cursor + 1 + return nil + } + case '[': + depth++ + if depth > maxDecodeNestingDepth { + return errors.ErrExceededMaxDepth(s.char(), s.cursor) + } + case ']': + depth-- + case '"': + for { + cursor++ + switch char(p, cursor) { + case '\\': + cursor++ + if char(p, cursor) == nul { + s.cursor = cursor + if s.read() { + _, cursor, p = s.stat() + continue + } + return errors.ErrUnexpectedEndOfJSON("string of object", cursor) + } + case '"': + goto SWITCH_OUT + case nul: + s.cursor = cursor + if s.read() { + _, cursor, p = s.statForRetry() + continue + } + return errors.ErrUnexpectedEndOfJSON("string of object", cursor) + } + } + case nul: + s.cursor = cursor + if s.read() { + _, cursor, p = s.stat() + continue + } + return errors.ErrUnexpectedEndOfJSON("object of object", cursor) + } + SWITCH_OUT: + cursor++ + } +} + +func (s *Stream) skipArray(depth int64) error { + bracketCount := 1 + _, cursor, p := s.stat() + for { + switch char(p, cursor) { + case '[': + bracketCount++ + depth++ + if depth > maxDecodeNestingDepth { + return errors.ErrExceededMaxDepth(s.char(), s.cursor) + } + case ']': + bracketCount-- + depth-- + if bracketCount == 0 { + s.cursor = cursor + 1 + return nil + } + case '{': + depth++ + if depth > maxDecodeNestingDepth { + return errors.ErrExceededMaxDepth(s.char(), s.cursor) + } + case '}': + depth-- + case '"': + for { + cursor++ + switch char(p, cursor) { + case '\\': + cursor++ + if char(p, cursor) == nul { + s.cursor = cursor + if s.read() { + _, cursor, p = s.stat() + continue + } + return errors.ErrUnexpectedEndOfJSON("string of object", cursor) + } + case '"': + goto SWITCH_OUT + case nul: + s.cursor = cursor + if s.read() { + _, cursor, p = s.statForRetry() + continue + } + return errors.ErrUnexpectedEndOfJSON("string of object", cursor) + } + } + case nul: + s.cursor = cursor + if s.read() { + _, cursor, p = s.stat() + continue + } + return errors.ErrUnexpectedEndOfJSON("array of object", cursor) + } + SWITCH_OUT: + cursor++ + } +} + +func (s *Stream) skipValue(depth int64) error { + _, cursor, p := s.stat() + for { + switch char(p, cursor) { + case ' ', '\n', '\t', '\r': + cursor++ + continue + case nul: + s.cursor = cursor + if s.read() { + _, cursor, p = s.stat() + continue + } + return errors.ErrUnexpectedEndOfJSON("value of object", s.totalOffset()) + case '{': + s.cursor = cursor + 1 + return s.skipObject(depth + 1) + case '[': + s.cursor = cursor + 1 + return s.skipArray(depth + 1) + case '"': + for { + cursor++ + switch char(p, cursor) { + case '\\': + cursor++ + if char(p, cursor) == nul { + s.cursor = cursor + if s.read() { + _, cursor, p = s.stat() + continue + } + return errors.ErrUnexpectedEndOfJSON("value of string", s.totalOffset()) + } + case '"': + s.cursor = cursor + 1 + return nil + case nul: + s.cursor = cursor + if s.read() { + _, cursor, p = s.statForRetry() + continue + } + return errors.ErrUnexpectedEndOfJSON("value of string", s.totalOffset()) + } + } + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + for { + cursor++ + c := char(p, cursor) + if floatTable[c] { + continue + } else if c == nul { + if s.read() { + _, cursor, p = s.stat() + continue + } + } + s.cursor = cursor + return nil + } + case 't': + s.cursor = cursor + if err := trueBytes(s); err != nil { + return err + } + return nil + case 'f': + s.cursor = cursor + if err := falseBytes(s); err != nil { + return err + } + return nil + case 'n': + s.cursor = cursor + if err := nullBytes(s); err != nil { + return err + } + return nil + } + cursor++ + } +} + +func nullBytes(s *Stream) error { + // current cursor's character is 'n' + s.cursor++ + if s.char() != 'u' { + if err := retryReadNull(s); err != nil { + return err + } + } + s.cursor++ + if s.char() != 'l' { + if err := retryReadNull(s); err != nil { + return err + } + } + s.cursor++ + if s.char() != 'l' { + if err := retryReadNull(s); err != nil { + return err + } + } + s.cursor++ + return nil +} + +func retryReadNull(s *Stream) error { + if s.char() == nul && s.read() { + return nil + } + return errors.ErrInvalidCharacter(s.char(), "null", s.totalOffset()) +} + +func trueBytes(s *Stream) error { + // current cursor's character is 't' + s.cursor++ + if s.char() != 'r' { + if err := retryReadTrue(s); err != nil { + return err + } + } + s.cursor++ + if s.char() != 'u' { + if err := retryReadTrue(s); err != nil { + return err + } + } + s.cursor++ + if s.char() != 'e' { + if err := retryReadTrue(s); err != nil { + return err + } + } + s.cursor++ + return nil +} + +func retryReadTrue(s *Stream) error { + if s.char() == nul && s.read() { + return nil + } + return errors.ErrInvalidCharacter(s.char(), "bool(true)", s.totalOffset()) +} + +func falseBytes(s *Stream) error { + // current cursor's character is 'f' + s.cursor++ + if s.char() != 'a' { + if err := retryReadFalse(s); err != nil { + return err + } + } + s.cursor++ + if s.char() != 'l' { + if err := retryReadFalse(s); err != nil { + return err + } + } + s.cursor++ + if s.char() != 's' { + if err := retryReadFalse(s); err != nil { + return err + } + } + s.cursor++ + if s.char() != 'e' { + if err := retryReadFalse(s); err != nil { + return err + } + } + s.cursor++ + return nil +} + +func retryReadFalse(s *Stream) error { + if s.char() == nul && s.read() { + return nil + } + return errors.ErrInvalidCharacter(s.char(), "bool(false)", s.totalOffset()) +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/string.go b/vendor/github.com/goccy/go-json/internal/decoder/string.go new file mode 100644 index 000000000..d07ad7101 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/string.go @@ -0,0 +1,441 @@ +package decoder + +import ( + "bytes" + "fmt" + "reflect" + "unicode" + "unicode/utf16" + "unicode/utf8" + "unsafe" + + "github.com/goccy/go-json/internal/errors" +) + +type stringDecoder struct { + structName string + fieldName string +} + +func newStringDecoder(structName, fieldName string) *stringDecoder { + return &stringDecoder{ + structName: structName, + fieldName: fieldName, + } +} + +func (d *stringDecoder) errUnmarshalType(typeName string, offset int64) *errors.UnmarshalTypeError { + return &errors.UnmarshalTypeError{ + Value: typeName, + Type: reflect.TypeOf(""), + Offset: offset, + Struct: d.structName, + Field: d.fieldName, + } +} + +func (d *stringDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { + bytes, err := d.decodeStreamByte(s) + if err != nil { + return err + } + if bytes == nil { + return nil + } + **(**string)(unsafe.Pointer(&p)) = *(*string)(unsafe.Pointer(&bytes)) + s.reset() + return nil +} + +func (d *stringDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + bytes, c, err := d.decodeByte(ctx.Buf, cursor) + if err != nil { + return 0, err + } + if bytes == nil { + return c, nil + } + cursor = c + **(**string)(unsafe.Pointer(&p)) = *(*string)(unsafe.Pointer(&bytes)) + return cursor, nil +} + +var ( + hexToInt = [256]int{ + '0': 0, + '1': 1, + '2': 2, + '3': 3, + '4': 4, + '5': 5, + '6': 6, + '7': 7, + '8': 8, + '9': 9, + 'A': 10, + 'B': 11, + 'C': 12, + 'D': 13, + 'E': 14, + 'F': 15, + 'a': 10, + 'b': 11, + 'c': 12, + 'd': 13, + 'e': 14, + 'f': 15, + } +) + +func unicodeToRune(code []byte) rune { + var r rune + for i := 0; i < len(code); i++ { + r = r*16 + rune(hexToInt[code[i]]) + } + return r +} + +func readAtLeast(s *Stream, n int64, p *unsafe.Pointer) bool { + for s.cursor+n >= s.length { + if !s.read() { + return false + } + *p = s.bufptr() + } + return true +} + +func decodeUnicodeRune(s *Stream, p unsafe.Pointer) (rune, int64, unsafe.Pointer, error) { + const defaultOffset = 5 + const surrogateOffset = 11 + + if !readAtLeast(s, defaultOffset, &p) { + return rune(0), 0, nil, errors.ErrInvalidCharacter(s.char(), "escaped string", s.totalOffset()) + } + + r := unicodeToRune(s.buf[s.cursor+1 : s.cursor+defaultOffset]) + if utf16.IsSurrogate(r) { + if !readAtLeast(s, surrogateOffset, &p) { + return unicode.ReplacementChar, defaultOffset, p, nil + } + if s.buf[s.cursor+defaultOffset] != '\\' || s.buf[s.cursor+defaultOffset+1] != 'u' { + return unicode.ReplacementChar, defaultOffset, p, nil + } + r2 := unicodeToRune(s.buf[s.cursor+defaultOffset+2 : s.cursor+surrogateOffset]) + if r := utf16.DecodeRune(r, r2); r != unicode.ReplacementChar { + return r, surrogateOffset, p, nil + } + } + return r, defaultOffset, p, nil +} + +func decodeUnicode(s *Stream, p unsafe.Pointer) (unsafe.Pointer, error) { + const backSlashAndULen = 2 // length of \u + + r, offset, pp, err := decodeUnicodeRune(s, p) + if err != nil { + return nil, err + } + unicode := []byte(string(r)) + unicodeLen := int64(len(unicode)) + s.buf = append(append(s.buf[:s.cursor-1], unicode...), s.buf[s.cursor+offset:]...) + unicodeOrgLen := offset - 1 + s.length = s.length - (backSlashAndULen + (unicodeOrgLen - unicodeLen)) + s.cursor = s.cursor - backSlashAndULen + unicodeLen + return pp, nil +} + +func decodeEscapeString(s *Stream, p unsafe.Pointer) (unsafe.Pointer, error) { + s.cursor++ +RETRY: + switch s.buf[s.cursor] { + case '"': + s.buf[s.cursor] = '"' + case '\\': + s.buf[s.cursor] = '\\' + case '/': + s.buf[s.cursor] = '/' + case 'b': + s.buf[s.cursor] = '\b' + case 'f': + s.buf[s.cursor] = '\f' + case 'n': + s.buf[s.cursor] = '\n' + case 'r': + s.buf[s.cursor] = '\r' + case 't': + s.buf[s.cursor] = '\t' + case 'u': + return decodeUnicode(s, p) + case nul: + if !s.read() { + return nil, errors.ErrInvalidCharacter(s.char(), "escaped string", s.totalOffset()) + } + p = s.bufptr() + goto RETRY + default: + return nil, errors.ErrUnexpectedEndOfJSON("string", s.totalOffset()) + } + s.buf = append(s.buf[:s.cursor-1], s.buf[s.cursor:]...) + s.length-- + s.cursor-- + p = s.bufptr() + return p, nil +} + +var ( + runeErrBytes = []byte(string(utf8.RuneError)) + runeErrBytesLen = int64(len(runeErrBytes)) +) + +func stringBytes(s *Stream) ([]byte, error) { + _, cursor, p := s.stat() + cursor++ // skip double quote char + start := cursor + for { + switch char(p, cursor) { + case '\\': + s.cursor = cursor + pp, err := decodeEscapeString(s, p) + if err != nil { + return nil, err + } + p = pp + cursor = s.cursor + case '"': + literal := s.buf[start:cursor] + cursor++ + s.cursor = cursor + return literal, nil + case + // 0x00 is nul, 0x5c is '\\', 0x22 is '"' . + 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0A, 0x0B, 0x0C, 0x0D, 0x0E, 0x0F, // 0x00-0x0F + 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, 0x17, 0x18, 0x19, 0x1A, 0x1B, 0x1C, 0x1D, 0x1E, 0x1F, // 0x10-0x1F + 0x20, 0x21 /*0x22,*/, 0x23, 0x24, 0x25, 0x26, 0x27, 0x28, 0x29, 0x2A, 0x2B, 0x2C, 0x2D, 0x2E, 0x2F, // 0x20-0x2F + 0x30, 0x31, 0x32, 0x33, 0x34, 0x35, 0x36, 0x37, 0x38, 0x39, 0x3A, 0x3B, 0x3C, 0x3D, 0x3E, 0x3F, // 0x30-0x3F + 0x40, 0x41, 0x42, 0x43, 0x44, 0x45, 0x46, 0x47, 0x48, 0x49, 0x4A, 0x4B, 0x4C, 0x4D, 0x4E, 0x4F, // 0x40-0x4F + 0x50, 0x51, 0x52, 0x53, 0x54, 0x55, 0x56, 0x57, 0x58, 0x59, 0x5A, 0x5B /*0x5C,*/, 0x5D, 0x5E, 0x5F, // 0x50-0x5F + 0x60, 0x61, 0x62, 0x63, 0x64, 0x65, 0x66, 0x67, 0x68, 0x69, 0x6A, 0x6B, 0x6C, 0x6D, 0x6E, 0x6F, // 0x60-0x6F + 0x70, 0x71, 0x72, 0x73, 0x74, 0x75, 0x76, 0x77, 0x78, 0x79, 0x7A, 0x7B, 0x7C, 0x7D, 0x7E, 0x7F: // 0x70-0x7F + // character is ASCII. skip to next char + case + 0x80, 0x81, 0x82, 0x83, 0x84, 0x85, 0x86, 0x87, 0x88, 0x89, 0x8A, 0x8B, 0x8C, 0x8D, 0x8E, 0x8F, // 0x80-0x8F + 0x90, 0x91, 0x92, 0x93, 0x94, 0x95, 0x96, 0x97, 0x98, 0x99, 0x9A, 0x9B, 0x9C, 0x9D, 0x9E, 0x9F, // 0x90-0x9F + 0xA0, 0xA1, 0xA2, 0xA3, 0xA4, 0xA5, 0xA6, 0xA7, 0xA8, 0xA9, 0xAA, 0xAB, 0xAC, 0xAD, 0xAE, 0xAF, // 0xA0-0xAF + 0xB0, 0xB1, 0xB2, 0xB3, 0xB4, 0xB5, 0xB6, 0xB7, 0xB8, 0xB9, 0xBA, 0xBB, 0xBC, 0xBD, 0xBE, 0xBF, // 0xB0-0xBF + 0xC0, 0xC1, // 0xC0-0xC1 + 0xF5, 0xF6, 0xF7, 0xF8, 0xF9, 0xFA, 0xFB, 0xFC, 0xFD, 0xFE, 0xFF: // 0xF5-0xFE + // character is invalid + s.buf = append(append(append([]byte{}, s.buf[:cursor]...), runeErrBytes...), s.buf[cursor+1:]...) + _, _, p = s.stat() + cursor += runeErrBytesLen + s.length += runeErrBytesLen + continue + case nul: + s.cursor = cursor + if s.read() { + _, cursor, p = s.stat() + continue + } + goto ERROR + case 0xEF: + // RuneError is {0xEF, 0xBF, 0xBD} + if s.buf[cursor+1] == 0xBF && s.buf[cursor+2] == 0xBD { + // found RuneError: skip + cursor += 2 + break + } + fallthrough + default: + // multi bytes character + if !utf8.FullRune(s.buf[cursor : len(s.buf)-1]) { + s.cursor = cursor + if s.read() { + _, cursor, p = s.stat() + continue + } + goto ERROR + } + r, size := utf8.DecodeRune(s.buf[cursor:]) + if r == utf8.RuneError { + s.buf = append(append(append([]byte{}, s.buf[:cursor]...), runeErrBytes...), s.buf[cursor+1:]...) + cursor += runeErrBytesLen + s.length += runeErrBytesLen + _, _, p = s.stat() + } else { + cursor += int64(size) + } + continue + } + cursor++ + } +ERROR: + return nil, errors.ErrUnexpectedEndOfJSON("string", s.totalOffset()) +} + +func (d *stringDecoder) decodeStreamByte(s *Stream) ([]byte, error) { + for { + switch s.char() { + case ' ', '\n', '\t', '\r': + s.cursor++ + continue + case '[': + return nil, d.errUnmarshalType("array", s.totalOffset()) + case '{': + return nil, d.errUnmarshalType("object", s.totalOffset()) + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + return nil, d.errUnmarshalType("number", s.totalOffset()) + case '"': + return stringBytes(s) + case 'n': + if err := nullBytes(s); err != nil { + return nil, err + } + return nil, nil + case nul: + if s.read() { + continue + } + } + break + } + return nil, errors.ErrInvalidBeginningOfValue(s.char(), s.totalOffset()) +} + +func (d *stringDecoder) decodeByte(buf []byte, cursor int64) ([]byte, int64, error) { + for { + switch buf[cursor] { + case ' ', '\n', '\t', '\r': + cursor++ + case '[': + return nil, 0, d.errUnmarshalType("array", cursor) + case '{': + return nil, 0, d.errUnmarshalType("object", cursor) + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + return nil, 0, d.errUnmarshalType("number", cursor) + case '"': + cursor++ + start := cursor + b := (*sliceHeader)(unsafe.Pointer(&buf)).data + escaped := 0 + for { + switch char(b, cursor) { + case '\\': + escaped++ + cursor++ + switch char(b, cursor) { + case '"', '\\', '/', 'b', 'f', 'n', 'r', 't': + cursor++ + case 'u': + buflen := int64(len(buf)) + if cursor+5 >= buflen { + return nil, 0, errors.ErrUnexpectedEndOfJSON("escaped string", cursor) + } + for i := int64(1); i <= 4; i++ { + c := char(b, cursor+i) + if !(('0' <= c && c <= '9') || ('a' <= c && c <= 'f') || ('A' <= c && c <= 'F')) { + return nil, 0, errors.ErrSyntax(fmt.Sprintf("json: invalid character %c in \\u hexadecimal character escape", c), cursor+i) + } + } + cursor += 5 + default: + return nil, 0, errors.ErrUnexpectedEndOfJSON("escaped string", cursor) + } + continue + case '"': + literal := buf[start:cursor] + if escaped > 0 { + literal = literal[:unescapeString(literal)] + } + cursor++ + return literal, cursor, nil + case nul: + return nil, 0, errors.ErrUnexpectedEndOfJSON("string", cursor) + } + cursor++ + } + case 'n': + if err := validateNull(buf, cursor); err != nil { + return nil, 0, err + } + cursor += 4 + return nil, cursor, nil + default: + return nil, 0, errors.ErrInvalidBeginningOfValue(buf[cursor], cursor) + } + } +} + +var unescapeMap = [256]byte{ + '"': '"', + '\\': '\\', + '/': '/', + 'b': '\b', + 'f': '\f', + 'n': '\n', + 'r': '\r', + 't': '\t', +} + +func unsafeAdd(ptr unsafe.Pointer, offset int) unsafe.Pointer { + return unsafe.Pointer(uintptr(ptr) + uintptr(offset)) +} + +func unescapeString(buf []byte) int { + p := (*sliceHeader)(unsafe.Pointer(&buf)).data + end := unsafeAdd(p, len(buf)) + src := unsafeAdd(p, bytes.IndexByte(buf, '\\')) + dst := src + for src != end { + c := char(src, 0) + if c == '\\' { + escapeChar := char(src, 1) + if escapeChar != 'u' { + *(*byte)(dst) = unescapeMap[escapeChar] + src = unsafeAdd(src, 2) + dst = unsafeAdd(dst, 1) + } else { + v1 := hexToInt[char(src, 2)] + v2 := hexToInt[char(src, 3)] + v3 := hexToInt[char(src, 4)] + v4 := hexToInt[char(src, 5)] + code := rune((v1 << 12) | (v2 << 8) | (v3 << 4) | v4) + if code >= 0xd800 && code < 0xdc00 && uintptr(unsafeAdd(src, 11)) < uintptr(end) { + if char(src, 6) == '\\' && char(src, 7) == 'u' { + v1 := hexToInt[char(src, 8)] + v2 := hexToInt[char(src, 9)] + v3 := hexToInt[char(src, 10)] + v4 := hexToInt[char(src, 11)] + lo := rune((v1 << 12) | (v2 << 8) | (v3 << 4) | v4) + if lo >= 0xdc00 && lo < 0xe000 { + code = (code-0xd800)<<10 | (lo - 0xdc00) + 0x10000 + src = unsafeAdd(src, 6) + } + } + } + var b [utf8.UTFMax]byte + n := utf8.EncodeRune(b[:], code) + switch n { + case 4: + *(*byte)(unsafeAdd(dst, 3)) = b[3] + fallthrough + case 3: + *(*byte)(unsafeAdd(dst, 2)) = b[2] + fallthrough + case 2: + *(*byte)(unsafeAdd(dst, 1)) = b[1] + fallthrough + case 1: + *(*byte)(unsafeAdd(dst, 0)) = b[0] + } + src = unsafeAdd(src, 6) + dst = unsafeAdd(dst, n) + } + } else { + *(*byte)(dst) = c + src = unsafeAdd(src, 1) + dst = unsafeAdd(dst, 1) + } + } + return int(uintptr(dst) - uintptr(p)) +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/struct.go b/vendor/github.com/goccy/go-json/internal/decoder/struct.go new file mode 100644 index 000000000..2c6468045 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/struct.go @@ -0,0 +1,819 @@ +package decoder + +import ( + "fmt" + "math" + "math/bits" + "sort" + "strings" + "unicode" + "unicode/utf16" + "unsafe" + + "github.com/goccy/go-json/internal/errors" +) + +type structFieldSet struct { + dec Decoder + offset uintptr + isTaggedKey bool + fieldIdx int + key string + keyLen int64 + err error +} + +type structDecoder struct { + fieldMap map[string]*structFieldSet + fieldUniqueNameNum int + stringDecoder *stringDecoder + structName string + fieldName string + isTriedOptimize bool + keyBitmapUint8 [][256]uint8 + keyBitmapUint16 [][256]uint16 + sortedFieldSets []*structFieldSet + keyDecoder func(*structDecoder, []byte, int64) (int64, *structFieldSet, error) + keyStreamDecoder func(*structDecoder, *Stream) (*structFieldSet, string, error) +} + +var ( + largeToSmallTable [256]byte +) + +func init() { + for i := 0; i < 256; i++ { + c := i + if 'A' <= c && c <= 'Z' { + c += 'a' - 'A' + } + largeToSmallTable[i] = byte(c) + } +} + +func newStructDecoder(structName, fieldName string, fieldMap map[string]*structFieldSet) *structDecoder { + return &structDecoder{ + fieldMap: fieldMap, + stringDecoder: newStringDecoder(structName, fieldName), + structName: structName, + fieldName: fieldName, + keyDecoder: decodeKey, + keyStreamDecoder: decodeKeyStream, + } +} + +const ( + allowOptimizeMaxKeyLen = 64 + allowOptimizeMaxFieldLen = 16 +) + +func (d *structDecoder) tryOptimize() { + fieldUniqueNameMap := map[string]int{} + fieldIdx := -1 + for k, v := range d.fieldMap { + lower := strings.ToLower(k) + idx, exists := fieldUniqueNameMap[lower] + if exists { + v.fieldIdx = idx + } else { + fieldIdx++ + v.fieldIdx = fieldIdx + } + fieldUniqueNameMap[lower] = fieldIdx + } + d.fieldUniqueNameNum = len(fieldUniqueNameMap) + + if d.isTriedOptimize { + return + } + fieldMap := map[string]*structFieldSet{} + conflicted := map[string]struct{}{} + for k, v := range d.fieldMap { + key := strings.ToLower(k) + if key != k { + // already exists same key (e.g. Hello and HELLO has same lower case key + if _, exists := conflicted[key]; exists { + d.isTriedOptimize = true + return + } + conflicted[key] = struct{}{} + } + if field, exists := fieldMap[key]; exists { + if field != v { + d.isTriedOptimize = true + return + } + } + fieldMap[key] = v + } + + if len(fieldMap) > allowOptimizeMaxFieldLen { + d.isTriedOptimize = true + return + } + + var maxKeyLen int + sortedKeys := []string{} + for key := range fieldMap { + keyLen := len(key) + if keyLen > allowOptimizeMaxKeyLen { + d.isTriedOptimize = true + return + } + if maxKeyLen < keyLen { + maxKeyLen = keyLen + } + sortedKeys = append(sortedKeys, key) + } + sort.Strings(sortedKeys) + + // By allocating one extra capacity than `maxKeyLen`, + // it is possible to avoid the process of comparing the index of the key with the length of the bitmap each time. + bitmapLen := maxKeyLen + 1 + if len(sortedKeys) <= 8 { + keyBitmap := make([][256]uint8, bitmapLen) + for i, key := range sortedKeys { + for j := 0; j < len(key); j++ { + c := key[j] + keyBitmap[j][c] |= (1 << uint(i)) + } + d.sortedFieldSets = append(d.sortedFieldSets, fieldMap[key]) + } + d.keyBitmapUint8 = keyBitmap + d.keyDecoder = decodeKeyByBitmapUint8 + d.keyStreamDecoder = decodeKeyByBitmapUint8Stream + } else { + keyBitmap := make([][256]uint16, bitmapLen) + for i, key := range sortedKeys { + for j := 0; j < len(key); j++ { + c := key[j] + keyBitmap[j][c] |= (1 << uint(i)) + } + d.sortedFieldSets = append(d.sortedFieldSets, fieldMap[key]) + } + d.keyBitmapUint16 = keyBitmap + d.keyDecoder = decodeKeyByBitmapUint16 + d.keyStreamDecoder = decodeKeyByBitmapUint16Stream + } +} + +// decode from '\uXXXX' +func decodeKeyCharByUnicodeRune(buf []byte, cursor int64) ([]byte, int64) { + const defaultOffset = 4 + const surrogateOffset = 6 + + r := unicodeToRune(buf[cursor : cursor+defaultOffset]) + if utf16.IsSurrogate(r) { + cursor += defaultOffset + if cursor+surrogateOffset >= int64(len(buf)) || buf[cursor] != '\\' || buf[cursor+1] != 'u' { + return []byte(string(unicode.ReplacementChar)), cursor + defaultOffset - 1 + } + cursor += 2 + r2 := unicodeToRune(buf[cursor : cursor+defaultOffset]) + if r := utf16.DecodeRune(r, r2); r != unicode.ReplacementChar { + return []byte(string(r)), cursor + defaultOffset - 1 + } + } + return []byte(string(r)), cursor + defaultOffset - 1 +} + +func decodeKeyCharByEscapedChar(buf []byte, cursor int64) ([]byte, int64) { + c := buf[cursor] + cursor++ + switch c { + case '"': + return []byte{'"'}, cursor + case '\\': + return []byte{'\\'}, cursor + case '/': + return []byte{'/'}, cursor + case 'b': + return []byte{'\b'}, cursor + case 'f': + return []byte{'\f'}, cursor + case 'n': + return []byte{'\n'}, cursor + case 'r': + return []byte{'\r'}, cursor + case 't': + return []byte{'\t'}, cursor + case 'u': + return decodeKeyCharByUnicodeRune(buf, cursor) + } + return nil, cursor +} + +func decodeKeyByBitmapUint8(d *structDecoder, buf []byte, cursor int64) (int64, *structFieldSet, error) { + var ( + curBit uint8 = math.MaxUint8 + ) + b := (*sliceHeader)(unsafe.Pointer(&buf)).data + for { + switch char(b, cursor) { + case ' ', '\n', '\t', '\r': + cursor++ + case '"': + cursor++ + c := char(b, cursor) + switch c { + case '"': + cursor++ + return cursor, nil, nil + case nul: + return 0, nil, errors.ErrUnexpectedEndOfJSON("string", cursor) + } + keyIdx := 0 + bitmap := d.keyBitmapUint8 + start := cursor + for { + c := char(b, cursor) + switch c { + case '"': + fieldSetIndex := bits.TrailingZeros8(curBit) + field := d.sortedFieldSets[fieldSetIndex] + keyLen := cursor - start + cursor++ + if keyLen < field.keyLen { + // early match + return cursor, nil, nil + } + return cursor, field, nil + case nul: + return 0, nil, errors.ErrUnexpectedEndOfJSON("string", cursor) + case '\\': + cursor++ + chars, nextCursor := decodeKeyCharByEscapedChar(buf, cursor) + for _, c := range chars { + curBit &= bitmap[keyIdx][largeToSmallTable[c]] + if curBit == 0 { + return decodeKeyNotFound(b, cursor) + } + keyIdx++ + } + cursor = nextCursor + default: + curBit &= bitmap[keyIdx][largeToSmallTable[c]] + if curBit == 0 { + return decodeKeyNotFound(b, cursor) + } + keyIdx++ + } + cursor++ + } + default: + return cursor, nil, errors.ErrInvalidBeginningOfValue(char(b, cursor), cursor) + } + } +} + +func decodeKeyByBitmapUint16(d *structDecoder, buf []byte, cursor int64) (int64, *structFieldSet, error) { + var ( + curBit uint16 = math.MaxUint16 + ) + b := (*sliceHeader)(unsafe.Pointer(&buf)).data + for { + switch char(b, cursor) { + case ' ', '\n', '\t', '\r': + cursor++ + case '"': + cursor++ + c := char(b, cursor) + switch c { + case '"': + cursor++ + return cursor, nil, nil + case nul: + return 0, nil, errors.ErrUnexpectedEndOfJSON("string", cursor) + } + keyIdx := 0 + bitmap := d.keyBitmapUint16 + start := cursor + for { + c := char(b, cursor) + switch c { + case '"': + fieldSetIndex := bits.TrailingZeros16(curBit) + field := d.sortedFieldSets[fieldSetIndex] + keyLen := cursor - start + cursor++ + if keyLen < field.keyLen { + // early match + return cursor, nil, nil + } + return cursor, field, nil + case nul: + return 0, nil, errors.ErrUnexpectedEndOfJSON("string", cursor) + case '\\': + cursor++ + chars, nextCursor := decodeKeyCharByEscapedChar(buf, cursor) + for _, c := range chars { + curBit &= bitmap[keyIdx][largeToSmallTable[c]] + if curBit == 0 { + return decodeKeyNotFound(b, cursor) + } + keyIdx++ + } + cursor = nextCursor + default: + curBit &= bitmap[keyIdx][largeToSmallTable[c]] + if curBit == 0 { + return decodeKeyNotFound(b, cursor) + } + keyIdx++ + } + cursor++ + } + default: + return cursor, nil, errors.ErrInvalidBeginningOfValue(char(b, cursor), cursor) + } + } +} + +func decodeKeyNotFound(b unsafe.Pointer, cursor int64) (int64, *structFieldSet, error) { + for { + cursor++ + switch char(b, cursor) { + case '"': + cursor++ + return cursor, nil, nil + case '\\': + cursor++ + if char(b, cursor) == nul { + return 0, nil, errors.ErrUnexpectedEndOfJSON("string", cursor) + } + case nul: + return 0, nil, errors.ErrUnexpectedEndOfJSON("string", cursor) + } + } +} + +func decodeKey(d *structDecoder, buf []byte, cursor int64) (int64, *structFieldSet, error) { + key, c, err := d.stringDecoder.decodeByte(buf, cursor) + if err != nil { + return 0, nil, err + } + cursor = c + k := *(*string)(unsafe.Pointer(&key)) + field, exists := d.fieldMap[k] + if !exists { + return cursor, nil, nil + } + return cursor, field, nil +} + +func decodeKeyByBitmapUint8Stream(d *structDecoder, s *Stream) (*structFieldSet, string, error) { + var ( + curBit uint8 = math.MaxUint8 + ) + _, cursor, p := s.stat() + for { + switch char(p, cursor) { + case ' ', '\n', '\t', '\r': + cursor++ + case nul: + s.cursor = cursor + if s.read() { + _, cursor, p = s.stat() + continue + } + return nil, "", errors.ErrInvalidBeginningOfValue(char(p, cursor), s.totalOffset()) + case '"': + cursor++ + FIRST_CHAR: + start := cursor + switch char(p, cursor) { + case '"': + cursor++ + s.cursor = cursor + return nil, "", nil + case nul: + s.cursor = cursor + if s.read() { + _, cursor, p = s.stat() + goto FIRST_CHAR + } + return nil, "", errors.ErrUnexpectedEndOfJSON("string", s.totalOffset()) + } + keyIdx := 0 + bitmap := d.keyBitmapUint8 + for { + c := char(p, cursor) + switch c { + case '"': + fieldSetIndex := bits.TrailingZeros8(curBit) + field := d.sortedFieldSets[fieldSetIndex] + keyLen := cursor - start + cursor++ + s.cursor = cursor + if keyLen < field.keyLen { + // early match + return nil, field.key, nil + } + return field, field.key, nil + case nul: + s.cursor = cursor + if s.read() { + _, cursor, p = s.stat() + continue + } + return nil, "", errors.ErrUnexpectedEndOfJSON("string", s.totalOffset()) + case '\\': + s.cursor = cursor + 1 // skip '\' char + chars, err := decodeKeyCharByEscapeCharStream(s) + if err != nil { + return nil, "", err + } + cursor = s.cursor + for _, c := range chars { + curBit &= bitmap[keyIdx][largeToSmallTable[c]] + if curBit == 0 { + s.cursor = cursor + return decodeKeyNotFoundStream(s, start) + } + keyIdx++ + } + default: + curBit &= bitmap[keyIdx][largeToSmallTable[c]] + if curBit == 0 { + s.cursor = cursor + return decodeKeyNotFoundStream(s, start) + } + keyIdx++ + } + cursor++ + } + default: + return nil, "", errors.ErrInvalidBeginningOfValue(char(p, cursor), s.totalOffset()) + } + } +} + +func decodeKeyByBitmapUint16Stream(d *structDecoder, s *Stream) (*structFieldSet, string, error) { + var ( + curBit uint16 = math.MaxUint16 + ) + _, cursor, p := s.stat() + for { + switch char(p, cursor) { + case ' ', '\n', '\t', '\r': + cursor++ + case nul: + s.cursor = cursor + if s.read() { + _, cursor, p = s.stat() + continue + } + return nil, "", errors.ErrInvalidBeginningOfValue(char(p, cursor), s.totalOffset()) + case '"': + cursor++ + FIRST_CHAR: + start := cursor + switch char(p, cursor) { + case '"': + cursor++ + s.cursor = cursor + return nil, "", nil + case nul: + s.cursor = cursor + if s.read() { + _, cursor, p = s.stat() + goto FIRST_CHAR + } + return nil, "", errors.ErrUnexpectedEndOfJSON("string", s.totalOffset()) + } + keyIdx := 0 + bitmap := d.keyBitmapUint16 + for { + c := char(p, cursor) + switch c { + case '"': + fieldSetIndex := bits.TrailingZeros16(curBit) + field := d.sortedFieldSets[fieldSetIndex] + keyLen := cursor - start + cursor++ + s.cursor = cursor + if keyLen < field.keyLen { + // early match + return nil, field.key, nil + } + return field, field.key, nil + case nul: + s.cursor = cursor + if s.read() { + _, cursor, p = s.stat() + continue + } + return nil, "", errors.ErrUnexpectedEndOfJSON("string", s.totalOffset()) + case '\\': + s.cursor = cursor + 1 // skip '\' char + chars, err := decodeKeyCharByEscapeCharStream(s) + if err != nil { + return nil, "", err + } + cursor = s.cursor + for _, c := range chars { + curBit &= bitmap[keyIdx][largeToSmallTable[c]] + if curBit == 0 { + s.cursor = cursor + return decodeKeyNotFoundStream(s, start) + } + keyIdx++ + } + default: + curBit &= bitmap[keyIdx][largeToSmallTable[c]] + if curBit == 0 { + s.cursor = cursor + return decodeKeyNotFoundStream(s, start) + } + keyIdx++ + } + cursor++ + } + default: + return nil, "", errors.ErrInvalidBeginningOfValue(char(p, cursor), s.totalOffset()) + } + } +} + +// decode from '\uXXXX' +func decodeKeyCharByUnicodeRuneStream(s *Stream) ([]byte, error) { + const defaultOffset = 4 + const surrogateOffset = 6 + + if s.cursor+defaultOffset >= s.length { + if !s.read() { + return nil, errors.ErrInvalidCharacter(s.char(), "escaped unicode char", s.totalOffset()) + } + } + + r := unicodeToRune(s.buf[s.cursor : s.cursor+defaultOffset]) + if utf16.IsSurrogate(r) { + s.cursor += defaultOffset + if s.cursor+surrogateOffset >= s.length { + s.read() + } + if s.cursor+surrogateOffset >= s.length || s.buf[s.cursor] != '\\' || s.buf[s.cursor+1] != 'u' { + s.cursor += defaultOffset - 1 + return []byte(string(unicode.ReplacementChar)), nil + } + r2 := unicodeToRune(s.buf[s.cursor+defaultOffset+2 : s.cursor+surrogateOffset]) + if r := utf16.DecodeRune(r, r2); r != unicode.ReplacementChar { + s.cursor += defaultOffset - 1 + return []byte(string(r)), nil + } + } + s.cursor += defaultOffset - 1 + return []byte(string(r)), nil +} + +func decodeKeyCharByEscapeCharStream(s *Stream) ([]byte, error) { + c := s.buf[s.cursor] + s.cursor++ +RETRY: + switch c { + case '"': + return []byte{'"'}, nil + case '\\': + return []byte{'\\'}, nil + case '/': + return []byte{'/'}, nil + case 'b': + return []byte{'\b'}, nil + case 'f': + return []byte{'\f'}, nil + case 'n': + return []byte{'\n'}, nil + case 'r': + return []byte{'\r'}, nil + case 't': + return []byte{'\t'}, nil + case 'u': + return decodeKeyCharByUnicodeRuneStream(s) + case nul: + if !s.read() { + return nil, errors.ErrInvalidCharacter(s.char(), "escaped char", s.totalOffset()) + } + goto RETRY + default: + return nil, errors.ErrUnexpectedEndOfJSON("struct field", s.totalOffset()) + } +} + +func decodeKeyNotFoundStream(s *Stream, start int64) (*structFieldSet, string, error) { + buf, cursor, p := s.stat() + for { + cursor++ + switch char(p, cursor) { + case '"': + b := buf[start:cursor] + key := *(*string)(unsafe.Pointer(&b)) + cursor++ + s.cursor = cursor + return nil, key, nil + case '\\': + cursor++ + if char(p, cursor) == nul { + s.cursor = cursor + if !s.read() { + return nil, "", errors.ErrUnexpectedEndOfJSON("string", s.totalOffset()) + } + buf, cursor, p = s.statForRetry() + } + case nul: + s.cursor = cursor + if !s.read() { + return nil, "", errors.ErrUnexpectedEndOfJSON("string", s.totalOffset()) + } + buf, cursor, p = s.statForRetry() + } + } +} + +func decodeKeyStream(d *structDecoder, s *Stream) (*structFieldSet, string, error) { + key, err := d.stringDecoder.decodeStreamByte(s) + if err != nil { + return nil, "", err + } + k := *(*string)(unsafe.Pointer(&key)) + return d.fieldMap[k], k, nil +} + +func (d *structDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { + depth++ + if depth > maxDecodeNestingDepth { + return errors.ErrExceededMaxDepth(s.char(), s.cursor) + } + + c := s.skipWhiteSpace() + switch c { + case 'n': + if err := nullBytes(s); err != nil { + return err + } + return nil + default: + if s.char() != '{' { + return errors.ErrInvalidBeginningOfValue(s.char(), s.totalOffset()) + } + } + s.cursor++ + if s.skipWhiteSpace() == '}' { + s.cursor++ + return nil + } + var ( + seenFields map[int]struct{} + seenFieldNum int + ) + firstWin := (s.Option.Flags & FirstWinOption) != 0 + if firstWin { + seenFields = make(map[int]struct{}, d.fieldUniqueNameNum) + } + for { + s.reset() + field, key, err := d.keyStreamDecoder(d, s) + if err != nil { + return err + } + if s.skipWhiteSpace() != ':' { + return errors.ErrExpected("colon after object key", s.totalOffset()) + } + s.cursor++ + if field != nil { + if field.err != nil { + return field.err + } + if firstWin { + if _, exists := seenFields[field.fieldIdx]; exists { + if err := s.skipValue(depth); err != nil { + return err + } + } else { + if err := field.dec.DecodeStream(s, depth, unsafe.Pointer(uintptr(p)+field.offset)); err != nil { + return err + } + seenFieldNum++ + if d.fieldUniqueNameNum <= seenFieldNum { + return s.skipObject(depth) + } + seenFields[field.fieldIdx] = struct{}{} + } + } else { + if err := field.dec.DecodeStream(s, depth, unsafe.Pointer(uintptr(p)+field.offset)); err != nil { + return err + } + } + } else if s.DisallowUnknownFields { + return fmt.Errorf("json: unknown field %q", key) + } else { + if err := s.skipValue(depth); err != nil { + return err + } + } + c := s.skipWhiteSpace() + if c == '}' { + s.cursor++ + return nil + } + if c != ',' { + return errors.ErrExpected("comma after object element", s.totalOffset()) + } + s.cursor++ + } +} + +func (d *structDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + buf := ctx.Buf + depth++ + if depth > maxDecodeNestingDepth { + return 0, errors.ErrExceededMaxDepth(buf[cursor], cursor) + } + buflen := int64(len(buf)) + cursor = skipWhiteSpace(buf, cursor) + b := (*sliceHeader)(unsafe.Pointer(&buf)).data + switch char(b, cursor) { + case 'n': + if err := validateNull(buf, cursor); err != nil { + return 0, err + } + cursor += 4 + return cursor, nil + case '{': + default: + return 0, errors.ErrInvalidBeginningOfValue(char(b, cursor), cursor) + } + cursor++ + cursor = skipWhiteSpace(buf, cursor) + if buf[cursor] == '}' { + cursor++ + return cursor, nil + } + var ( + seenFields map[int]struct{} + seenFieldNum int + ) + firstWin := (ctx.Option.Flags & FirstWinOption) != 0 + if firstWin { + seenFields = make(map[int]struct{}, d.fieldUniqueNameNum) + } + for { + c, field, err := d.keyDecoder(d, buf, cursor) + if err != nil { + return 0, err + } + cursor = skipWhiteSpace(buf, c) + if char(b, cursor) != ':' { + return 0, errors.ErrExpected("colon after object key", cursor) + } + cursor++ + if cursor >= buflen { + return 0, errors.ErrExpected("object value after colon", cursor) + } + if field != nil { + if field.err != nil { + return 0, field.err + } + if firstWin { + if _, exists := seenFields[field.fieldIdx]; exists { + c, err := skipValue(buf, cursor, depth) + if err != nil { + return 0, err + } + cursor = c + } else { + c, err := field.dec.Decode(ctx, cursor, depth, unsafe.Pointer(uintptr(p)+field.offset)) + if err != nil { + return 0, err + } + cursor = c + seenFieldNum++ + if d.fieldUniqueNameNum <= seenFieldNum { + return skipObject(buf, cursor, depth) + } + seenFields[field.fieldIdx] = struct{}{} + } + } else { + c, err := field.dec.Decode(ctx, cursor, depth, unsafe.Pointer(uintptr(p)+field.offset)) + if err != nil { + return 0, err + } + cursor = c + } + } else { + c, err := skipValue(buf, cursor, depth) + if err != nil { + return 0, err + } + cursor = c + } + cursor = skipWhiteSpace(buf, cursor) + if char(b, cursor) == '}' { + cursor++ + return cursor, nil + } + if char(b, cursor) != ',' { + return 0, errors.ErrExpected("comma after object element", cursor) + } + cursor++ + } +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/type.go b/vendor/github.com/goccy/go-json/internal/decoder/type.go new file mode 100644 index 000000000..70e9907c8 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/type.go @@ -0,0 +1,29 @@ +package decoder + +import ( + "context" + "encoding" + "encoding/json" + "reflect" + "unsafe" +) + +type Decoder interface { + Decode(*RuntimeContext, int64, int64, unsafe.Pointer) (int64, error) + DecodeStream(*Stream, int64, unsafe.Pointer) error +} + +const ( + nul = '\000' + maxDecodeNestingDepth = 10000 +) + +type unmarshalerContext interface { + UnmarshalJSON(context.Context, []byte) error +} + +var ( + unmarshalJSONType = reflect.TypeOf((*json.Unmarshaler)(nil)).Elem() + unmarshalJSONContextType = reflect.TypeOf((*unmarshalerContext)(nil)).Elem() + unmarshalTextType = reflect.TypeOf((*encoding.TextUnmarshaler)(nil)).Elem() +) diff --git a/vendor/github.com/goccy/go-json/internal/decoder/uint.go b/vendor/github.com/goccy/go-json/internal/decoder/uint.go new file mode 100644 index 000000000..a62c51492 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/uint.go @@ -0,0 +1,190 @@ +package decoder + +import ( + "fmt" + "reflect" + "unsafe" + + "github.com/goccy/go-json/internal/errors" + "github.com/goccy/go-json/internal/runtime" +) + +type uintDecoder struct { + typ *runtime.Type + kind reflect.Kind + op func(unsafe.Pointer, uint64) + structName string + fieldName string +} + +func newUintDecoder(typ *runtime.Type, structName, fieldName string, op func(unsafe.Pointer, uint64)) *uintDecoder { + return &uintDecoder{ + typ: typ, + kind: typ.Kind(), + op: op, + structName: structName, + fieldName: fieldName, + } +} + +func (d *uintDecoder) typeError(buf []byte, offset int64) *errors.UnmarshalTypeError { + return &errors.UnmarshalTypeError{ + Value: fmt.Sprintf("number %s", string(buf)), + Type: runtime.RType2Type(d.typ), + Offset: offset, + } +} + +var ( + pow10u64 = [...]uint64{ + 1e00, 1e01, 1e02, 1e03, 1e04, 1e05, 1e06, 1e07, 1e08, 1e09, + 1e10, 1e11, 1e12, 1e13, 1e14, 1e15, 1e16, 1e17, 1e18, 1e19, + } + pow10u64Len = len(pow10u64) +) + +func (d *uintDecoder) parseUint(b []byte) (uint64, error) { + maxDigit := len(b) + if maxDigit > pow10u64Len { + return 0, fmt.Errorf("invalid length of number") + } + sum := uint64(0) + for i := 0; i < maxDigit; i++ { + c := uint64(b[i]) - 48 + digitValue := pow10u64[maxDigit-i-1] + sum += c * digitValue + } + return sum, nil +} + +func (d *uintDecoder) decodeStreamByte(s *Stream) ([]byte, error) { + for { + switch s.char() { + case ' ', '\n', '\t', '\r': + s.cursor++ + continue + case '0': + s.cursor++ + return numZeroBuf, nil + case '1', '2', '3', '4', '5', '6', '7', '8', '9': + start := s.cursor + for { + s.cursor++ + if numTable[s.char()] { + continue + } else if s.char() == nul { + if s.read() { + s.cursor-- // for retry current character + continue + } + } + break + } + num := s.buf[start:s.cursor] + return num, nil + case 'n': + if err := nullBytes(s); err != nil { + return nil, err + } + return nil, nil + case nul: + if s.read() { + continue + } + default: + return nil, d.typeError([]byte{s.char()}, s.totalOffset()) + } + break + } + return nil, errors.ErrUnexpectedEndOfJSON("number(unsigned integer)", s.totalOffset()) +} + +func (d *uintDecoder) decodeByte(buf []byte, cursor int64) ([]byte, int64, error) { + for { + switch buf[cursor] { + case ' ', '\n', '\t', '\r': + cursor++ + continue + case '0': + cursor++ + return numZeroBuf, cursor, nil + case '1', '2', '3', '4', '5', '6', '7', '8', '9': + start := cursor + cursor++ + for numTable[buf[cursor]] { + cursor++ + } + num := buf[start:cursor] + return num, cursor, nil + case 'n': + if err := validateNull(buf, cursor); err != nil { + return nil, 0, err + } + cursor += 4 + return nil, cursor, nil + default: + return nil, 0, d.typeError([]byte{buf[cursor]}, cursor) + } + } +} + +func (d *uintDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { + bytes, err := d.decodeStreamByte(s) + if err != nil { + return err + } + if bytes == nil { + return nil + } + u64, err := d.parseUint(bytes) + if err != nil { + return d.typeError(bytes, s.totalOffset()) + } + switch d.kind { + case reflect.Uint8: + if (1 << 8) <= u64 { + return d.typeError(bytes, s.totalOffset()) + } + case reflect.Uint16: + if (1 << 16) <= u64 { + return d.typeError(bytes, s.totalOffset()) + } + case reflect.Uint32: + if (1 << 32) <= u64 { + return d.typeError(bytes, s.totalOffset()) + } + } + d.op(p, u64) + return nil +} + +func (d *uintDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + bytes, c, err := d.decodeByte(ctx.Buf, cursor) + if err != nil { + return 0, err + } + if bytes == nil { + return c, nil + } + cursor = c + u64, err := d.parseUint(bytes) + if err != nil { + return 0, d.typeError(bytes, cursor) + } + switch d.kind { + case reflect.Uint8: + if (1 << 8) <= u64 { + return 0, d.typeError(bytes, cursor) + } + case reflect.Uint16: + if (1 << 16) <= u64 { + return 0, d.typeError(bytes, cursor) + } + case reflect.Uint32: + if (1 << 32) <= u64 { + return 0, d.typeError(bytes, cursor) + } + } + d.op(p, u64) + return cursor, nil +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/unmarshal_json.go b/vendor/github.com/goccy/go-json/internal/decoder/unmarshal_json.go new file mode 100644 index 000000000..e9b25c68f --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/unmarshal_json.go @@ -0,0 +1,99 @@ +package decoder + +import ( + "context" + "encoding/json" + "unsafe" + + "github.com/goccy/go-json/internal/errors" + "github.com/goccy/go-json/internal/runtime" +) + +type unmarshalJSONDecoder struct { + typ *runtime.Type + structName string + fieldName string +} + +func newUnmarshalJSONDecoder(typ *runtime.Type, structName, fieldName string) *unmarshalJSONDecoder { + return &unmarshalJSONDecoder{ + typ: typ, + structName: structName, + fieldName: fieldName, + } +} + +func (d *unmarshalJSONDecoder) annotateError(cursor int64, err error) { + switch e := err.(type) { + case *errors.UnmarshalTypeError: + e.Struct = d.structName + e.Field = d.fieldName + case *errors.SyntaxError: + e.Offset = cursor + } +} + +func (d *unmarshalJSONDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { + s.skipWhiteSpace() + start := s.cursor + if err := s.skipValue(depth); err != nil { + return err + } + src := s.buf[start:s.cursor] + dst := make([]byte, len(src)) + copy(dst, src) + + v := *(*interface{})(unsafe.Pointer(&emptyInterface{ + typ: d.typ, + ptr: p, + })) + switch v := v.(type) { + case unmarshalerContext: + var ctx context.Context + if (s.Option.Flags & ContextOption) != 0 { + ctx = s.Option.Context + } else { + ctx = context.Background() + } + if err := v.UnmarshalJSON(ctx, dst); err != nil { + d.annotateError(s.cursor, err) + return err + } + case json.Unmarshaler: + if err := v.UnmarshalJSON(dst); err != nil { + d.annotateError(s.cursor, err) + return err + } + } + return nil +} + +func (d *unmarshalJSONDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + buf := ctx.Buf + cursor = skipWhiteSpace(buf, cursor) + start := cursor + end, err := skipValue(buf, cursor, depth) + if err != nil { + return 0, err + } + src := buf[start:end] + dst := make([]byte, len(src)) + copy(dst, src) + + v := *(*interface{})(unsafe.Pointer(&emptyInterface{ + typ: d.typ, + ptr: p, + })) + if (ctx.Option.Flags & ContextOption) != 0 { + if err := v.(unmarshalerContext).UnmarshalJSON(ctx.Option.Context, dst); err != nil { + d.annotateError(cursor, err) + return 0, err + } + } else { + if err := v.(json.Unmarshaler).UnmarshalJSON(dst); err != nil { + d.annotateError(cursor, err) + return 0, err + } + } + return end, nil +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/unmarshal_text.go b/vendor/github.com/goccy/go-json/internal/decoder/unmarshal_text.go new file mode 100644 index 000000000..1ef287782 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/unmarshal_text.go @@ -0,0 +1,280 @@ +package decoder + +import ( + "bytes" + "encoding" + "unicode" + "unicode/utf16" + "unicode/utf8" + "unsafe" + + "github.com/goccy/go-json/internal/errors" + "github.com/goccy/go-json/internal/runtime" +) + +type unmarshalTextDecoder struct { + typ *runtime.Type + structName string + fieldName string +} + +func newUnmarshalTextDecoder(typ *runtime.Type, structName, fieldName string) *unmarshalTextDecoder { + return &unmarshalTextDecoder{ + typ: typ, + structName: structName, + fieldName: fieldName, + } +} + +func (d *unmarshalTextDecoder) annotateError(cursor int64, err error) { + switch e := err.(type) { + case *errors.UnmarshalTypeError: + e.Struct = d.structName + e.Field = d.fieldName + case *errors.SyntaxError: + e.Offset = cursor + } +} + +var ( + nullbytes = []byte(`null`) +) + +func (d *unmarshalTextDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { + s.skipWhiteSpace() + start := s.cursor + if err := s.skipValue(depth); err != nil { + return err + } + src := s.buf[start:s.cursor] + if len(src) > 0 { + switch src[0] { + case '[': + return &errors.UnmarshalTypeError{ + Value: "array", + Type: runtime.RType2Type(d.typ), + Offset: s.totalOffset(), + } + case '{': + return &errors.UnmarshalTypeError{ + Value: "object", + Type: runtime.RType2Type(d.typ), + Offset: s.totalOffset(), + } + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + return &errors.UnmarshalTypeError{ + Value: "number", + Type: runtime.RType2Type(d.typ), + Offset: s.totalOffset(), + } + case 'n': + if bytes.Equal(src, nullbytes) { + *(*unsafe.Pointer)(p) = nil + return nil + } + } + } + dst := make([]byte, len(src)) + copy(dst, src) + + if b, ok := unquoteBytes(dst); ok { + dst = b + } + v := *(*interface{})(unsafe.Pointer(&emptyInterface{ + typ: d.typ, + ptr: p, + })) + if err := v.(encoding.TextUnmarshaler).UnmarshalText(dst); err != nil { + d.annotateError(s.cursor, err) + return err + } + return nil +} + +func (d *unmarshalTextDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + buf := ctx.Buf + cursor = skipWhiteSpace(buf, cursor) + start := cursor + end, err := skipValue(buf, cursor, depth) + if err != nil { + return 0, err + } + src := buf[start:end] + if len(src) > 0 { + switch src[0] { + case '[': + return 0, &errors.UnmarshalTypeError{ + Value: "array", + Type: runtime.RType2Type(d.typ), + Offset: start, + } + case '{': + return 0, &errors.UnmarshalTypeError{ + Value: "object", + Type: runtime.RType2Type(d.typ), + Offset: start, + } + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + return 0, &errors.UnmarshalTypeError{ + Value: "number", + Type: runtime.RType2Type(d.typ), + Offset: start, + } + case 'n': + if bytes.Equal(src, nullbytes) { + *(*unsafe.Pointer)(p) = nil + return end, nil + } + } + } + + if s, ok := unquoteBytes(src); ok { + src = s + } + v := *(*interface{})(unsafe.Pointer(&emptyInterface{ + typ: d.typ, + ptr: *(*unsafe.Pointer)(unsafe.Pointer(&p)), + })) + if err := v.(encoding.TextUnmarshaler).UnmarshalText(src); err != nil { + d.annotateError(cursor, err) + return 0, err + } + return end, nil +} + +func unquoteBytes(s []byte) (t []byte, ok bool) { + length := len(s) + if length < 2 || s[0] != '"' || s[length-1] != '"' { + return + } + s = s[1 : length-1] + length -= 2 + + // Check for unusual characters. If there are none, + // then no unquoting is needed, so return a slice of the + // original bytes. + r := 0 + for r < length { + c := s[r] + if c == '\\' || c == '"' || c < ' ' { + break + } + if c < utf8.RuneSelf { + r++ + continue + } + rr, size := utf8.DecodeRune(s[r:]) + if rr == utf8.RuneError && size == 1 { + break + } + r += size + } + if r == length { + return s, true + } + + b := make([]byte, length+2*utf8.UTFMax) + w := copy(b, s[0:r]) + for r < length { + // Out of room? Can only happen if s is full of + // malformed UTF-8 and we're replacing each + // byte with RuneError. + if w >= len(b)-2*utf8.UTFMax { + nb := make([]byte, (len(b)+utf8.UTFMax)*2) + copy(nb, b[0:w]) + b = nb + } + switch c := s[r]; { + case c == '\\': + r++ + if r >= length { + return + } + switch s[r] { + default: + return + case '"', '\\', '/', '\'': + b[w] = s[r] + r++ + w++ + case 'b': + b[w] = '\b' + r++ + w++ + case 'f': + b[w] = '\f' + r++ + w++ + case 'n': + b[w] = '\n' + r++ + w++ + case 'r': + b[w] = '\r' + r++ + w++ + case 't': + b[w] = '\t' + r++ + w++ + case 'u': + r-- + rr := getu4(s[r:]) + if rr < 0 { + return + } + r += 6 + if utf16.IsSurrogate(rr) { + rr1 := getu4(s[r:]) + if dec := utf16.DecodeRune(rr, rr1); dec != unicode.ReplacementChar { + // A valid pair; consume. + r += 6 + w += utf8.EncodeRune(b[w:], dec) + break + } + // Invalid surrogate; fall back to replacement rune. + rr = unicode.ReplacementChar + } + w += utf8.EncodeRune(b[w:], rr) + } + + // Quote, control characters are invalid. + case c == '"', c < ' ': + return + + // ASCII + case c < utf8.RuneSelf: + b[w] = c + r++ + w++ + + // Coerce to well-formed UTF-8. + default: + rr, size := utf8.DecodeRune(s[r:]) + r += size + w += utf8.EncodeRune(b[w:], rr) + } + } + return b[0:w], true +} + +func getu4(s []byte) rune { + if len(s) < 6 || s[0] != '\\' || s[1] != 'u' { + return -1 + } + var r rune + for _, c := range s[2:6] { + switch { + case '0' <= c && c <= '9': + c = c - '0' + case 'a' <= c && c <= 'f': + c = c - 'a' + 10 + case 'A' <= c && c <= 'F': + c = c - 'A' + 10 + default: + return -1 + } + r = r*16 + rune(c) + } + return r +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/wrapped_string.go b/vendor/github.com/goccy/go-json/internal/decoder/wrapped_string.go new file mode 100644 index 000000000..66227ae02 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/decoder/wrapped_string.go @@ -0,0 +1,68 @@ +package decoder + +import ( + "reflect" + "unsafe" + + "github.com/goccy/go-json/internal/runtime" +) + +type wrappedStringDecoder struct { + typ *runtime.Type + dec Decoder + stringDecoder *stringDecoder + structName string + fieldName string + isPtrType bool +} + +func newWrappedStringDecoder(typ *runtime.Type, dec Decoder, structName, fieldName string) *wrappedStringDecoder { + return &wrappedStringDecoder{ + typ: typ, + dec: dec, + stringDecoder: newStringDecoder(structName, fieldName), + structName: structName, + fieldName: fieldName, + isPtrType: typ.Kind() == reflect.Ptr, + } +} + +func (d *wrappedStringDecoder) DecodeStream(s *Stream, depth int64, p unsafe.Pointer) error { + bytes, err := d.stringDecoder.decodeStreamByte(s) + if err != nil { + return err + } + if bytes == nil { + if d.isPtrType { + *(*unsafe.Pointer)(p) = nil + } + return nil + } + b := make([]byte, len(bytes)+1) + copy(b, bytes) + if _, err := d.dec.Decode(&RuntimeContext{Buf: b}, 0, depth, p); err != nil { + return err + } + return nil +} + +func (d *wrappedStringDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.Pointer) (int64, error) { + bytes, c, err := d.stringDecoder.decodeByte(ctx.Buf, cursor) + if err != nil { + return 0, err + } + if bytes == nil { + if d.isPtrType { + *(*unsafe.Pointer)(p) = nil + } + return c, nil + } + bytes = append(bytes, nul) + oldBuf := ctx.Buf + ctx.Buf = bytes + if _, err := d.dec.Decode(ctx, 0, depth, p); err != nil { + return 0, err + } + ctx.Buf = oldBuf + return c, nil +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/code.go b/vendor/github.com/goccy/go-json/internal/encoder/code.go new file mode 100644 index 000000000..8d62a9cd5 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/code.go @@ -0,0 +1,1017 @@ +package encoder + +import ( + "fmt" + "reflect" + "unsafe" + + "github.com/goccy/go-json/internal/runtime" +) + +type Code interface { + Kind() CodeKind + ToOpcode(*compileContext) Opcodes + Filter(*FieldQuery) Code +} + +type AnonymousCode interface { + ToAnonymousOpcode(*compileContext) Opcodes +} + +type Opcodes []*Opcode + +func (o Opcodes) First() *Opcode { + if len(o) == 0 { + return nil + } + return o[0] +} + +func (o Opcodes) Last() *Opcode { + if len(o) == 0 { + return nil + } + return o[len(o)-1] +} + +func (o Opcodes) Add(codes ...*Opcode) Opcodes { + return append(o, codes...) +} + +type CodeKind int + +const ( + CodeKindInterface CodeKind = iota + CodeKindPtr + CodeKindInt + CodeKindUint + CodeKindFloat + CodeKindString + CodeKindBool + CodeKindStruct + CodeKindMap + CodeKindSlice + CodeKindArray + CodeKindBytes + CodeKindMarshalJSON + CodeKindMarshalText + CodeKindRecursive +) + +type IntCode struct { + typ *runtime.Type + bitSize uint8 + isString bool + isPtr bool +} + +func (c *IntCode) Kind() CodeKind { + return CodeKindInt +} + +func (c *IntCode) ToOpcode(ctx *compileContext) Opcodes { + var code *Opcode + switch { + case c.isPtr: + code = newOpCode(ctx, c.typ, OpIntPtr) + case c.isString: + code = newOpCode(ctx, c.typ, OpIntString) + default: + code = newOpCode(ctx, c.typ, OpInt) + } + code.NumBitSize = c.bitSize + ctx.incIndex() + return Opcodes{code} +} + +func (c *IntCode) Filter(_ *FieldQuery) Code { + return c +} + +type UintCode struct { + typ *runtime.Type + bitSize uint8 + isString bool + isPtr bool +} + +func (c *UintCode) Kind() CodeKind { + return CodeKindUint +} + +func (c *UintCode) ToOpcode(ctx *compileContext) Opcodes { + var code *Opcode + switch { + case c.isPtr: + code = newOpCode(ctx, c.typ, OpUintPtr) + case c.isString: + code = newOpCode(ctx, c.typ, OpUintString) + default: + code = newOpCode(ctx, c.typ, OpUint) + } + code.NumBitSize = c.bitSize + ctx.incIndex() + return Opcodes{code} +} + +func (c *UintCode) Filter(_ *FieldQuery) Code { + return c +} + +type FloatCode struct { + typ *runtime.Type + bitSize uint8 + isPtr bool +} + +func (c *FloatCode) Kind() CodeKind { + return CodeKindFloat +} + +func (c *FloatCode) ToOpcode(ctx *compileContext) Opcodes { + var code *Opcode + switch { + case c.isPtr: + switch c.bitSize { + case 32: + code = newOpCode(ctx, c.typ, OpFloat32Ptr) + default: + code = newOpCode(ctx, c.typ, OpFloat64Ptr) + } + default: + switch c.bitSize { + case 32: + code = newOpCode(ctx, c.typ, OpFloat32) + default: + code = newOpCode(ctx, c.typ, OpFloat64) + } + } + ctx.incIndex() + return Opcodes{code} +} + +func (c *FloatCode) Filter(_ *FieldQuery) Code { + return c +} + +type StringCode struct { + typ *runtime.Type + isPtr bool +} + +func (c *StringCode) Kind() CodeKind { + return CodeKindString +} + +func (c *StringCode) ToOpcode(ctx *compileContext) Opcodes { + isJSONNumberType := c.typ == runtime.Type2RType(jsonNumberType) + var code *Opcode + if c.isPtr { + if isJSONNumberType { + code = newOpCode(ctx, c.typ, OpNumberPtr) + } else { + code = newOpCode(ctx, c.typ, OpStringPtr) + } + } else { + if isJSONNumberType { + code = newOpCode(ctx, c.typ, OpNumber) + } else { + code = newOpCode(ctx, c.typ, OpString) + } + } + ctx.incIndex() + return Opcodes{code} +} + +func (c *StringCode) Filter(_ *FieldQuery) Code { + return c +} + +type BoolCode struct { + typ *runtime.Type + isPtr bool +} + +func (c *BoolCode) Kind() CodeKind { + return CodeKindBool +} + +func (c *BoolCode) ToOpcode(ctx *compileContext) Opcodes { + var code *Opcode + switch { + case c.isPtr: + code = newOpCode(ctx, c.typ, OpBoolPtr) + default: + code = newOpCode(ctx, c.typ, OpBool) + } + ctx.incIndex() + return Opcodes{code} +} + +func (c *BoolCode) Filter(_ *FieldQuery) Code { + return c +} + +type BytesCode struct { + typ *runtime.Type + isPtr bool +} + +func (c *BytesCode) Kind() CodeKind { + return CodeKindBytes +} + +func (c *BytesCode) ToOpcode(ctx *compileContext) Opcodes { + var code *Opcode + switch { + case c.isPtr: + code = newOpCode(ctx, c.typ, OpBytesPtr) + default: + code = newOpCode(ctx, c.typ, OpBytes) + } + ctx.incIndex() + return Opcodes{code} +} + +func (c *BytesCode) Filter(_ *FieldQuery) Code { + return c +} + +type SliceCode struct { + typ *runtime.Type + value Code +} + +func (c *SliceCode) Kind() CodeKind { + return CodeKindSlice +} + +func (c *SliceCode) ToOpcode(ctx *compileContext) Opcodes { + // header => opcode => elem => end + // ^ | + // |________| + size := c.typ.Elem().Size() + header := newSliceHeaderCode(ctx, c.typ) + ctx.incIndex() + + ctx.incIndent() + codes := c.value.ToOpcode(ctx) + ctx.decIndent() + + codes.First().Flags |= IndirectFlags + elemCode := newSliceElemCode(ctx, c.typ.Elem(), header, size) + ctx.incIndex() + end := newOpCode(ctx, c.typ, OpSliceEnd) + ctx.incIndex() + header.End = end + header.Next = codes.First() + codes.Last().Next = elemCode + elemCode.Next = codes.First() + elemCode.End = end + return Opcodes{header}.Add(codes...).Add(elemCode).Add(end) +} + +func (c *SliceCode) Filter(_ *FieldQuery) Code { + return c +} + +type ArrayCode struct { + typ *runtime.Type + value Code +} + +func (c *ArrayCode) Kind() CodeKind { + return CodeKindArray +} + +func (c *ArrayCode) ToOpcode(ctx *compileContext) Opcodes { + // header => opcode => elem => end + // ^ | + // |________| + elem := c.typ.Elem() + alen := c.typ.Len() + size := elem.Size() + + header := newArrayHeaderCode(ctx, c.typ, alen) + ctx.incIndex() + + ctx.incIndent() + codes := c.value.ToOpcode(ctx) + ctx.decIndent() + + codes.First().Flags |= IndirectFlags + + elemCode := newArrayElemCode(ctx, elem, header, alen, size) + ctx.incIndex() + + end := newOpCode(ctx, c.typ, OpArrayEnd) + ctx.incIndex() + + header.End = end + header.Next = codes.First() + codes.Last().Next = elemCode + elemCode.Next = codes.First() + elemCode.End = end + + return Opcodes{header}.Add(codes...).Add(elemCode).Add(end) +} + +func (c *ArrayCode) Filter(_ *FieldQuery) Code { + return c +} + +type MapCode struct { + typ *runtime.Type + key Code + value Code +} + +func (c *MapCode) Kind() CodeKind { + return CodeKindMap +} + +func (c *MapCode) ToOpcode(ctx *compileContext) Opcodes { + // header => code => value => code => key => code => value => code => end + // ^ | + // |_______________________| + header := newMapHeaderCode(ctx, c.typ) + ctx.incIndex() + + keyCodes := c.key.ToOpcode(ctx) + + value := newMapValueCode(ctx, c.typ.Elem(), header) + ctx.incIndex() + + ctx.incIndent() + valueCodes := c.value.ToOpcode(ctx) + ctx.decIndent() + + valueCodes.First().Flags |= IndirectFlags + + key := newMapKeyCode(ctx, c.typ.Key(), header) + ctx.incIndex() + + end := newMapEndCode(ctx, c.typ, header) + ctx.incIndex() + + header.Next = keyCodes.First() + keyCodes.Last().Next = value + value.Next = valueCodes.First() + valueCodes.Last().Next = key + key.Next = keyCodes.First() + + header.End = end + key.End = end + value.End = end + return Opcodes{header}.Add(keyCodes...).Add(value).Add(valueCodes...).Add(key).Add(end) +} + +func (c *MapCode) Filter(_ *FieldQuery) Code { + return c +} + +type StructCode struct { + typ *runtime.Type + fields []*StructFieldCode + isPtr bool + disableIndirectConversion bool + isIndirect bool + isRecursive bool +} + +func (c *StructCode) Kind() CodeKind { + return CodeKindStruct +} + +func (c *StructCode) lastFieldCode(field *StructFieldCode, firstField *Opcode) *Opcode { + if isEmbeddedStruct(field) { + return c.lastAnonymousFieldCode(firstField) + } + lastField := firstField + for lastField.NextField != nil { + lastField = lastField.NextField + } + return lastField +} + +func (c *StructCode) lastAnonymousFieldCode(firstField *Opcode) *Opcode { + // firstField is special StructHead operation for anonymous structure. + // So, StructHead's next operation is truly struct head operation. + lastField := firstField.Next + for lastField.NextField != nil { + lastField = lastField.NextField + } + return lastField +} + +func (c *StructCode) ToOpcode(ctx *compileContext) Opcodes { + // header => code => structField => code => end + // ^ | + // |__________| + if c.isRecursive { + recursive := newRecursiveCode(ctx, c.typ, &CompiledCode{}) + recursive.Type = c.typ + ctx.incIndex() + *ctx.recursiveCodes = append(*ctx.recursiveCodes, recursive) + return Opcodes{recursive} + } + codes := Opcodes{} + var prevField *Opcode + ctx.incIndent() + for idx, field := range c.fields { + isFirstField := idx == 0 + isEndField := idx == len(c.fields)-1 + fieldCodes := field.ToOpcode(ctx, isFirstField, isEndField) + for _, code := range fieldCodes { + if c.isIndirect { + code.Flags |= IndirectFlags + } + } + firstField := fieldCodes.First() + if len(codes) > 0 { + codes.Last().Next = firstField + firstField.Idx = codes.First().Idx + } + if prevField != nil { + prevField.NextField = firstField + } + if isEndField { + endField := fieldCodes.Last() + if isEmbeddedStruct(field) { + firstField.End = endField + lastField := c.lastAnonymousFieldCode(firstField) + lastField.NextField = endField + } + if len(codes) > 0 { + codes.First().End = endField + } else { + firstField.End = endField + } + codes = codes.Add(fieldCodes...) + break + } + prevField = c.lastFieldCode(field, firstField) + codes = codes.Add(fieldCodes...) + } + if len(codes) == 0 { + head := &Opcode{ + Op: OpStructHead, + Idx: opcodeOffset(ctx.ptrIndex), + Type: c.typ, + DisplayIdx: ctx.opcodeIndex, + Indent: ctx.indent, + } + ctx.incOpcodeIndex() + end := &Opcode{ + Op: OpStructEnd, + Idx: opcodeOffset(ctx.ptrIndex), + DisplayIdx: ctx.opcodeIndex, + Indent: ctx.indent, + } + head.NextField = end + head.Next = end + head.End = end + codes = codes.Add(head, end) + ctx.incIndex() + } + ctx.decIndent() + ctx.structTypeToCodes[uintptr(unsafe.Pointer(c.typ))] = codes + return codes +} + +func (c *StructCode) ToAnonymousOpcode(ctx *compileContext) Opcodes { + // header => code => structField => code => end + // ^ | + // |__________| + if c.isRecursive { + recursive := newRecursiveCode(ctx, c.typ, &CompiledCode{}) + recursive.Type = c.typ + ctx.incIndex() + *ctx.recursiveCodes = append(*ctx.recursiveCodes, recursive) + return Opcodes{recursive} + } + codes := Opcodes{} + var prevField *Opcode + for idx, field := range c.fields { + isFirstField := idx == 0 + isEndField := idx == len(c.fields)-1 + fieldCodes := field.ToAnonymousOpcode(ctx, isFirstField, isEndField) + for _, code := range fieldCodes { + if c.isIndirect { + code.Flags |= IndirectFlags + } + } + firstField := fieldCodes.First() + if len(codes) > 0 { + codes.Last().Next = firstField + firstField.Idx = codes.First().Idx + } + if prevField != nil { + prevField.NextField = firstField + } + if isEndField { + lastField := fieldCodes.Last() + if len(codes) > 0 { + codes.First().End = lastField + } else { + firstField.End = lastField + } + } + prevField = firstField + codes = codes.Add(fieldCodes...) + } + return codes +} + +func (c *StructCode) removeFieldsByTags(tags runtime.StructTags) { + fields := make([]*StructFieldCode, 0, len(c.fields)) + for _, field := range c.fields { + if field.isAnonymous { + structCode := field.getAnonymousStruct() + if structCode != nil && !structCode.isRecursive { + structCode.removeFieldsByTags(tags) + if len(structCode.fields) > 0 { + fields = append(fields, field) + } + continue + } + } + if tags.ExistsKey(field.key) { + continue + } + fields = append(fields, field) + } + c.fields = fields +} + +func (c *StructCode) enableIndirect() { + if c.isIndirect { + return + } + c.isIndirect = true + if len(c.fields) == 0 { + return + } + structCode := c.fields[0].getStruct() + if structCode == nil { + return + } + structCode.enableIndirect() +} + +func (c *StructCode) Filter(query *FieldQuery) Code { + fieldMap := map[string]*FieldQuery{} + for _, field := range query.Fields { + fieldMap[field.Name] = field + } + fields := make([]*StructFieldCode, 0, len(c.fields)) + for _, field := range c.fields { + query, exists := fieldMap[field.key] + if !exists { + continue + } + fieldCode := &StructFieldCode{ + typ: field.typ, + key: field.key, + tag: field.tag, + value: field.value, + offset: field.offset, + isAnonymous: field.isAnonymous, + isTaggedKey: field.isTaggedKey, + isNilableType: field.isNilableType, + isNilCheck: field.isNilCheck, + isAddrForMarshaler: field.isAddrForMarshaler, + isNextOpPtrType: field.isNextOpPtrType, + } + if len(query.Fields) > 0 { + fieldCode.value = fieldCode.value.Filter(query) + } + fields = append(fields, fieldCode) + } + return &StructCode{ + typ: c.typ, + fields: fields, + isPtr: c.isPtr, + disableIndirectConversion: c.disableIndirectConversion, + isIndirect: c.isIndirect, + isRecursive: c.isRecursive, + } +} + +type StructFieldCode struct { + typ *runtime.Type + key string + tag *runtime.StructTag + value Code + offset uintptr + isAnonymous bool + isTaggedKey bool + isNilableType bool + isNilCheck bool + isAddrForMarshaler bool + isNextOpPtrType bool + isMarshalerContext bool +} + +func (c *StructFieldCode) getStruct() *StructCode { + value := c.value + ptr, ok := value.(*PtrCode) + if ok { + value = ptr.value + } + structCode, ok := value.(*StructCode) + if ok { + return structCode + } + return nil +} + +func (c *StructFieldCode) getAnonymousStruct() *StructCode { + if !c.isAnonymous { + return nil + } + return c.getStruct() +} + +func optimizeStructHeader(code *Opcode, tag *runtime.StructTag) OpType { + headType := code.ToHeaderType(tag.IsString) + if tag.IsOmitEmpty { + headType = headType.HeadToOmitEmptyHead() + } + return headType +} + +func optimizeStructField(code *Opcode, tag *runtime.StructTag) OpType { + fieldType := code.ToFieldType(tag.IsString) + if tag.IsOmitEmpty { + fieldType = fieldType.FieldToOmitEmptyField() + } + return fieldType +} + +func (c *StructFieldCode) headerOpcodes(ctx *compileContext, field *Opcode, valueCodes Opcodes) Opcodes { + value := valueCodes.First() + op := optimizeStructHeader(value, c.tag) + field.Op = op + if value.Flags&MarshalerContextFlags != 0 { + field.Flags |= MarshalerContextFlags + } + field.NumBitSize = value.NumBitSize + field.PtrNum = value.PtrNum + field.FieldQuery = value.FieldQuery + fieldCodes := Opcodes{field} + if op.IsMultipleOpHead() { + field.Next = value + fieldCodes = fieldCodes.Add(valueCodes...) + } else { + ctx.decIndex() + } + return fieldCodes +} + +func (c *StructFieldCode) fieldOpcodes(ctx *compileContext, field *Opcode, valueCodes Opcodes) Opcodes { + value := valueCodes.First() + op := optimizeStructField(value, c.tag) + field.Op = op + if value.Flags&MarshalerContextFlags != 0 { + field.Flags |= MarshalerContextFlags + } + field.NumBitSize = value.NumBitSize + field.PtrNum = value.PtrNum + field.FieldQuery = value.FieldQuery + + fieldCodes := Opcodes{field} + if op.IsMultipleOpField() { + field.Next = value + fieldCodes = fieldCodes.Add(valueCodes...) + } else { + ctx.decIndex() + } + return fieldCodes +} + +func (c *StructFieldCode) addStructEndCode(ctx *compileContext, codes Opcodes) Opcodes { + end := &Opcode{ + Op: OpStructEnd, + Idx: opcodeOffset(ctx.ptrIndex), + DisplayIdx: ctx.opcodeIndex, + Indent: ctx.indent, + } + codes.Last().Next = end + codes.First().NextField = end + codes = codes.Add(end) + ctx.incOpcodeIndex() + return codes +} + +func (c *StructFieldCode) structKey(ctx *compileContext) string { + if ctx.escapeKey { + rctx := &RuntimeContext{Option: &Option{Flag: HTMLEscapeOption}} + return fmt.Sprintf(`%s:`, string(AppendString(rctx, []byte{}, c.key))) + } + return fmt.Sprintf(`"%s":`, c.key) +} + +func (c *StructFieldCode) flags() OpFlags { + var flags OpFlags + if c.isTaggedKey { + flags |= IsTaggedKeyFlags + } + if c.isNilableType { + flags |= IsNilableTypeFlags + } + if c.isNilCheck { + flags |= NilCheckFlags + } + if c.isAddrForMarshaler { + flags |= AddrForMarshalerFlags + } + if c.isNextOpPtrType { + flags |= IsNextOpPtrTypeFlags + } + if c.isAnonymous { + flags |= AnonymousKeyFlags + } + if c.isMarshalerContext { + flags |= MarshalerContextFlags + } + return flags +} + +func (c *StructFieldCode) toValueOpcodes(ctx *compileContext) Opcodes { + if c.isAnonymous { + anonymCode, ok := c.value.(AnonymousCode) + if ok { + return anonymCode.ToAnonymousOpcode(ctx) + } + } + return c.value.ToOpcode(ctx) +} + +func (c *StructFieldCode) ToOpcode(ctx *compileContext, isFirstField, isEndField bool) Opcodes { + field := &Opcode{ + Idx: opcodeOffset(ctx.ptrIndex), + Flags: c.flags(), + Key: c.structKey(ctx), + Offset: uint32(c.offset), + Type: c.typ, + DisplayIdx: ctx.opcodeIndex, + Indent: ctx.indent, + DisplayKey: c.key, + } + ctx.incIndex() + valueCodes := c.toValueOpcodes(ctx) + if isFirstField { + codes := c.headerOpcodes(ctx, field, valueCodes) + if isEndField { + codes = c.addStructEndCode(ctx, codes) + } + return codes + } + codes := c.fieldOpcodes(ctx, field, valueCodes) + if isEndField { + if isEnableStructEndOptimization(c.value) { + field.Op = field.Op.FieldToEnd() + } else { + codes = c.addStructEndCode(ctx, codes) + } + } + return codes +} + +func (c *StructFieldCode) ToAnonymousOpcode(ctx *compileContext, isFirstField, isEndField bool) Opcodes { + field := &Opcode{ + Idx: opcodeOffset(ctx.ptrIndex), + Flags: c.flags() | AnonymousHeadFlags, + Key: c.structKey(ctx), + Offset: uint32(c.offset), + Type: c.typ, + DisplayIdx: ctx.opcodeIndex, + Indent: ctx.indent, + DisplayKey: c.key, + } + ctx.incIndex() + valueCodes := c.toValueOpcodes(ctx) + if isFirstField { + return c.headerOpcodes(ctx, field, valueCodes) + } + return c.fieldOpcodes(ctx, field, valueCodes) +} + +func isEnableStructEndOptimization(value Code) bool { + switch value.Kind() { + case CodeKindInt, + CodeKindUint, + CodeKindFloat, + CodeKindString, + CodeKindBool, + CodeKindBytes: + return true + case CodeKindPtr: + return isEnableStructEndOptimization(value.(*PtrCode).value) + default: + return false + } +} + +type InterfaceCode struct { + typ *runtime.Type + fieldQuery *FieldQuery + isPtr bool +} + +func (c *InterfaceCode) Kind() CodeKind { + return CodeKindInterface +} + +func (c *InterfaceCode) ToOpcode(ctx *compileContext) Opcodes { + var code *Opcode + switch { + case c.isPtr: + code = newOpCode(ctx, c.typ, OpInterfacePtr) + default: + code = newOpCode(ctx, c.typ, OpInterface) + } + code.FieldQuery = c.fieldQuery + if c.typ.NumMethod() > 0 { + code.Flags |= NonEmptyInterfaceFlags + } + ctx.incIndex() + return Opcodes{code} +} + +func (c *InterfaceCode) Filter(query *FieldQuery) Code { + return &InterfaceCode{ + typ: c.typ, + fieldQuery: query, + isPtr: c.isPtr, + } +} + +type MarshalJSONCode struct { + typ *runtime.Type + fieldQuery *FieldQuery + isAddrForMarshaler bool + isNilableType bool + isMarshalerContext bool +} + +func (c *MarshalJSONCode) Kind() CodeKind { + return CodeKindMarshalJSON +} + +func (c *MarshalJSONCode) ToOpcode(ctx *compileContext) Opcodes { + code := newOpCode(ctx, c.typ, OpMarshalJSON) + code.FieldQuery = c.fieldQuery + if c.isAddrForMarshaler { + code.Flags |= AddrForMarshalerFlags + } + if c.isMarshalerContext { + code.Flags |= MarshalerContextFlags + } + if c.isNilableType { + code.Flags |= IsNilableTypeFlags + } else { + code.Flags &= ^IsNilableTypeFlags + } + ctx.incIndex() + return Opcodes{code} +} + +func (c *MarshalJSONCode) Filter(query *FieldQuery) Code { + return &MarshalJSONCode{ + typ: c.typ, + fieldQuery: query, + isAddrForMarshaler: c.isAddrForMarshaler, + isNilableType: c.isNilableType, + isMarshalerContext: c.isMarshalerContext, + } +} + +type MarshalTextCode struct { + typ *runtime.Type + fieldQuery *FieldQuery + isAddrForMarshaler bool + isNilableType bool +} + +func (c *MarshalTextCode) Kind() CodeKind { + return CodeKindMarshalText +} + +func (c *MarshalTextCode) ToOpcode(ctx *compileContext) Opcodes { + code := newOpCode(ctx, c.typ, OpMarshalText) + code.FieldQuery = c.fieldQuery + if c.isAddrForMarshaler { + code.Flags |= AddrForMarshalerFlags + } + if c.isNilableType { + code.Flags |= IsNilableTypeFlags + } else { + code.Flags &= ^IsNilableTypeFlags + } + ctx.incIndex() + return Opcodes{code} +} + +func (c *MarshalTextCode) Filter(query *FieldQuery) Code { + return &MarshalTextCode{ + typ: c.typ, + fieldQuery: query, + isAddrForMarshaler: c.isAddrForMarshaler, + isNilableType: c.isNilableType, + } +} + +type PtrCode struct { + typ *runtime.Type + value Code + ptrNum uint8 +} + +func (c *PtrCode) Kind() CodeKind { + return CodeKindPtr +} + +func (c *PtrCode) ToOpcode(ctx *compileContext) Opcodes { + codes := c.value.ToOpcode(ctx) + codes.First().Op = convertPtrOp(codes.First()) + codes.First().PtrNum = c.ptrNum + return codes +} + +func (c *PtrCode) ToAnonymousOpcode(ctx *compileContext) Opcodes { + var codes Opcodes + anonymCode, ok := c.value.(AnonymousCode) + if ok { + codes = anonymCode.ToAnonymousOpcode(ctx) + } else { + codes = c.value.ToOpcode(ctx) + } + codes.First().Op = convertPtrOp(codes.First()) + codes.First().PtrNum = c.ptrNum + return codes +} + +func (c *PtrCode) Filter(query *FieldQuery) Code { + return &PtrCode{ + typ: c.typ, + value: c.value.Filter(query), + ptrNum: c.ptrNum, + } +} + +func convertPtrOp(code *Opcode) OpType { + ptrHeadOp := code.Op.HeadToPtrHead() + if code.Op != ptrHeadOp { + if code.PtrNum > 0 { + // ptr field and ptr head + code.PtrNum-- + } + return ptrHeadOp + } + switch code.Op { + case OpInt: + return OpIntPtr + case OpUint: + return OpUintPtr + case OpFloat32: + return OpFloat32Ptr + case OpFloat64: + return OpFloat64Ptr + case OpString: + return OpStringPtr + case OpBool: + return OpBoolPtr + case OpBytes: + return OpBytesPtr + case OpNumber: + return OpNumberPtr + case OpArray: + return OpArrayPtr + case OpSlice: + return OpSlicePtr + case OpMap: + return OpMapPtr + case OpMarshalJSON: + return OpMarshalJSONPtr + case OpMarshalText: + return OpMarshalTextPtr + case OpInterface: + return OpInterfacePtr + case OpRecursive: + return OpRecursivePtr + } + return code.Op +} + +func isEmbeddedStruct(field *StructFieldCode) bool { + if !field.isAnonymous { + return false + } + t := field.typ + if t.Kind() == reflect.Ptr { + t = t.Elem() + } + return t.Kind() == reflect.Struct +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compact.go b/vendor/github.com/goccy/go-json/internal/encoder/compact.go new file mode 100644 index 000000000..0eb9545d8 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/compact.go @@ -0,0 +1,286 @@ +package encoder + +import ( + "bytes" + "fmt" + "strconv" + "unsafe" + + "github.com/goccy/go-json/internal/errors" +) + +var ( + isWhiteSpace = [256]bool{ + ' ': true, + '\n': true, + '\t': true, + '\r': true, + } + isHTMLEscapeChar = [256]bool{ + '<': true, + '>': true, + '&': true, + } + nul = byte('\000') +) + +func Compact(buf *bytes.Buffer, src []byte, escape bool) error { + if len(src) == 0 { + return errors.ErrUnexpectedEndOfJSON("", 0) + } + buf.Grow(len(src)) + dst := buf.Bytes() + + ctx := TakeRuntimeContext() + ctxBuf := ctx.Buf[:0] + ctxBuf = append(append(ctxBuf, src...), nul) + ctx.Buf = ctxBuf + + if err := compactAndWrite(buf, dst, ctxBuf, escape); err != nil { + ReleaseRuntimeContext(ctx) + return err + } + ReleaseRuntimeContext(ctx) + return nil +} + +func compactAndWrite(buf *bytes.Buffer, dst []byte, src []byte, escape bool) error { + dst, err := compact(dst, src, escape) + if err != nil { + return err + } + if _, err := buf.Write(dst); err != nil { + return err + } + return nil +} + +func compact(dst, src []byte, escape bool) ([]byte, error) { + buf, cursor, err := compactValue(dst, src, 0, escape) + if err != nil { + return nil, err + } + if err := validateEndBuf(src, cursor); err != nil { + return nil, err + } + return buf, nil +} + +func validateEndBuf(src []byte, cursor int64) error { + for { + switch src[cursor] { + case ' ', '\t', '\n', '\r': + cursor++ + continue + case nul: + return nil + } + return errors.ErrSyntax( + fmt.Sprintf("invalid character '%c' after top-level value", src[cursor]), + cursor+1, + ) + } +} + +func skipWhiteSpace(buf []byte, cursor int64) int64 { +LOOP: + if isWhiteSpace[buf[cursor]] { + cursor++ + goto LOOP + } + return cursor +} + +func compactValue(dst, src []byte, cursor int64, escape bool) ([]byte, int64, error) { + for { + switch src[cursor] { + case ' ', '\t', '\n', '\r': + cursor++ + continue + case '{': + return compactObject(dst, src, cursor, escape) + case '}': + return nil, 0, errors.ErrSyntax("unexpected character '}'", cursor) + case '[': + return compactArray(dst, src, cursor, escape) + case ']': + return nil, 0, errors.ErrSyntax("unexpected character ']'", cursor) + case '"': + return compactString(dst, src, cursor, escape) + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + return compactNumber(dst, src, cursor) + case 't': + return compactTrue(dst, src, cursor) + case 'f': + return compactFalse(dst, src, cursor) + case 'n': + return compactNull(dst, src, cursor) + default: + return nil, 0, errors.ErrSyntax(fmt.Sprintf("unexpected character '%c'", src[cursor]), cursor) + } + } +} + +func compactObject(dst, src []byte, cursor int64, escape bool) ([]byte, int64, error) { + if src[cursor] == '{' { + dst = append(dst, '{') + } else { + return nil, 0, errors.ErrExpected("expected { character for object value", cursor) + } + cursor = skipWhiteSpace(src, cursor+1) + if src[cursor] == '}' { + dst = append(dst, '}') + return dst, cursor + 1, nil + } + var err error + for { + cursor = skipWhiteSpace(src, cursor) + dst, cursor, err = compactString(dst, src, cursor, escape) + if err != nil { + return nil, 0, err + } + cursor = skipWhiteSpace(src, cursor) + if src[cursor] != ':' { + return nil, 0, errors.ErrExpected("colon after object key", cursor) + } + dst = append(dst, ':') + dst, cursor, err = compactValue(dst, src, cursor+1, escape) + if err != nil { + return nil, 0, err + } + cursor = skipWhiteSpace(src, cursor) + switch src[cursor] { + case '}': + dst = append(dst, '}') + cursor++ + return dst, cursor, nil + case ',': + dst = append(dst, ',') + default: + return nil, 0, errors.ErrExpected("comma after object value", cursor) + } + cursor++ + } +} + +func compactArray(dst, src []byte, cursor int64, escape bool) ([]byte, int64, error) { + if src[cursor] == '[' { + dst = append(dst, '[') + } else { + return nil, 0, errors.ErrExpected("expected [ character for array value", cursor) + } + cursor = skipWhiteSpace(src, cursor+1) + if src[cursor] == ']' { + dst = append(dst, ']') + return dst, cursor + 1, nil + } + var err error + for { + dst, cursor, err = compactValue(dst, src, cursor, escape) + if err != nil { + return nil, 0, err + } + cursor = skipWhiteSpace(src, cursor) + switch src[cursor] { + case ']': + dst = append(dst, ']') + cursor++ + return dst, cursor, nil + case ',': + dst = append(dst, ',') + default: + return nil, 0, errors.ErrExpected("comma after array value", cursor) + } + cursor++ + } +} + +func compactString(dst, src []byte, cursor int64, escape bool) ([]byte, int64, error) { + if src[cursor] != '"' { + return nil, 0, errors.ErrInvalidCharacter(src[cursor], "string", cursor) + } + start := cursor + for { + cursor++ + c := src[cursor] + if escape { + if isHTMLEscapeChar[c] { + dst = append(dst, src[start:cursor]...) + dst = append(dst, `\u00`...) + dst = append(dst, hex[c>>4], hex[c&0xF]) + start = cursor + 1 + } else if c == 0xE2 && cursor+2 < int64(len(src)) && src[cursor+1] == 0x80 && src[cursor+2]&^1 == 0xA8 { + dst = append(dst, src[start:cursor]...) + dst = append(dst, `\u202`...) + dst = append(dst, hex[src[cursor+2]&0xF]) + cursor += 2 + start = cursor + 3 + } + } + switch c { + case '\\': + cursor++ + if src[cursor] == nul { + return nil, 0, errors.ErrUnexpectedEndOfJSON("string", int64(len(src))) + } + case '"': + cursor++ + return append(dst, src[start:cursor]...), cursor, nil + case nul: + return nil, 0, errors.ErrUnexpectedEndOfJSON("string", int64(len(src))) + } + } +} + +func compactNumber(dst, src []byte, cursor int64) ([]byte, int64, error) { + start := cursor + for { + cursor++ + if floatTable[src[cursor]] { + continue + } + break + } + num := src[start:cursor] + if _, err := strconv.ParseFloat(*(*string)(unsafe.Pointer(&num)), 64); err != nil { + return nil, 0, err + } + dst = append(dst, num...) + return dst, cursor, nil +} + +func compactTrue(dst, src []byte, cursor int64) ([]byte, int64, error) { + if cursor+3 >= int64(len(src)) { + return nil, 0, errors.ErrUnexpectedEndOfJSON("true", cursor) + } + if !bytes.Equal(src[cursor:cursor+4], []byte(`true`)) { + return nil, 0, errors.ErrInvalidCharacter(src[cursor], "true", cursor) + } + dst = append(dst, "true"...) + cursor += 4 + return dst, cursor, nil +} + +func compactFalse(dst, src []byte, cursor int64) ([]byte, int64, error) { + if cursor+4 >= int64(len(src)) { + return nil, 0, errors.ErrUnexpectedEndOfJSON("false", cursor) + } + if !bytes.Equal(src[cursor:cursor+5], []byte(`false`)) { + return nil, 0, errors.ErrInvalidCharacter(src[cursor], "false", cursor) + } + dst = append(dst, "false"...) + cursor += 5 + return dst, cursor, nil +} + +func compactNull(dst, src []byte, cursor int64) ([]byte, int64, error) { + if cursor+3 >= int64(len(src)) { + return nil, 0, errors.ErrUnexpectedEndOfJSON("null", cursor) + } + if !bytes.Equal(src[cursor:cursor+4], []byte(`null`)) { + return nil, 0, errors.ErrInvalidCharacter(src[cursor], "null", cursor) + } + dst = append(dst, "null"...) + cursor += 4 + return dst, cursor, nil +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compiler.go b/vendor/github.com/goccy/go-json/internal/encoder/compiler.go new file mode 100644 index 000000000..bf5e0f947 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/compiler.go @@ -0,0 +1,930 @@ +package encoder + +import ( + "context" + "encoding" + "encoding/json" + "reflect" + "sync/atomic" + "unsafe" + + "github.com/goccy/go-json/internal/errors" + "github.com/goccy/go-json/internal/runtime" +) + +type marshalerContext interface { + MarshalJSON(context.Context) ([]byte, error) +} + +var ( + marshalJSONType = reflect.TypeOf((*json.Marshaler)(nil)).Elem() + marshalJSONContextType = reflect.TypeOf((*marshalerContext)(nil)).Elem() + marshalTextType = reflect.TypeOf((*encoding.TextMarshaler)(nil)).Elem() + jsonNumberType = reflect.TypeOf(json.Number("")) + cachedOpcodeSets []*OpcodeSet + cachedOpcodeMap unsafe.Pointer // map[uintptr]*OpcodeSet + typeAddr *runtime.TypeAddr +) + +func init() { + typeAddr = runtime.AnalyzeTypeAddr() + if typeAddr == nil { + typeAddr = &runtime.TypeAddr{} + } + cachedOpcodeSets = make([]*OpcodeSet, typeAddr.AddrRange>>typeAddr.AddrShift+1) +} + +func loadOpcodeMap() map[uintptr]*OpcodeSet { + p := atomic.LoadPointer(&cachedOpcodeMap) + return *(*map[uintptr]*OpcodeSet)(unsafe.Pointer(&p)) +} + +func storeOpcodeSet(typ uintptr, set *OpcodeSet, m map[uintptr]*OpcodeSet) { + newOpcodeMap := make(map[uintptr]*OpcodeSet, len(m)+1) + newOpcodeMap[typ] = set + + for k, v := range m { + newOpcodeMap[k] = v + } + + atomic.StorePointer(&cachedOpcodeMap, *(*unsafe.Pointer)(unsafe.Pointer(&newOpcodeMap))) +} + +func compileToGetCodeSetSlowPath(typeptr uintptr) (*OpcodeSet, error) { + opcodeMap := loadOpcodeMap() + if codeSet, exists := opcodeMap[typeptr]; exists { + return codeSet, nil + } + codeSet, err := newCompiler().compile(typeptr) + if err != nil { + return nil, err + } + storeOpcodeSet(typeptr, codeSet, opcodeMap) + return codeSet, nil +} + +func getFilteredCodeSetIfNeeded(ctx *RuntimeContext, codeSet *OpcodeSet) (*OpcodeSet, error) { + if (ctx.Option.Flag & ContextOption) == 0 { + return codeSet, nil + } + query := FieldQueryFromContext(ctx.Option.Context) + if query == nil { + return codeSet, nil + } + ctx.Option.Flag |= FieldQueryOption + cacheCodeSet := codeSet.getQueryCache(query.Hash()) + if cacheCodeSet != nil { + return cacheCodeSet, nil + } + queryCodeSet, err := newCompiler().codeToOpcodeSet(codeSet.Type, codeSet.Code.Filter(query)) + if err != nil { + return nil, err + } + codeSet.setQueryCache(query.Hash(), queryCodeSet) + return queryCodeSet, nil +} + +type Compiler struct { + structTypeToCode map[uintptr]*StructCode +} + +func newCompiler() *Compiler { + return &Compiler{ + structTypeToCode: map[uintptr]*StructCode{}, + } +} + +func (c *Compiler) compile(typeptr uintptr) (*OpcodeSet, error) { + // noescape trick for header.typ ( reflect.*rtype ) + typ := *(**runtime.Type)(unsafe.Pointer(&typeptr)) + code, err := c.typeToCode(typ) + if err != nil { + return nil, err + } + return c.codeToOpcodeSet(typ, code) +} + +func (c *Compiler) codeToOpcodeSet(typ *runtime.Type, code Code) (*OpcodeSet, error) { + noescapeKeyCode := c.codeToOpcode(&compileContext{ + structTypeToCodes: map[uintptr]Opcodes{}, + recursiveCodes: &Opcodes{}, + }, typ, code) + if err := noescapeKeyCode.Validate(); err != nil { + return nil, err + } + escapeKeyCode := c.codeToOpcode(&compileContext{ + structTypeToCodes: map[uintptr]Opcodes{}, + recursiveCodes: &Opcodes{}, + escapeKey: true, + }, typ, code) + noescapeKeyCode = copyOpcode(noescapeKeyCode) + escapeKeyCode = copyOpcode(escapeKeyCode) + setTotalLengthToInterfaceOp(noescapeKeyCode) + setTotalLengthToInterfaceOp(escapeKeyCode) + interfaceNoescapeKeyCode := copyToInterfaceOpcode(noescapeKeyCode) + interfaceEscapeKeyCode := copyToInterfaceOpcode(escapeKeyCode) + codeLength := noescapeKeyCode.TotalLength() + return &OpcodeSet{ + Type: typ, + NoescapeKeyCode: noescapeKeyCode, + EscapeKeyCode: escapeKeyCode, + InterfaceNoescapeKeyCode: interfaceNoescapeKeyCode, + InterfaceEscapeKeyCode: interfaceEscapeKeyCode, + CodeLength: codeLength, + EndCode: ToEndCode(interfaceNoescapeKeyCode), + Code: code, + QueryCache: map[string]*OpcodeSet{}, + }, nil +} + +func (c *Compiler) typeToCode(typ *runtime.Type) (Code, error) { + switch { + case c.implementsMarshalJSON(typ): + return c.marshalJSONCode(typ) + case c.implementsMarshalText(typ): + return c.marshalTextCode(typ) + } + + isPtr := false + orgType := typ + if typ.Kind() == reflect.Ptr { + typ = typ.Elem() + isPtr = true + } + switch { + case c.implementsMarshalJSON(typ): + return c.marshalJSONCode(orgType) + case c.implementsMarshalText(typ): + return c.marshalTextCode(orgType) + } + switch typ.Kind() { + case reflect.Slice: + elem := typ.Elem() + if elem.Kind() == reflect.Uint8 { + p := runtime.PtrTo(elem) + if !c.implementsMarshalJSONType(p) && !p.Implements(marshalTextType) { + return c.bytesCode(typ, isPtr) + } + } + return c.sliceCode(typ) + case reflect.Map: + if isPtr { + return c.ptrCode(runtime.PtrTo(typ)) + } + return c.mapCode(typ) + case reflect.Struct: + return c.structCode(typ, isPtr) + case reflect.Int: + return c.intCode(typ, isPtr) + case reflect.Int8: + return c.int8Code(typ, isPtr) + case reflect.Int16: + return c.int16Code(typ, isPtr) + case reflect.Int32: + return c.int32Code(typ, isPtr) + case reflect.Int64: + return c.int64Code(typ, isPtr) + case reflect.Uint, reflect.Uintptr: + return c.uintCode(typ, isPtr) + case reflect.Uint8: + return c.uint8Code(typ, isPtr) + case reflect.Uint16: + return c.uint16Code(typ, isPtr) + case reflect.Uint32: + return c.uint32Code(typ, isPtr) + case reflect.Uint64: + return c.uint64Code(typ, isPtr) + case reflect.Float32: + return c.float32Code(typ, isPtr) + case reflect.Float64: + return c.float64Code(typ, isPtr) + case reflect.String: + return c.stringCode(typ, isPtr) + case reflect.Bool: + return c.boolCode(typ, isPtr) + case reflect.Interface: + return c.interfaceCode(typ, isPtr) + default: + if isPtr && typ.Implements(marshalTextType) { + typ = orgType + } + return c.typeToCodeWithPtr(typ, isPtr) + } +} + +func (c *Compiler) typeToCodeWithPtr(typ *runtime.Type, isPtr bool) (Code, error) { + switch { + case c.implementsMarshalJSON(typ): + return c.marshalJSONCode(typ) + case c.implementsMarshalText(typ): + return c.marshalTextCode(typ) + } + switch typ.Kind() { + case reflect.Ptr: + return c.ptrCode(typ) + case reflect.Slice: + elem := typ.Elem() + if elem.Kind() == reflect.Uint8 { + p := runtime.PtrTo(elem) + if !c.implementsMarshalJSONType(p) && !p.Implements(marshalTextType) { + return c.bytesCode(typ, false) + } + } + return c.sliceCode(typ) + case reflect.Array: + return c.arrayCode(typ) + case reflect.Map: + return c.mapCode(typ) + case reflect.Struct: + return c.structCode(typ, isPtr) + case reflect.Interface: + return c.interfaceCode(typ, false) + case reflect.Int: + return c.intCode(typ, false) + case reflect.Int8: + return c.int8Code(typ, false) + case reflect.Int16: + return c.int16Code(typ, false) + case reflect.Int32: + return c.int32Code(typ, false) + case reflect.Int64: + return c.int64Code(typ, false) + case reflect.Uint: + return c.uintCode(typ, false) + case reflect.Uint8: + return c.uint8Code(typ, false) + case reflect.Uint16: + return c.uint16Code(typ, false) + case reflect.Uint32: + return c.uint32Code(typ, false) + case reflect.Uint64: + return c.uint64Code(typ, false) + case reflect.Uintptr: + return c.uintCode(typ, false) + case reflect.Float32: + return c.float32Code(typ, false) + case reflect.Float64: + return c.float64Code(typ, false) + case reflect.String: + return c.stringCode(typ, false) + case reflect.Bool: + return c.boolCode(typ, false) + } + return nil, &errors.UnsupportedTypeError{Type: runtime.RType2Type(typ)} +} + +const intSize = 32 << (^uint(0) >> 63) + +//nolint:unparam +func (c *Compiler) intCode(typ *runtime.Type, isPtr bool) (*IntCode, error) { + return &IntCode{typ: typ, bitSize: intSize, isPtr: isPtr}, nil +} + +//nolint:unparam +func (c *Compiler) int8Code(typ *runtime.Type, isPtr bool) (*IntCode, error) { + return &IntCode{typ: typ, bitSize: 8, isPtr: isPtr}, nil +} + +//nolint:unparam +func (c *Compiler) int16Code(typ *runtime.Type, isPtr bool) (*IntCode, error) { + return &IntCode{typ: typ, bitSize: 16, isPtr: isPtr}, nil +} + +//nolint:unparam +func (c *Compiler) int32Code(typ *runtime.Type, isPtr bool) (*IntCode, error) { + return &IntCode{typ: typ, bitSize: 32, isPtr: isPtr}, nil +} + +//nolint:unparam +func (c *Compiler) int64Code(typ *runtime.Type, isPtr bool) (*IntCode, error) { + return &IntCode{typ: typ, bitSize: 64, isPtr: isPtr}, nil +} + +//nolint:unparam +func (c *Compiler) uintCode(typ *runtime.Type, isPtr bool) (*UintCode, error) { + return &UintCode{typ: typ, bitSize: intSize, isPtr: isPtr}, nil +} + +//nolint:unparam +func (c *Compiler) uint8Code(typ *runtime.Type, isPtr bool) (*UintCode, error) { + return &UintCode{typ: typ, bitSize: 8, isPtr: isPtr}, nil +} + +//nolint:unparam +func (c *Compiler) uint16Code(typ *runtime.Type, isPtr bool) (*UintCode, error) { + return &UintCode{typ: typ, bitSize: 16, isPtr: isPtr}, nil +} + +//nolint:unparam +func (c *Compiler) uint32Code(typ *runtime.Type, isPtr bool) (*UintCode, error) { + return &UintCode{typ: typ, bitSize: 32, isPtr: isPtr}, nil +} + +//nolint:unparam +func (c *Compiler) uint64Code(typ *runtime.Type, isPtr bool) (*UintCode, error) { + return &UintCode{typ: typ, bitSize: 64, isPtr: isPtr}, nil +} + +//nolint:unparam +func (c *Compiler) float32Code(typ *runtime.Type, isPtr bool) (*FloatCode, error) { + return &FloatCode{typ: typ, bitSize: 32, isPtr: isPtr}, nil +} + +//nolint:unparam +func (c *Compiler) float64Code(typ *runtime.Type, isPtr bool) (*FloatCode, error) { + return &FloatCode{typ: typ, bitSize: 64, isPtr: isPtr}, nil +} + +//nolint:unparam +func (c *Compiler) stringCode(typ *runtime.Type, isPtr bool) (*StringCode, error) { + return &StringCode{typ: typ, isPtr: isPtr}, nil +} + +//nolint:unparam +func (c *Compiler) boolCode(typ *runtime.Type, isPtr bool) (*BoolCode, error) { + return &BoolCode{typ: typ, isPtr: isPtr}, nil +} + +//nolint:unparam +func (c *Compiler) intStringCode(typ *runtime.Type) (*IntCode, error) { + return &IntCode{typ: typ, bitSize: intSize, isString: true}, nil +} + +//nolint:unparam +func (c *Compiler) int8StringCode(typ *runtime.Type) (*IntCode, error) { + return &IntCode{typ: typ, bitSize: 8, isString: true}, nil +} + +//nolint:unparam +func (c *Compiler) int16StringCode(typ *runtime.Type) (*IntCode, error) { + return &IntCode{typ: typ, bitSize: 16, isString: true}, nil +} + +//nolint:unparam +func (c *Compiler) int32StringCode(typ *runtime.Type) (*IntCode, error) { + return &IntCode{typ: typ, bitSize: 32, isString: true}, nil +} + +//nolint:unparam +func (c *Compiler) int64StringCode(typ *runtime.Type) (*IntCode, error) { + return &IntCode{typ: typ, bitSize: 64, isString: true}, nil +} + +//nolint:unparam +func (c *Compiler) uintStringCode(typ *runtime.Type) (*UintCode, error) { + return &UintCode{typ: typ, bitSize: intSize, isString: true}, nil +} + +//nolint:unparam +func (c *Compiler) uint8StringCode(typ *runtime.Type) (*UintCode, error) { + return &UintCode{typ: typ, bitSize: 8, isString: true}, nil +} + +//nolint:unparam +func (c *Compiler) uint16StringCode(typ *runtime.Type) (*UintCode, error) { + return &UintCode{typ: typ, bitSize: 16, isString: true}, nil +} + +//nolint:unparam +func (c *Compiler) uint32StringCode(typ *runtime.Type) (*UintCode, error) { + return &UintCode{typ: typ, bitSize: 32, isString: true}, nil +} + +//nolint:unparam +func (c *Compiler) uint64StringCode(typ *runtime.Type) (*UintCode, error) { + return &UintCode{typ: typ, bitSize: 64, isString: true}, nil +} + +//nolint:unparam +func (c *Compiler) bytesCode(typ *runtime.Type, isPtr bool) (*BytesCode, error) { + return &BytesCode{typ: typ, isPtr: isPtr}, nil +} + +//nolint:unparam +func (c *Compiler) interfaceCode(typ *runtime.Type, isPtr bool) (*InterfaceCode, error) { + return &InterfaceCode{typ: typ, isPtr: isPtr}, nil +} + +//nolint:unparam +func (c *Compiler) marshalJSONCode(typ *runtime.Type) (*MarshalJSONCode, error) { + return &MarshalJSONCode{ + typ: typ, + isAddrForMarshaler: c.isPtrMarshalJSONType(typ), + isNilableType: c.isNilableType(typ), + isMarshalerContext: typ.Implements(marshalJSONContextType) || runtime.PtrTo(typ).Implements(marshalJSONContextType), + }, nil +} + +//nolint:unparam +func (c *Compiler) marshalTextCode(typ *runtime.Type) (*MarshalTextCode, error) { + return &MarshalTextCode{ + typ: typ, + isAddrForMarshaler: c.isPtrMarshalTextType(typ), + isNilableType: c.isNilableType(typ), + }, nil +} + +func (c *Compiler) ptrCode(typ *runtime.Type) (*PtrCode, error) { + code, err := c.typeToCodeWithPtr(typ.Elem(), true) + if err != nil { + return nil, err + } + ptr, ok := code.(*PtrCode) + if ok { + return &PtrCode{typ: typ, value: ptr.value, ptrNum: ptr.ptrNum + 1}, nil + } + return &PtrCode{typ: typ, value: code, ptrNum: 1}, nil +} + +func (c *Compiler) sliceCode(typ *runtime.Type) (*SliceCode, error) { + elem := typ.Elem() + code, err := c.listElemCode(elem) + if err != nil { + return nil, err + } + if code.Kind() == CodeKindStruct { + structCode := code.(*StructCode) + structCode.enableIndirect() + } + return &SliceCode{typ: typ, value: code}, nil +} + +func (c *Compiler) arrayCode(typ *runtime.Type) (*ArrayCode, error) { + elem := typ.Elem() + code, err := c.listElemCode(elem) + if err != nil { + return nil, err + } + if code.Kind() == CodeKindStruct { + structCode := code.(*StructCode) + structCode.enableIndirect() + } + return &ArrayCode{typ: typ, value: code}, nil +} + +func (c *Compiler) mapCode(typ *runtime.Type) (*MapCode, error) { + keyCode, err := c.mapKeyCode(typ.Key()) + if err != nil { + return nil, err + } + valueCode, err := c.mapValueCode(typ.Elem()) + if err != nil { + return nil, err + } + if valueCode.Kind() == CodeKindStruct { + structCode := valueCode.(*StructCode) + structCode.enableIndirect() + } + return &MapCode{typ: typ, key: keyCode, value: valueCode}, nil +} + +func (c *Compiler) listElemCode(typ *runtime.Type) (Code, error) { + switch { + case c.isPtrMarshalJSONType(typ): + return c.marshalJSONCode(typ) + case !typ.Implements(marshalTextType) && runtime.PtrTo(typ).Implements(marshalTextType): + return c.marshalTextCode(typ) + case typ.Kind() == reflect.Map: + return c.ptrCode(runtime.PtrTo(typ)) + default: + // isPtr was originally used to indicate whether the type of top level is pointer. + // However, since the slice/array element is a specification that can get the pointer address, explicitly set isPtr to true. + // See here for related issues: https://github.com/goccy/go-json/issues/370 + code, err := c.typeToCodeWithPtr(typ, true) + if err != nil { + return nil, err + } + ptr, ok := code.(*PtrCode) + if ok { + if ptr.value.Kind() == CodeKindMap { + ptr.ptrNum++ + } + } + return code, nil + } +} + +func (c *Compiler) mapKeyCode(typ *runtime.Type) (Code, error) { + switch { + case c.implementsMarshalJSON(typ): + return c.marshalJSONCode(typ) + case c.implementsMarshalText(typ): + return c.marshalTextCode(typ) + } + switch typ.Kind() { + case reflect.Ptr: + return c.ptrCode(typ) + case reflect.String: + return c.stringCode(typ, false) + case reflect.Int: + return c.intStringCode(typ) + case reflect.Int8: + return c.int8StringCode(typ) + case reflect.Int16: + return c.int16StringCode(typ) + case reflect.Int32: + return c.int32StringCode(typ) + case reflect.Int64: + return c.int64StringCode(typ) + case reflect.Uint: + return c.uintStringCode(typ) + case reflect.Uint8: + return c.uint8StringCode(typ) + case reflect.Uint16: + return c.uint16StringCode(typ) + case reflect.Uint32: + return c.uint32StringCode(typ) + case reflect.Uint64: + return c.uint64StringCode(typ) + case reflect.Uintptr: + return c.uintStringCode(typ) + } + return nil, &errors.UnsupportedTypeError{Type: runtime.RType2Type(typ)} +} + +func (c *Compiler) mapValueCode(typ *runtime.Type) (Code, error) { + switch typ.Kind() { + case reflect.Map: + return c.ptrCode(runtime.PtrTo(typ)) + default: + code, err := c.typeToCodeWithPtr(typ, false) + if err != nil { + return nil, err + } + ptr, ok := code.(*PtrCode) + if ok { + if ptr.value.Kind() == CodeKindMap { + ptr.ptrNum++ + } + } + return code, nil + } +} + +func (c *Compiler) structCode(typ *runtime.Type, isPtr bool) (*StructCode, error) { + typeptr := uintptr(unsafe.Pointer(typ)) + if code, exists := c.structTypeToCode[typeptr]; exists { + derefCode := *code + derefCode.isRecursive = true + return &derefCode, nil + } + indirect := runtime.IfaceIndir(typ) + code := &StructCode{typ: typ, isPtr: isPtr, isIndirect: indirect} + c.structTypeToCode[typeptr] = code + + fieldNum := typ.NumField() + tags := c.typeToStructTags(typ) + fields := []*StructFieldCode{} + for i, tag := range tags { + isOnlyOneFirstField := i == 0 && fieldNum == 1 + field, err := c.structFieldCode(code, tag, isPtr, isOnlyOneFirstField) + if err != nil { + return nil, err + } + if field.isAnonymous { + structCode := field.getAnonymousStruct() + if structCode != nil { + structCode.removeFieldsByTags(tags) + if c.isAssignableIndirect(field, isPtr) { + if indirect { + structCode.isIndirect = true + } else { + structCode.isIndirect = false + } + } + } + } else { + structCode := field.getStruct() + if structCode != nil { + if indirect { + // if parent is indirect type, set child indirect property to true + structCode.isIndirect = true + } else { + // if parent is not indirect type, set child indirect property to false. + // but if parent's indirect is false and isPtr is true, then indirect must be true. + // Do this only if indirectConversion is enabled at the end of compileStruct. + structCode.isIndirect = false + } + } + } + fields = append(fields, field) + } + fieldMap := c.getFieldMap(fields) + duplicatedFieldMap := c.getDuplicatedFieldMap(fieldMap) + code.fields = c.filteredDuplicatedFields(fields, duplicatedFieldMap) + if !code.disableIndirectConversion && !indirect && isPtr { + code.enableIndirect() + } + delete(c.structTypeToCode, typeptr) + return code, nil +} + +func (c *Compiler) structFieldCode(structCode *StructCode, tag *runtime.StructTag, isPtr, isOnlyOneFirstField bool) (*StructFieldCode, error) { + field := tag.Field + fieldType := runtime.Type2RType(field.Type) + isIndirectSpecialCase := isPtr && isOnlyOneFirstField + fieldCode := &StructFieldCode{ + typ: fieldType, + key: tag.Key, + tag: tag, + offset: field.Offset, + isAnonymous: field.Anonymous && !tag.IsTaggedKey, + isTaggedKey: tag.IsTaggedKey, + isNilableType: c.isNilableType(fieldType), + isNilCheck: true, + } + switch { + case c.isMovePointerPositionFromHeadToFirstMarshalJSONFieldCase(fieldType, isIndirectSpecialCase): + code, err := c.marshalJSONCode(fieldType) + if err != nil { + return nil, err + } + fieldCode.value = code + fieldCode.isAddrForMarshaler = true + fieldCode.isNilCheck = false + structCode.isIndirect = false + structCode.disableIndirectConversion = true + case c.isMovePointerPositionFromHeadToFirstMarshalTextFieldCase(fieldType, isIndirectSpecialCase): + code, err := c.marshalTextCode(fieldType) + if err != nil { + return nil, err + } + fieldCode.value = code + fieldCode.isAddrForMarshaler = true + fieldCode.isNilCheck = false + structCode.isIndirect = false + structCode.disableIndirectConversion = true + case isPtr && c.isPtrMarshalJSONType(fieldType): + // *struct{ field T } + // func (*T) MarshalJSON() ([]byte, error) + code, err := c.marshalJSONCode(fieldType) + if err != nil { + return nil, err + } + fieldCode.value = code + fieldCode.isAddrForMarshaler = true + fieldCode.isNilCheck = false + case isPtr && c.isPtrMarshalTextType(fieldType): + // *struct{ field T } + // func (*T) MarshalText() ([]byte, error) + code, err := c.marshalTextCode(fieldType) + if err != nil { + return nil, err + } + fieldCode.value = code + fieldCode.isAddrForMarshaler = true + fieldCode.isNilCheck = false + default: + code, err := c.typeToCodeWithPtr(fieldType, isPtr) + if err != nil { + return nil, err + } + switch code.Kind() { + case CodeKindPtr, CodeKindInterface: + fieldCode.isNextOpPtrType = true + } + fieldCode.value = code + } + return fieldCode, nil +} + +func (c *Compiler) isAssignableIndirect(fieldCode *StructFieldCode, isPtr bool) bool { + if isPtr { + return false + } + codeType := fieldCode.value.Kind() + if codeType == CodeKindMarshalJSON { + return false + } + if codeType == CodeKindMarshalText { + return false + } + return true +} + +func (c *Compiler) getFieldMap(fields []*StructFieldCode) map[string][]*StructFieldCode { + fieldMap := map[string][]*StructFieldCode{} + for _, field := range fields { + if field.isAnonymous { + for k, v := range c.getAnonymousFieldMap(field) { + fieldMap[k] = append(fieldMap[k], v...) + } + continue + } + fieldMap[field.key] = append(fieldMap[field.key], field) + } + return fieldMap +} + +func (c *Compiler) getAnonymousFieldMap(field *StructFieldCode) map[string][]*StructFieldCode { + fieldMap := map[string][]*StructFieldCode{} + structCode := field.getAnonymousStruct() + if structCode == nil || structCode.isRecursive { + fieldMap[field.key] = append(fieldMap[field.key], field) + return fieldMap + } + for k, v := range c.getFieldMapFromAnonymousParent(structCode.fields) { + fieldMap[k] = append(fieldMap[k], v...) + } + return fieldMap +} + +func (c *Compiler) getFieldMapFromAnonymousParent(fields []*StructFieldCode) map[string][]*StructFieldCode { + fieldMap := map[string][]*StructFieldCode{} + for _, field := range fields { + if field.isAnonymous { + for k, v := range c.getAnonymousFieldMap(field) { + // Do not handle tagged key when embedding more than once + for _, vv := range v { + vv.isTaggedKey = false + } + fieldMap[k] = append(fieldMap[k], v...) + } + continue + } + fieldMap[field.key] = append(fieldMap[field.key], field) + } + return fieldMap +} + +func (c *Compiler) getDuplicatedFieldMap(fieldMap map[string][]*StructFieldCode) map[*StructFieldCode]struct{} { + duplicatedFieldMap := map[*StructFieldCode]struct{}{} + for _, fields := range fieldMap { + if len(fields) == 1 { + continue + } + if c.isTaggedKeyOnly(fields) { + for _, field := range fields { + if field.isTaggedKey { + continue + } + duplicatedFieldMap[field] = struct{}{} + } + } else { + for _, field := range fields { + duplicatedFieldMap[field] = struct{}{} + } + } + } + return duplicatedFieldMap +} + +func (c *Compiler) filteredDuplicatedFields(fields []*StructFieldCode, duplicatedFieldMap map[*StructFieldCode]struct{}) []*StructFieldCode { + filteredFields := make([]*StructFieldCode, 0, len(fields)) + for _, field := range fields { + if field.isAnonymous { + structCode := field.getAnonymousStruct() + if structCode != nil && !structCode.isRecursive { + structCode.fields = c.filteredDuplicatedFields(structCode.fields, duplicatedFieldMap) + if len(structCode.fields) > 0 { + filteredFields = append(filteredFields, field) + } + continue + } + } + if _, exists := duplicatedFieldMap[field]; exists { + continue + } + filteredFields = append(filteredFields, field) + } + return filteredFields +} + +func (c *Compiler) isTaggedKeyOnly(fields []*StructFieldCode) bool { + var taggedKeyFieldCount int + for _, field := range fields { + if field.isTaggedKey { + taggedKeyFieldCount++ + } + } + return taggedKeyFieldCount == 1 +} + +func (c *Compiler) typeToStructTags(typ *runtime.Type) runtime.StructTags { + tags := runtime.StructTags{} + fieldNum := typ.NumField() + for i := 0; i < fieldNum; i++ { + field := typ.Field(i) + if runtime.IsIgnoredStructField(field) { + continue + } + tags = append(tags, runtime.StructTagFromField(field)) + } + return tags +} + +// *struct{ field T } => struct { field *T } +// func (*T) MarshalJSON() ([]byte, error) +func (c *Compiler) isMovePointerPositionFromHeadToFirstMarshalJSONFieldCase(typ *runtime.Type, isIndirectSpecialCase bool) bool { + return isIndirectSpecialCase && !c.isNilableType(typ) && c.isPtrMarshalJSONType(typ) +} + +// *struct{ field T } => struct { field *T } +// func (*T) MarshalText() ([]byte, error) +func (c *Compiler) isMovePointerPositionFromHeadToFirstMarshalTextFieldCase(typ *runtime.Type, isIndirectSpecialCase bool) bool { + return isIndirectSpecialCase && !c.isNilableType(typ) && c.isPtrMarshalTextType(typ) +} + +func (c *Compiler) implementsMarshalJSON(typ *runtime.Type) bool { + if !c.implementsMarshalJSONType(typ) { + return false + } + if typ.Kind() != reflect.Ptr { + return true + } + // type kind is reflect.Ptr + if !c.implementsMarshalJSONType(typ.Elem()) { + return true + } + // needs to dereference + return false +} + +func (c *Compiler) implementsMarshalText(typ *runtime.Type) bool { + if !typ.Implements(marshalTextType) { + return false + } + if typ.Kind() != reflect.Ptr { + return true + } + // type kind is reflect.Ptr + if !typ.Elem().Implements(marshalTextType) { + return true + } + // needs to dereference + return false +} + +func (c *Compiler) isNilableType(typ *runtime.Type) bool { + if !runtime.IfaceIndir(typ) { + return true + } + switch typ.Kind() { + case reflect.Ptr: + return true + case reflect.Map: + return true + case reflect.Func: + return true + default: + return false + } +} + +func (c *Compiler) implementsMarshalJSONType(typ *runtime.Type) bool { + return typ.Implements(marshalJSONType) || typ.Implements(marshalJSONContextType) +} + +func (c *Compiler) isPtrMarshalJSONType(typ *runtime.Type) bool { + return !c.implementsMarshalJSONType(typ) && c.implementsMarshalJSONType(runtime.PtrTo(typ)) +} + +func (c *Compiler) isPtrMarshalTextType(typ *runtime.Type) bool { + return !typ.Implements(marshalTextType) && runtime.PtrTo(typ).Implements(marshalTextType) +} + +func (c *Compiler) codeToOpcode(ctx *compileContext, typ *runtime.Type, code Code) *Opcode { + codes := code.ToOpcode(ctx) + codes.Last().Next = newEndOp(ctx, typ) + c.linkRecursiveCode(ctx) + return codes.First() +} + +func (c *Compiler) linkRecursiveCode(ctx *compileContext) { + recursiveCodes := map[uintptr]*CompiledCode{} + for _, recursive := range *ctx.recursiveCodes { + typeptr := uintptr(unsafe.Pointer(recursive.Type)) + codes := ctx.structTypeToCodes[typeptr] + if recursiveCode, ok := recursiveCodes[typeptr]; ok { + *recursive.Jmp = *recursiveCode + continue + } + + code := copyOpcode(codes.First()) + code.Op = code.Op.PtrHeadToHead() + lastCode := newEndOp(&compileContext{}, recursive.Type) + lastCode.Op = OpRecursiveEnd + + // OpRecursiveEnd must set before call TotalLength + code.End.Next = lastCode + + totalLength := code.TotalLength() + + // Idx, ElemIdx, Length must set after call TotalLength + lastCode.Idx = uint32((totalLength + 1) * uintptrSize) + lastCode.ElemIdx = lastCode.Idx + uintptrSize + lastCode.Length = lastCode.Idx + 2*uintptrSize + + // extend length to alloc slot for elemIdx + length + curTotalLength := uintptr(recursive.TotalLength()) + 3 + nextTotalLength := uintptr(totalLength) + 3 + + compiled := recursive.Jmp + compiled.Code = code + compiled.CurLen = curTotalLength + compiled.NextLen = nextTotalLength + compiled.Linked = true + + recursiveCodes[typeptr] = compiled + } +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go b/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go new file mode 100644 index 000000000..20c93cbf7 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go @@ -0,0 +1,32 @@ +//go:build !race +// +build !race + +package encoder + +func CompileToGetCodeSet(ctx *RuntimeContext, typeptr uintptr) (*OpcodeSet, error) { + if typeptr > typeAddr.MaxTypeAddr || typeptr < typeAddr.BaseTypeAddr { + codeSet, err := compileToGetCodeSetSlowPath(typeptr) + if err != nil { + return nil, err + } + return getFilteredCodeSetIfNeeded(ctx, codeSet) + } + index := (typeptr - typeAddr.BaseTypeAddr) >> typeAddr.AddrShift + if codeSet := cachedOpcodeSets[index]; codeSet != nil { + filtered, err := getFilteredCodeSetIfNeeded(ctx, codeSet) + if err != nil { + return nil, err + } + return filtered, nil + } + codeSet, err := newCompiler().compile(typeptr) + if err != nil { + return nil, err + } + filtered, err := getFilteredCodeSetIfNeeded(ctx, codeSet) + if err != nil { + return nil, err + } + cachedOpcodeSets[index] = codeSet + return filtered, nil +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go b/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go new file mode 100644 index 000000000..13ba23fdf --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go @@ -0,0 +1,45 @@ +//go:build race +// +build race + +package encoder + +import ( + "sync" +) + +var setsMu sync.RWMutex + +func CompileToGetCodeSet(ctx *RuntimeContext, typeptr uintptr) (*OpcodeSet, error) { + if typeptr > typeAddr.MaxTypeAddr || typeptr < typeAddr.BaseTypeAddr { + codeSet, err := compileToGetCodeSetSlowPath(typeptr) + if err != nil { + return nil, err + } + return getFilteredCodeSetIfNeeded(ctx, codeSet) + } + index := (typeptr - typeAddr.BaseTypeAddr) >> typeAddr.AddrShift + setsMu.RLock() + if codeSet := cachedOpcodeSets[index]; codeSet != nil { + filtered, err := getFilteredCodeSetIfNeeded(ctx, codeSet) + if err != nil { + setsMu.RUnlock() + return nil, err + } + setsMu.RUnlock() + return filtered, nil + } + setsMu.RUnlock() + + codeSet, err := newCompiler().compile(typeptr) + if err != nil { + return nil, err + } + filtered, err := getFilteredCodeSetIfNeeded(ctx, codeSet) + if err != nil { + return nil, err + } + setsMu.Lock() + cachedOpcodeSets[index] = codeSet + setsMu.Unlock() + return filtered, nil +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/context.go b/vendor/github.com/goccy/go-json/internal/encoder/context.go new file mode 100644 index 000000000..3833d0c86 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/context.go @@ -0,0 +1,105 @@ +package encoder + +import ( + "context" + "sync" + "unsafe" + + "github.com/goccy/go-json/internal/runtime" +) + +type compileContext struct { + opcodeIndex uint32 + ptrIndex int + indent uint32 + escapeKey bool + structTypeToCodes map[uintptr]Opcodes + recursiveCodes *Opcodes +} + +func (c *compileContext) incIndent() { + c.indent++ +} + +func (c *compileContext) decIndent() { + c.indent-- +} + +func (c *compileContext) incIndex() { + c.incOpcodeIndex() + c.incPtrIndex() +} + +func (c *compileContext) decIndex() { + c.decOpcodeIndex() + c.decPtrIndex() +} + +func (c *compileContext) incOpcodeIndex() { + c.opcodeIndex++ +} + +func (c *compileContext) decOpcodeIndex() { + c.opcodeIndex-- +} + +func (c *compileContext) incPtrIndex() { + c.ptrIndex++ +} + +func (c *compileContext) decPtrIndex() { + c.ptrIndex-- +} + +const ( + bufSize = 1024 +) + +var ( + runtimeContextPool = sync.Pool{ + New: func() interface{} { + return &RuntimeContext{ + Buf: make([]byte, 0, bufSize), + Ptrs: make([]uintptr, 128), + KeepRefs: make([]unsafe.Pointer, 0, 8), + Option: &Option{}, + } + }, + } +) + +type RuntimeContext struct { + Context context.Context + Buf []byte + MarshalBuf []byte + Ptrs []uintptr + KeepRefs []unsafe.Pointer + SeenPtr []uintptr + BaseIndent uint32 + Prefix []byte + IndentStr []byte + Option *Option +} + +func (c *RuntimeContext) Init(p uintptr, codelen int) { + if len(c.Ptrs) < codelen { + c.Ptrs = make([]uintptr, codelen) + } + c.Ptrs[0] = p + c.KeepRefs = c.KeepRefs[:0] + c.SeenPtr = c.SeenPtr[:0] + c.BaseIndent = 0 +} + +func (c *RuntimeContext) Ptr() uintptr { + header := (*runtime.SliceHeader)(unsafe.Pointer(&c.Ptrs)) + return uintptr(header.Data) +} + +func TakeRuntimeContext() *RuntimeContext { + return runtimeContextPool.Get().(*RuntimeContext) +} + +func ReleaseRuntimeContext(ctx *RuntimeContext) { + runtimeContextPool.Put(ctx) +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/decode_rune.go b/vendor/github.com/goccy/go-json/internal/encoder/decode_rune.go new file mode 100644 index 000000000..35c959d48 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/decode_rune.go @@ -0,0 +1,126 @@ +package encoder + +import "unicode/utf8" + +const ( + // The default lowest and highest continuation byte. + locb = 128 //0b10000000 + hicb = 191 //0b10111111 + + // These names of these constants are chosen to give nice alignment in the + // table below. The first nibble is an index into acceptRanges or F for + // special one-byte cases. The second nibble is the Rune length or the + // Status for the special one-byte case. + xx = 0xF1 // invalid: size 1 + as = 0xF0 // ASCII: size 1 + s1 = 0x02 // accept 0, size 2 + s2 = 0x13 // accept 1, size 3 + s3 = 0x03 // accept 0, size 3 + s4 = 0x23 // accept 2, size 3 + s5 = 0x34 // accept 3, size 4 + s6 = 0x04 // accept 0, size 4 + s7 = 0x44 // accept 4, size 4 +) + +// first is information about the first byte in a UTF-8 sequence. +var first = [256]uint8{ + // 1 2 3 4 5 6 7 8 9 A B C D E F + as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x00-0x0F + as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x10-0x1F + as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x20-0x2F + as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x30-0x3F + as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x40-0x4F + as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x50-0x5F + as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x60-0x6F + as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x70-0x7F + // 1 2 3 4 5 6 7 8 9 A B C D E F + xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, // 0x80-0x8F + xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, // 0x90-0x9F + xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, // 0xA0-0xAF + xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, // 0xB0-0xBF + xx, xx, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, // 0xC0-0xCF + s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, // 0xD0-0xDF + s2, s3, s3, s3, s3, s3, s3, s3, s3, s3, s3, s3, s3, s4, s3, s3, // 0xE0-0xEF + s5, s6, s6, s6, s7, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, // 0xF0-0xFF +} + +const ( + lineSep = byte(168) //'\u2028' + paragraphSep = byte(169) //'\u2029' +) + +type decodeRuneState int + +const ( + validUTF8State decodeRuneState = iota + runeErrorState + lineSepState + paragraphSepState +) + +func decodeRuneInString(s string) (decodeRuneState, int) { + n := len(s) + s0 := s[0] + x := first[s0] + if x >= as { + // The following code simulates an additional check for x == xx and + // handling the ASCII and invalid cases accordingly. This mask-and-or + // approach prevents an additional branch. + mask := rune(x) << 31 >> 31 // Create 0x0000 or 0xFFFF. + if rune(s[0])&^mask|utf8.RuneError&mask == utf8.RuneError { + return runeErrorState, 1 + } + return validUTF8State, 1 + } + sz := int(x & 7) + if n < sz { + return runeErrorState, 1 + } + s1 := s[1] + switch x >> 4 { + case 0: + if s1 < locb || hicb < s1 { + return runeErrorState, 1 + } + case 1: + if s1 < 0xA0 || hicb < s1 { + return runeErrorState, 1 + } + case 2: + if s1 < locb || 0x9F < s1 { + return runeErrorState, 1 + } + case 3: + if s1 < 0x90 || hicb < s1 { + return runeErrorState, 1 + } + case 4: + if s1 < locb || 0x8F < s1 { + return runeErrorState, 1 + } + } + if sz <= 2 { + return validUTF8State, 2 + } + s2 := s[2] + if s2 < locb || hicb < s2 { + return runeErrorState, 1 + } + if sz <= 3 { + // separator character prefixes: [2]byte{226, 128} + if s0 == 226 && s1 == 128 { + switch s2 { + case lineSep: + return lineSepState, 3 + case paragraphSep: + return paragraphSepState, 3 + } + } + return validUTF8State, 3 + } + s3 := s[3] + if s3 < locb || hicb < s3 { + return runeErrorState, 1 + } + return validUTF8State, 4 +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/encoder.go b/vendor/github.com/goccy/go-json/internal/encoder/encoder.go new file mode 100644 index 000000000..14eb6a0d6 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/encoder.go @@ -0,0 +1,596 @@ +package encoder + +import ( + "bytes" + "encoding" + "encoding/base64" + "encoding/json" + "fmt" + "math" + "reflect" + "strconv" + "strings" + "sync" + "unsafe" + + "github.com/goccy/go-json/internal/errors" + "github.com/goccy/go-json/internal/runtime" +) + +func (t OpType) IsMultipleOpHead() bool { + switch t { + case OpStructHead: + return true + case OpStructHeadSlice: + return true + case OpStructHeadArray: + return true + case OpStructHeadMap: + return true + case OpStructHeadStruct: + return true + case OpStructHeadOmitEmpty: + return true + case OpStructHeadOmitEmptySlice: + return true + case OpStructHeadOmitEmptyArray: + return true + case OpStructHeadOmitEmptyMap: + return true + case OpStructHeadOmitEmptyStruct: + return true + case OpStructHeadSlicePtr: + return true + case OpStructHeadOmitEmptySlicePtr: + return true + case OpStructHeadArrayPtr: + return true + case OpStructHeadOmitEmptyArrayPtr: + return true + case OpStructHeadMapPtr: + return true + case OpStructHeadOmitEmptyMapPtr: + return true + } + return false +} + +func (t OpType) IsMultipleOpField() bool { + switch t { + case OpStructField: + return true + case OpStructFieldSlice: + return true + case OpStructFieldArray: + return true + case OpStructFieldMap: + return true + case OpStructFieldStruct: + return true + case OpStructFieldOmitEmpty: + return true + case OpStructFieldOmitEmptySlice: + return true + case OpStructFieldOmitEmptyArray: + return true + case OpStructFieldOmitEmptyMap: + return true + case OpStructFieldOmitEmptyStruct: + return true + case OpStructFieldSlicePtr: + return true + case OpStructFieldOmitEmptySlicePtr: + return true + case OpStructFieldArrayPtr: + return true + case OpStructFieldOmitEmptyArrayPtr: + return true + case OpStructFieldMapPtr: + return true + case OpStructFieldOmitEmptyMapPtr: + return true + } + return false +} + +type OpcodeSet struct { + Type *runtime.Type + NoescapeKeyCode *Opcode + EscapeKeyCode *Opcode + InterfaceNoescapeKeyCode *Opcode + InterfaceEscapeKeyCode *Opcode + CodeLength int + EndCode *Opcode + Code Code + QueryCache map[string]*OpcodeSet + cacheMu sync.RWMutex +} + +func (s *OpcodeSet) getQueryCache(hash string) *OpcodeSet { + s.cacheMu.RLock() + codeSet := s.QueryCache[hash] + s.cacheMu.RUnlock() + return codeSet +} + +func (s *OpcodeSet) setQueryCache(hash string, codeSet *OpcodeSet) { + s.cacheMu.Lock() + s.QueryCache[hash] = codeSet + s.cacheMu.Unlock() +} + +type CompiledCode struct { + Code *Opcode + Linked bool // whether recursive code already have linked + CurLen uintptr + NextLen uintptr +} + +const StartDetectingCyclesAfter = 1000 + +func Load(base uintptr, idx uintptr) uintptr { + addr := base + idx + return **(**uintptr)(unsafe.Pointer(&addr)) +} + +func Store(base uintptr, idx uintptr, p uintptr) { + addr := base + idx + **(**uintptr)(unsafe.Pointer(&addr)) = p +} + +func LoadNPtr(base uintptr, idx uintptr, ptrNum int) uintptr { + addr := base + idx + p := **(**uintptr)(unsafe.Pointer(&addr)) + if p == 0 { + return 0 + } + return PtrToPtr(p) + /* + for i := 0; i < ptrNum; i++ { + if p == 0 { + return p + } + p = PtrToPtr(p) + } + return p + */ +} + +func PtrToUint64(p uintptr) uint64 { return **(**uint64)(unsafe.Pointer(&p)) } +func PtrToFloat32(p uintptr) float32 { return **(**float32)(unsafe.Pointer(&p)) } +func PtrToFloat64(p uintptr) float64 { return **(**float64)(unsafe.Pointer(&p)) } +func PtrToBool(p uintptr) bool { return **(**bool)(unsafe.Pointer(&p)) } +func PtrToBytes(p uintptr) []byte { return **(**[]byte)(unsafe.Pointer(&p)) } +func PtrToNumber(p uintptr) json.Number { return **(**json.Number)(unsafe.Pointer(&p)) } +func PtrToString(p uintptr) string { return **(**string)(unsafe.Pointer(&p)) } +func PtrToSlice(p uintptr) *runtime.SliceHeader { return *(**runtime.SliceHeader)(unsafe.Pointer(&p)) } +func PtrToPtr(p uintptr) uintptr { + return uintptr(**(**unsafe.Pointer)(unsafe.Pointer(&p))) +} +func PtrToNPtr(p uintptr, ptrNum int) uintptr { + for i := 0; i < ptrNum; i++ { + if p == 0 { + return 0 + } + p = PtrToPtr(p) + } + return p +} + +func PtrToUnsafePtr(p uintptr) unsafe.Pointer { + return *(*unsafe.Pointer)(unsafe.Pointer(&p)) +} +func PtrToInterface(code *Opcode, p uintptr) interface{} { + return *(*interface{})(unsafe.Pointer(&emptyInterface{ + typ: code.Type, + ptr: *(*unsafe.Pointer)(unsafe.Pointer(&p)), + })) +} + +func ErrUnsupportedValue(code *Opcode, ptr uintptr) *errors.UnsupportedValueError { + v := *(*interface{})(unsafe.Pointer(&emptyInterface{ + typ: code.Type, + ptr: *(*unsafe.Pointer)(unsafe.Pointer(&ptr)), + })) + return &errors.UnsupportedValueError{ + Value: reflect.ValueOf(v), + Str: fmt.Sprintf("encountered a cycle via %s", code.Type), + } +} + +func ErrUnsupportedFloat(v float64) *errors.UnsupportedValueError { + return &errors.UnsupportedValueError{ + Value: reflect.ValueOf(v), + Str: strconv.FormatFloat(v, 'g', -1, 64), + } +} + +func ErrMarshalerWithCode(code *Opcode, err error) *errors.MarshalerError { + return &errors.MarshalerError{ + Type: runtime.RType2Type(code.Type), + Err: err, + } +} + +type emptyInterface struct { + typ *runtime.Type + ptr unsafe.Pointer +} + +type MapItem struct { + Key []byte + Value []byte +} + +type Mapslice struct { + Items []MapItem +} + +func (m *Mapslice) Len() int { + return len(m.Items) +} + +func (m *Mapslice) Less(i, j int) bool { + return bytes.Compare(m.Items[i].Key, m.Items[j].Key) < 0 +} + +func (m *Mapslice) Swap(i, j int) { + m.Items[i], m.Items[j] = m.Items[j], m.Items[i] +} + +//nolint:structcheck,unused +type mapIter struct { + key unsafe.Pointer + elem unsafe.Pointer + t unsafe.Pointer + h unsafe.Pointer + buckets unsafe.Pointer + bptr unsafe.Pointer + overflow unsafe.Pointer + oldoverflow unsafe.Pointer + startBucket uintptr + offset uint8 + wrapped bool + B uint8 + i uint8 + bucket uintptr + checkBucket uintptr +} + +type MapContext struct { + Start int + First int + Idx int + Slice *Mapslice + Buf []byte + Len int + Iter mapIter +} + +var mapContextPool = sync.Pool{ + New: func() interface{} { + return &MapContext{ + Slice: &Mapslice{}, + } + }, +} + +func NewMapContext(mapLen int, unorderedMap bool) *MapContext { + ctx := mapContextPool.Get().(*MapContext) + if !unorderedMap { + if len(ctx.Slice.Items) < mapLen { + ctx.Slice.Items = make([]MapItem, mapLen) + } else { + ctx.Slice.Items = ctx.Slice.Items[:mapLen] + } + } + ctx.Buf = ctx.Buf[:0] + ctx.Iter = mapIter{} + ctx.Idx = 0 + ctx.Len = mapLen + return ctx +} + +func ReleaseMapContext(c *MapContext) { + mapContextPool.Put(c) +} + +//go:linkname MapIterInit runtime.mapiterinit +//go:noescape +func MapIterInit(mapType *runtime.Type, m unsafe.Pointer, it *mapIter) + +//go:linkname MapIterKey reflect.mapiterkey +//go:noescape +func MapIterKey(it *mapIter) unsafe.Pointer + +//go:linkname MapIterNext reflect.mapiternext +//go:noescape +func MapIterNext(it *mapIter) + +//go:linkname MapLen reflect.maplen +//go:noescape +func MapLen(m unsafe.Pointer) int + +func AppendByteSlice(_ *RuntimeContext, b []byte, src []byte) []byte { + if src == nil { + return append(b, `null`...) + } + encodedLen := base64.StdEncoding.EncodedLen(len(src)) + b = append(b, '"') + pos := len(b) + remainLen := cap(b[pos:]) + var buf []byte + if remainLen > encodedLen { + buf = b[pos : pos+encodedLen] + } else { + buf = make([]byte, encodedLen) + } + base64.StdEncoding.Encode(buf, src) + return append(append(b, buf...), '"') +} + +func AppendFloat32(_ *RuntimeContext, b []byte, v float32) []byte { + f64 := float64(v) + abs := math.Abs(f64) + fmt := byte('f') + // Note: Must use float32 comparisons for underlying float32 value to get precise cutoffs right. + if abs != 0 { + f32 := float32(abs) + if f32 < 1e-6 || f32 >= 1e21 { + fmt = 'e' + } + } + return strconv.AppendFloat(b, f64, fmt, -1, 32) +} + +func AppendFloat64(_ *RuntimeContext, b []byte, v float64) []byte { + abs := math.Abs(v) + fmt := byte('f') + // Note: Must use float32 comparisons for underlying float32 value to get precise cutoffs right. + if abs != 0 { + if abs < 1e-6 || abs >= 1e21 { + fmt = 'e' + } + } + return strconv.AppendFloat(b, v, fmt, -1, 64) +} + +func AppendBool(_ *RuntimeContext, b []byte, v bool) []byte { + if v { + return append(b, "true"...) + } + return append(b, "false"...) +} + +var ( + floatTable = [256]bool{ + '0': true, + '1': true, + '2': true, + '3': true, + '4': true, + '5': true, + '6': true, + '7': true, + '8': true, + '9': true, + '.': true, + 'e': true, + 'E': true, + '+': true, + '-': true, + } +) + +func AppendNumber(_ *RuntimeContext, b []byte, n json.Number) ([]byte, error) { + if len(n) == 0 { + return append(b, '0'), nil + } + for i := 0; i < len(n); i++ { + if !floatTable[n[i]] { + return nil, fmt.Errorf("json: invalid number literal %q", n) + } + } + b = append(b, n...) + return b, nil +} + +func AppendMarshalJSON(ctx *RuntimeContext, code *Opcode, b []byte, v interface{}) ([]byte, error) { + rv := reflect.ValueOf(v) // convert by dynamic interface type + if (code.Flags & AddrForMarshalerFlags) != 0 { + if rv.CanAddr() { + rv = rv.Addr() + } else { + newV := reflect.New(rv.Type()) + newV.Elem().Set(rv) + rv = newV + } + } + v = rv.Interface() + var bb []byte + if (code.Flags & MarshalerContextFlags) != 0 { + marshaler, ok := v.(marshalerContext) + if !ok { + return AppendNull(ctx, b), nil + } + stdctx := ctx.Option.Context + if ctx.Option.Flag&FieldQueryOption != 0 { + stdctx = SetFieldQueryToContext(stdctx, code.FieldQuery) + } + b, err := marshaler.MarshalJSON(stdctx) + if err != nil { + return nil, &errors.MarshalerError{Type: reflect.TypeOf(v), Err: err} + } + bb = b + } else { + marshaler, ok := v.(json.Marshaler) + if !ok { + return AppendNull(ctx, b), nil + } + b, err := marshaler.MarshalJSON() + if err != nil { + return nil, &errors.MarshalerError{Type: reflect.TypeOf(v), Err: err} + } + bb = b + } + marshalBuf := ctx.MarshalBuf[:0] + marshalBuf = append(append(marshalBuf, bb...), nul) + compactedBuf, err := compact(b, marshalBuf, (ctx.Option.Flag&HTMLEscapeOption) != 0) + if err != nil { + return nil, &errors.MarshalerError{Type: reflect.TypeOf(v), Err: err} + } + ctx.MarshalBuf = marshalBuf + return compactedBuf, nil +} + +func AppendMarshalJSONIndent(ctx *RuntimeContext, code *Opcode, b []byte, v interface{}) ([]byte, error) { + rv := reflect.ValueOf(v) // convert by dynamic interface type + if (code.Flags & AddrForMarshalerFlags) != 0 { + if rv.CanAddr() { + rv = rv.Addr() + } else { + newV := reflect.New(rv.Type()) + newV.Elem().Set(rv) + rv = newV + } + } + v = rv.Interface() + var bb []byte + if (code.Flags & MarshalerContextFlags) != 0 { + marshaler, ok := v.(marshalerContext) + if !ok { + return AppendNull(ctx, b), nil + } + b, err := marshaler.MarshalJSON(ctx.Option.Context) + if err != nil { + return nil, &errors.MarshalerError{Type: reflect.TypeOf(v), Err: err} + } + bb = b + } else { + marshaler, ok := v.(json.Marshaler) + if !ok { + return AppendNull(ctx, b), nil + } + b, err := marshaler.MarshalJSON() + if err != nil { + return nil, &errors.MarshalerError{Type: reflect.TypeOf(v), Err: err} + } + bb = b + } + marshalBuf := ctx.MarshalBuf[:0] + marshalBuf = append(append(marshalBuf, bb...), nul) + indentedBuf, err := doIndent( + b, + marshalBuf, + string(ctx.Prefix)+strings.Repeat(string(ctx.IndentStr), int(ctx.BaseIndent+code.Indent)), + string(ctx.IndentStr), + (ctx.Option.Flag&HTMLEscapeOption) != 0, + ) + if err != nil { + return nil, &errors.MarshalerError{Type: reflect.TypeOf(v), Err: err} + } + ctx.MarshalBuf = marshalBuf + return indentedBuf, nil +} + +func AppendMarshalText(ctx *RuntimeContext, code *Opcode, b []byte, v interface{}) ([]byte, error) { + rv := reflect.ValueOf(v) // convert by dynamic interface type + if (code.Flags & AddrForMarshalerFlags) != 0 { + if rv.CanAddr() { + rv = rv.Addr() + } else { + newV := reflect.New(rv.Type()) + newV.Elem().Set(rv) + rv = newV + } + } + v = rv.Interface() + marshaler, ok := v.(encoding.TextMarshaler) + if !ok { + return AppendNull(ctx, b), nil + } + bytes, err := marshaler.MarshalText() + if err != nil { + return nil, &errors.MarshalerError{Type: reflect.TypeOf(v), Err: err} + } + return AppendString(ctx, b, *(*string)(unsafe.Pointer(&bytes))), nil +} + +func AppendMarshalTextIndent(ctx *RuntimeContext, code *Opcode, b []byte, v interface{}) ([]byte, error) { + rv := reflect.ValueOf(v) // convert by dynamic interface type + if (code.Flags & AddrForMarshalerFlags) != 0 { + if rv.CanAddr() { + rv = rv.Addr() + } else { + newV := reflect.New(rv.Type()) + newV.Elem().Set(rv) + rv = newV + } + } + v = rv.Interface() + marshaler, ok := v.(encoding.TextMarshaler) + if !ok { + return AppendNull(ctx, b), nil + } + bytes, err := marshaler.MarshalText() + if err != nil { + return nil, &errors.MarshalerError{Type: reflect.TypeOf(v), Err: err} + } + return AppendString(ctx, b, *(*string)(unsafe.Pointer(&bytes))), nil +} + +func AppendNull(_ *RuntimeContext, b []byte) []byte { + return append(b, "null"...) +} + +func AppendComma(_ *RuntimeContext, b []byte) []byte { + return append(b, ',') +} + +func AppendCommaIndent(_ *RuntimeContext, b []byte) []byte { + return append(b, ',', '\n') +} + +func AppendStructEnd(_ *RuntimeContext, b []byte) []byte { + return append(b, '}', ',') +} + +func AppendStructEndIndent(ctx *RuntimeContext, code *Opcode, b []byte) []byte { + b = append(b, '\n') + b = append(b, ctx.Prefix...) + indentNum := ctx.BaseIndent + code.Indent - 1 + for i := uint32(0); i < indentNum; i++ { + b = append(b, ctx.IndentStr...) + } + return append(b, '}', ',', '\n') +} + +func AppendIndent(ctx *RuntimeContext, b []byte, indent uint32) []byte { + b = append(b, ctx.Prefix...) + indentNum := ctx.BaseIndent + indent + for i := uint32(0); i < indentNum; i++ { + b = append(b, ctx.IndentStr...) + } + return b +} + +func IsNilForMarshaler(v interface{}) bool { + rv := reflect.ValueOf(v) + switch rv.Kind() { + case reflect.Bool: + return !rv.Bool() + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return rv.Int() == 0 + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return rv.Uint() == 0 + case reflect.Float32, reflect.Float64: + return math.Float64bits(rv.Float()) == 0 + case reflect.Interface, reflect.Map, reflect.Ptr, reflect.Func: + return rv.IsNil() + case reflect.Slice: + return rv.IsNil() || rv.Len() == 0 + case reflect.String: + return rv.Len() == 0 + } + return false +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/indent.go b/vendor/github.com/goccy/go-json/internal/encoder/indent.go new file mode 100644 index 000000000..dfe04b5e3 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/indent.go @@ -0,0 +1,211 @@ +package encoder + +import ( + "bytes" + "fmt" + + "github.com/goccy/go-json/internal/errors" +) + +func takeIndentSrcRuntimeContext(src []byte) (*RuntimeContext, []byte) { + ctx := TakeRuntimeContext() + buf := ctx.Buf[:0] + buf = append(append(buf, src...), nul) + ctx.Buf = buf + return ctx, buf +} + +func Indent(buf *bytes.Buffer, src []byte, prefix, indentStr string) error { + if len(src) == 0 { + return errors.ErrUnexpectedEndOfJSON("", 0) + } + + srcCtx, srcBuf := takeIndentSrcRuntimeContext(src) + dstCtx := TakeRuntimeContext() + dst := dstCtx.Buf[:0] + + dst, err := indentAndWrite(buf, dst, srcBuf, prefix, indentStr) + if err != nil { + ReleaseRuntimeContext(srcCtx) + ReleaseRuntimeContext(dstCtx) + return err + } + dstCtx.Buf = dst + ReleaseRuntimeContext(srcCtx) + ReleaseRuntimeContext(dstCtx) + return nil +} + +func indentAndWrite(buf *bytes.Buffer, dst []byte, src []byte, prefix, indentStr string) ([]byte, error) { + dst, err := doIndent(dst, src, prefix, indentStr, false) + if err != nil { + return nil, err + } + if _, err := buf.Write(dst); err != nil { + return nil, err + } + return dst, nil +} + +func doIndent(dst, src []byte, prefix, indentStr string, escape bool) ([]byte, error) { + buf, cursor, err := indentValue(dst, src, 0, 0, []byte(prefix), []byte(indentStr), escape) + if err != nil { + return nil, err + } + if err := validateEndBuf(src, cursor); err != nil { + return nil, err + } + return buf, nil +} + +func indentValue( + dst []byte, + src []byte, + indentNum int, + cursor int64, + prefix []byte, + indentBytes []byte, + escape bool) ([]byte, int64, error) { + for { + switch src[cursor] { + case ' ', '\t', '\n', '\r': + cursor++ + continue + case '{': + return indentObject(dst, src, indentNum, cursor, prefix, indentBytes, escape) + case '}': + return nil, 0, errors.ErrSyntax("unexpected character '}'", cursor) + case '[': + return indentArray(dst, src, indentNum, cursor, prefix, indentBytes, escape) + case ']': + return nil, 0, errors.ErrSyntax("unexpected character ']'", cursor) + case '"': + return compactString(dst, src, cursor, escape) + case '-', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + return compactNumber(dst, src, cursor) + case 't': + return compactTrue(dst, src, cursor) + case 'f': + return compactFalse(dst, src, cursor) + case 'n': + return compactNull(dst, src, cursor) + default: + return nil, 0, errors.ErrSyntax(fmt.Sprintf("unexpected character '%c'", src[cursor]), cursor) + } + } +} + +func indentObject( + dst []byte, + src []byte, + indentNum int, + cursor int64, + prefix []byte, + indentBytes []byte, + escape bool) ([]byte, int64, error) { + if src[cursor] == '{' { + dst = append(dst, '{') + } else { + return nil, 0, errors.ErrExpected("expected { character for object value", cursor) + } + cursor = skipWhiteSpace(src, cursor+1) + if src[cursor] == '}' { + dst = append(dst, '}') + return dst, cursor + 1, nil + } + indentNum++ + var err error + for { + dst = append(append(dst, '\n'), prefix...) + for i := 0; i < indentNum; i++ { + dst = append(dst, indentBytes...) + } + cursor = skipWhiteSpace(src, cursor) + dst, cursor, err = compactString(dst, src, cursor, escape) + if err != nil { + return nil, 0, err + } + cursor = skipWhiteSpace(src, cursor) + if src[cursor] != ':' { + return nil, 0, errors.ErrSyntax( + fmt.Sprintf("invalid character '%c' after object key", src[cursor]), + cursor+1, + ) + } + dst = append(dst, ':', ' ') + dst, cursor, err = indentValue(dst, src, indentNum, cursor+1, prefix, indentBytes, escape) + if err != nil { + return nil, 0, err + } + cursor = skipWhiteSpace(src, cursor) + switch src[cursor] { + case '}': + dst = append(append(dst, '\n'), prefix...) + for i := 0; i < indentNum-1; i++ { + dst = append(dst, indentBytes...) + } + dst = append(dst, '}') + cursor++ + return dst, cursor, nil + case ',': + dst = append(dst, ',') + default: + return nil, 0, errors.ErrSyntax( + fmt.Sprintf("invalid character '%c' after object key:value pair", src[cursor]), + cursor+1, + ) + } + cursor++ + } +} + +func indentArray( + dst []byte, + src []byte, + indentNum int, + cursor int64, + prefix []byte, + indentBytes []byte, + escape bool) ([]byte, int64, error) { + if src[cursor] == '[' { + dst = append(dst, '[') + } else { + return nil, 0, errors.ErrExpected("expected [ character for array value", cursor) + } + cursor = skipWhiteSpace(src, cursor+1) + if src[cursor] == ']' { + dst = append(dst, ']') + return dst, cursor + 1, nil + } + indentNum++ + var err error + for { + dst = append(append(dst, '\n'), prefix...) + for i := 0; i < indentNum; i++ { + dst = append(dst, indentBytes...) + } + dst, cursor, err = indentValue(dst, src, indentNum, cursor, prefix, indentBytes, escape) + if err != nil { + return nil, 0, err + } + cursor = skipWhiteSpace(src, cursor) + switch src[cursor] { + case ']': + dst = append(append(dst, '\n'), prefix...) + for i := 0; i < indentNum-1; i++ { + dst = append(dst, indentBytes...) + } + dst = append(dst, ']') + cursor++ + return dst, cursor, nil + case ',': + dst = append(dst, ',') + default: + return nil, 0, errors.ErrSyntax( + fmt.Sprintf("invalid character '%c' after array value", src[cursor]), + cursor+1, + ) + } + cursor++ + } +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/int.go b/vendor/github.com/goccy/go-json/internal/encoder/int.go new file mode 100644 index 000000000..85f079609 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/int.go @@ -0,0 +1,152 @@ +package encoder + +import ( + "unsafe" +) + +var endianness int + +func init() { + var b [2]byte + *(*uint16)(unsafe.Pointer(&b)) = uint16(0xABCD) + + switch b[0] { + case 0xCD: + endianness = 0 // LE + case 0xAB: + endianness = 1 // BE + default: + panic("could not determine endianness") + } +} + +// "00010203...96979899" cast to []uint16 +var intLELookup = [100]uint16{ + 0x3030, 0x3130, 0x3230, 0x3330, 0x3430, 0x3530, 0x3630, 0x3730, 0x3830, 0x3930, + 0x3031, 0x3131, 0x3231, 0x3331, 0x3431, 0x3531, 0x3631, 0x3731, 0x3831, 0x3931, + 0x3032, 0x3132, 0x3232, 0x3332, 0x3432, 0x3532, 0x3632, 0x3732, 0x3832, 0x3932, + 0x3033, 0x3133, 0x3233, 0x3333, 0x3433, 0x3533, 0x3633, 0x3733, 0x3833, 0x3933, + 0x3034, 0x3134, 0x3234, 0x3334, 0x3434, 0x3534, 0x3634, 0x3734, 0x3834, 0x3934, + 0x3035, 0x3135, 0x3235, 0x3335, 0x3435, 0x3535, 0x3635, 0x3735, 0x3835, 0x3935, + 0x3036, 0x3136, 0x3236, 0x3336, 0x3436, 0x3536, 0x3636, 0x3736, 0x3836, 0x3936, + 0x3037, 0x3137, 0x3237, 0x3337, 0x3437, 0x3537, 0x3637, 0x3737, 0x3837, 0x3937, + 0x3038, 0x3138, 0x3238, 0x3338, 0x3438, 0x3538, 0x3638, 0x3738, 0x3838, 0x3938, + 0x3039, 0x3139, 0x3239, 0x3339, 0x3439, 0x3539, 0x3639, 0x3739, 0x3839, 0x3939, +} + +var intBELookup = [100]uint16{ + 0x3030, 0x3031, 0x3032, 0x3033, 0x3034, 0x3035, 0x3036, 0x3037, 0x3038, 0x3039, + 0x3130, 0x3131, 0x3132, 0x3133, 0x3134, 0x3135, 0x3136, 0x3137, 0x3138, 0x3139, + 0x3230, 0x3231, 0x3232, 0x3233, 0x3234, 0x3235, 0x3236, 0x3237, 0x3238, 0x3239, + 0x3330, 0x3331, 0x3332, 0x3333, 0x3334, 0x3335, 0x3336, 0x3337, 0x3338, 0x3339, + 0x3430, 0x3431, 0x3432, 0x3433, 0x3434, 0x3435, 0x3436, 0x3437, 0x3438, 0x3439, + 0x3530, 0x3531, 0x3532, 0x3533, 0x3534, 0x3535, 0x3536, 0x3537, 0x3538, 0x3539, + 0x3630, 0x3631, 0x3632, 0x3633, 0x3634, 0x3635, 0x3636, 0x3637, 0x3638, 0x3639, + 0x3730, 0x3731, 0x3732, 0x3733, 0x3734, 0x3735, 0x3736, 0x3737, 0x3738, 0x3739, + 0x3830, 0x3831, 0x3832, 0x3833, 0x3834, 0x3835, 0x3836, 0x3837, 0x3838, 0x3839, + 0x3930, 0x3931, 0x3932, 0x3933, 0x3934, 0x3935, 0x3936, 0x3937, 0x3938, 0x3939, +} + +var intLookup = [2]*[100]uint16{&intLELookup, &intBELookup} + +func numMask(numBitSize uint8) uint64 { + return 1<<numBitSize - 1 +} + +func AppendInt(_ *RuntimeContext, out []byte, p uintptr, code *Opcode) []byte { + var u64 uint64 + switch code.NumBitSize { + case 8: + u64 = (uint64)(**(**uint8)(unsafe.Pointer(&p))) + case 16: + u64 = (uint64)(**(**uint16)(unsafe.Pointer(&p))) + case 32: + u64 = (uint64)(**(**uint32)(unsafe.Pointer(&p))) + case 64: + u64 = **(**uint64)(unsafe.Pointer(&p)) + } + mask := numMask(code.NumBitSize) + n := u64 & mask + negative := (u64>>(code.NumBitSize-1))&1 == 1 + if !negative { + if n < 10 { + return append(out, byte(n+'0')) + } else if n < 100 { + u := intLELookup[n] + return append(out, byte(u), byte(u>>8)) + } + } else { + n = -n & mask + } + + lookup := intLookup[endianness] + + var b [22]byte + u := (*[11]uint16)(unsafe.Pointer(&b)) + i := 11 + + for n >= 100 { + j := n % 100 + n /= 100 + i-- + u[i] = lookup[j] + } + + i-- + u[i] = lookup[n] + + i *= 2 // convert to byte index + if n < 10 { + i++ // remove leading zero + } + if negative { + i-- + b[i] = '-' + } + + return append(out, b[i:]...) +} + +func AppendUint(_ *RuntimeContext, out []byte, p uintptr, code *Opcode) []byte { + var u64 uint64 + switch code.NumBitSize { + case 8: + u64 = (uint64)(**(**uint8)(unsafe.Pointer(&p))) + case 16: + u64 = (uint64)(**(**uint16)(unsafe.Pointer(&p))) + case 32: + u64 = (uint64)(**(**uint32)(unsafe.Pointer(&p))) + case 64: + u64 = **(**uint64)(unsafe.Pointer(&p)) + } + mask := numMask(code.NumBitSize) + n := u64 & mask + if n < 10 { + return append(out, byte(n+'0')) + } else if n < 100 { + u := intLELookup[n] + return append(out, byte(u), byte(u>>8)) + } + + lookup := intLookup[endianness] + + var b [22]byte + u := (*[11]uint16)(unsafe.Pointer(&b)) + i := 11 + + for n >= 100 { + j := n % 100 + n /= 100 + i-- + u[i] = lookup[j] + } + + i-- + u[i] = lookup[n] + + i *= 2 // convert to byte index + if n < 10 { + i++ // remove leading zero + } + return append(out, b[i:]...) +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/map112.go b/vendor/github.com/goccy/go-json/internal/encoder/map112.go new file mode 100644 index 000000000..e96ffadf7 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/map112.go @@ -0,0 +1,9 @@ +//go:build !go1.13 +// +build !go1.13 + +package encoder + +import "unsafe" + +//go:linkname MapIterValue reflect.mapitervalue +func MapIterValue(it *mapIter) unsafe.Pointer diff --git a/vendor/github.com/goccy/go-json/internal/encoder/map113.go b/vendor/github.com/goccy/go-json/internal/encoder/map113.go new file mode 100644 index 000000000..9b69dcc36 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/map113.go @@ -0,0 +1,9 @@ +//go:build go1.13 +// +build go1.13 + +package encoder + +import "unsafe" + +//go:linkname MapIterValue reflect.mapiterelem +func MapIterValue(it *mapIter) unsafe.Pointer diff --git a/vendor/github.com/goccy/go-json/internal/encoder/opcode.go b/vendor/github.com/goccy/go-json/internal/encoder/opcode.go new file mode 100644 index 000000000..05fc3ce04 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/opcode.go @@ -0,0 +1,669 @@ +package encoder + +import ( + "fmt" + "strings" + "unsafe" + + "github.com/goccy/go-json/internal/runtime" +) + +const uintptrSize = 4 << (^uintptr(0) >> 63) + +type OpFlags uint16 + +const ( + AnonymousHeadFlags OpFlags = 1 << 0 + AnonymousKeyFlags OpFlags = 1 << 1 + IndirectFlags OpFlags = 1 << 2 + IsTaggedKeyFlags OpFlags = 1 << 3 + NilCheckFlags OpFlags = 1 << 4 + AddrForMarshalerFlags OpFlags = 1 << 5 + IsNextOpPtrTypeFlags OpFlags = 1 << 6 + IsNilableTypeFlags OpFlags = 1 << 7 + MarshalerContextFlags OpFlags = 1 << 8 + NonEmptyInterfaceFlags OpFlags = 1 << 9 +) + +type Opcode struct { + Op OpType // operation type + Idx uint32 // offset to access ptr + Next *Opcode // next opcode + End *Opcode // array/slice/struct/map end + NextField *Opcode // next struct field + Key string // struct field key + Offset uint32 // offset size from struct header + PtrNum uint8 // pointer number: e.g. double pointer is 2. + NumBitSize uint8 + Flags OpFlags + + Type *runtime.Type // go type + Jmp *CompiledCode // for recursive call + FieldQuery *FieldQuery // field query for Interface / MarshalJSON / MarshalText + ElemIdx uint32 // offset to access array/slice elem + Length uint32 // offset to access slice length or array length + Indent uint32 // indent number + Size uint32 // array/slice elem size + DisplayIdx uint32 // opcode index + DisplayKey string // key text to display +} + +func (c *Opcode) Validate() error { + var prevIdx uint32 + for code := c; !code.IsEnd(); { + if prevIdx != 0 { + if code.DisplayIdx != prevIdx+1 { + return fmt.Errorf( + "invalid index. previous display index is %d but next is %d. dump = %s", + prevIdx, code.DisplayIdx, c.Dump(), + ) + } + } + prevIdx = code.DisplayIdx + code = code.IterNext() + } + return nil +} + +func (c *Opcode) IterNext() *Opcode { + if c == nil { + return nil + } + switch c.Op.CodeType() { + case CodeArrayElem, CodeSliceElem, CodeMapKey: + return c.End + default: + return c.Next + } +} + +func (c *Opcode) IsEnd() bool { + if c == nil { + return true + } + return c.Op == OpEnd || c.Op == OpInterfaceEnd || c.Op == OpRecursiveEnd +} + +func (c *Opcode) MaxIdx() uint32 { + max := uint32(0) + for _, value := range []uint32{ + c.Idx, + c.ElemIdx, + c.Length, + c.Size, + } { + if max < value { + max = value + } + } + return max +} + +func (c *Opcode) ToHeaderType(isString bool) OpType { + switch c.Op { + case OpInt: + if isString { + return OpStructHeadIntString + } + return OpStructHeadInt + case OpIntPtr: + if isString { + return OpStructHeadIntPtrString + } + return OpStructHeadIntPtr + case OpUint: + if isString { + return OpStructHeadUintString + } + return OpStructHeadUint + case OpUintPtr: + if isString { + return OpStructHeadUintPtrString + } + return OpStructHeadUintPtr + case OpFloat32: + if isString { + return OpStructHeadFloat32String + } + return OpStructHeadFloat32 + case OpFloat32Ptr: + if isString { + return OpStructHeadFloat32PtrString + } + return OpStructHeadFloat32Ptr + case OpFloat64: + if isString { + return OpStructHeadFloat64String + } + return OpStructHeadFloat64 + case OpFloat64Ptr: + if isString { + return OpStructHeadFloat64PtrString + } + return OpStructHeadFloat64Ptr + case OpString: + if isString { + return OpStructHeadStringString + } + return OpStructHeadString + case OpStringPtr: + if isString { + return OpStructHeadStringPtrString + } + return OpStructHeadStringPtr + case OpNumber: + if isString { + return OpStructHeadNumberString + } + return OpStructHeadNumber + case OpNumberPtr: + if isString { + return OpStructHeadNumberPtrString + } + return OpStructHeadNumberPtr + case OpBool: + if isString { + return OpStructHeadBoolString + } + return OpStructHeadBool + case OpBoolPtr: + if isString { + return OpStructHeadBoolPtrString + } + return OpStructHeadBoolPtr + case OpBytes: + return OpStructHeadBytes + case OpBytesPtr: + return OpStructHeadBytesPtr + case OpMap: + return OpStructHeadMap + case OpMapPtr: + c.Op = OpMap + return OpStructHeadMapPtr + case OpArray: + return OpStructHeadArray + case OpArrayPtr: + c.Op = OpArray + return OpStructHeadArrayPtr + case OpSlice: + return OpStructHeadSlice + case OpSlicePtr: + c.Op = OpSlice + return OpStructHeadSlicePtr + case OpMarshalJSON: + return OpStructHeadMarshalJSON + case OpMarshalJSONPtr: + return OpStructHeadMarshalJSONPtr + case OpMarshalText: + return OpStructHeadMarshalText + case OpMarshalTextPtr: + return OpStructHeadMarshalTextPtr + } + return OpStructHead +} + +func (c *Opcode) ToFieldType(isString bool) OpType { + switch c.Op { + case OpInt: + if isString { + return OpStructFieldIntString + } + return OpStructFieldInt + case OpIntPtr: + if isString { + return OpStructFieldIntPtrString + } + return OpStructFieldIntPtr + case OpUint: + if isString { + return OpStructFieldUintString + } + return OpStructFieldUint + case OpUintPtr: + if isString { + return OpStructFieldUintPtrString + } + return OpStructFieldUintPtr + case OpFloat32: + if isString { + return OpStructFieldFloat32String + } + return OpStructFieldFloat32 + case OpFloat32Ptr: + if isString { + return OpStructFieldFloat32PtrString + } + return OpStructFieldFloat32Ptr + case OpFloat64: + if isString { + return OpStructFieldFloat64String + } + return OpStructFieldFloat64 + case OpFloat64Ptr: + if isString { + return OpStructFieldFloat64PtrString + } + return OpStructFieldFloat64Ptr + case OpString: + if isString { + return OpStructFieldStringString + } + return OpStructFieldString + case OpStringPtr: + if isString { + return OpStructFieldStringPtrString + } + return OpStructFieldStringPtr + case OpNumber: + if isString { + return OpStructFieldNumberString + } + return OpStructFieldNumber + case OpNumberPtr: + if isString { + return OpStructFieldNumberPtrString + } + return OpStructFieldNumberPtr + case OpBool: + if isString { + return OpStructFieldBoolString + } + return OpStructFieldBool + case OpBoolPtr: + if isString { + return OpStructFieldBoolPtrString + } + return OpStructFieldBoolPtr + case OpBytes: + return OpStructFieldBytes + case OpBytesPtr: + return OpStructFieldBytesPtr + case OpMap: + return OpStructFieldMap + case OpMapPtr: + c.Op = OpMap + return OpStructFieldMapPtr + case OpArray: + return OpStructFieldArray + case OpArrayPtr: + c.Op = OpArray + return OpStructFieldArrayPtr + case OpSlice: + return OpStructFieldSlice + case OpSlicePtr: + c.Op = OpSlice + return OpStructFieldSlicePtr + case OpMarshalJSON: + return OpStructFieldMarshalJSON + case OpMarshalJSONPtr: + return OpStructFieldMarshalJSONPtr + case OpMarshalText: + return OpStructFieldMarshalText + case OpMarshalTextPtr: + return OpStructFieldMarshalTextPtr + } + return OpStructField +} + +func newOpCode(ctx *compileContext, typ *runtime.Type, op OpType) *Opcode { + return newOpCodeWithNext(ctx, typ, op, newEndOp(ctx, typ)) +} + +func opcodeOffset(idx int) uint32 { + return uint32(idx) * uintptrSize +} + +func getCodeAddrByIdx(head *Opcode, idx uint32) *Opcode { + addr := uintptr(unsafe.Pointer(head)) + uintptr(idx)*unsafe.Sizeof(Opcode{}) + return *(**Opcode)(unsafe.Pointer(&addr)) +} + +func copyOpcode(code *Opcode) *Opcode { + codeNum := ToEndCode(code).DisplayIdx + 1 + codeSlice := make([]Opcode, codeNum) + head := (*Opcode)((*runtime.SliceHeader)(unsafe.Pointer(&codeSlice)).Data) + ptr := head + c := code + for { + *ptr = Opcode{ + Op: c.Op, + Key: c.Key, + PtrNum: c.PtrNum, + NumBitSize: c.NumBitSize, + Flags: c.Flags, + Idx: c.Idx, + Offset: c.Offset, + Type: c.Type, + FieldQuery: c.FieldQuery, + DisplayIdx: c.DisplayIdx, + DisplayKey: c.DisplayKey, + ElemIdx: c.ElemIdx, + Length: c.Length, + Size: c.Size, + Indent: c.Indent, + Jmp: c.Jmp, + } + if c.End != nil { + ptr.End = getCodeAddrByIdx(head, c.End.DisplayIdx) + } + if c.NextField != nil { + ptr.NextField = getCodeAddrByIdx(head, c.NextField.DisplayIdx) + } + if c.Next != nil { + ptr.Next = getCodeAddrByIdx(head, c.Next.DisplayIdx) + } + if c.IsEnd() { + break + } + ptr = getCodeAddrByIdx(head, c.DisplayIdx+1) + c = c.IterNext() + } + return head +} + +func setTotalLengthToInterfaceOp(code *Opcode) { + for c := code; !c.IsEnd(); { + if c.Op == OpInterface || c.Op == OpInterfacePtr { + c.Length = uint32(code.TotalLength()) + } + c = c.IterNext() + } +} + +func ToEndCode(code *Opcode) *Opcode { + c := code + for !c.IsEnd() { + c = c.IterNext() + } + return c +} + +func copyToInterfaceOpcode(code *Opcode) *Opcode { + copied := copyOpcode(code) + c := copied + c = ToEndCode(c) + c.Idx += uintptrSize + c.ElemIdx = c.Idx + uintptrSize + c.Length = c.Idx + 2*uintptrSize + c.Op = OpInterfaceEnd + return copied +} + +func newOpCodeWithNext(ctx *compileContext, typ *runtime.Type, op OpType, next *Opcode) *Opcode { + return &Opcode{ + Op: op, + Idx: opcodeOffset(ctx.ptrIndex), + Next: next, + Type: typ, + DisplayIdx: ctx.opcodeIndex, + Indent: ctx.indent, + } +} + +func newEndOp(ctx *compileContext, typ *runtime.Type) *Opcode { + return newOpCodeWithNext(ctx, typ, OpEnd, nil) +} + +func (c *Opcode) TotalLength() int { + var idx int + code := c + for !code.IsEnd() { + maxIdx := int(code.MaxIdx() / uintptrSize) + if idx < maxIdx { + idx = maxIdx + } + if code.Op == OpRecursiveEnd { + break + } + code = code.IterNext() + } + maxIdx := int(code.MaxIdx() / uintptrSize) + if idx < maxIdx { + idx = maxIdx + } + return idx + 1 +} + +func (c *Opcode) dumpHead(code *Opcode) string { + var length uint32 + if code.Op.CodeType() == CodeArrayHead { + length = code.Length + } else { + length = code.Length / uintptrSize + } + return fmt.Sprintf( + `[%03d]%s%s ([idx:%d][elemIdx:%d][length:%d])`, + code.DisplayIdx, + strings.Repeat("-", int(code.Indent)), + code.Op, + code.Idx/uintptrSize, + code.ElemIdx/uintptrSize, + length, + ) +} + +func (c *Opcode) dumpMapHead(code *Opcode) string { + return fmt.Sprintf( + `[%03d]%s%s ([idx:%d])`, + code.DisplayIdx, + strings.Repeat("-", int(code.Indent)), + code.Op, + code.Idx/uintptrSize, + ) +} + +func (c *Opcode) dumpMapEnd(code *Opcode) string { + return fmt.Sprintf( + `[%03d]%s%s ([idx:%d])`, + code.DisplayIdx, + strings.Repeat("-", int(code.Indent)), + code.Op, + code.Idx/uintptrSize, + ) +} + +func (c *Opcode) dumpElem(code *Opcode) string { + var length uint32 + if code.Op.CodeType() == CodeArrayElem { + length = code.Length + } else { + length = code.Length / uintptrSize + } + return fmt.Sprintf( + `[%03d]%s%s ([idx:%d][elemIdx:%d][length:%d][size:%d])`, + code.DisplayIdx, + strings.Repeat("-", int(code.Indent)), + code.Op, + code.Idx/uintptrSize, + code.ElemIdx/uintptrSize, + length, + code.Size, + ) +} + +func (c *Opcode) dumpField(code *Opcode) string { + return fmt.Sprintf( + `[%03d]%s%s ([idx:%d][key:%s][offset:%d])`, + code.DisplayIdx, + strings.Repeat("-", int(code.Indent)), + code.Op, + code.Idx/uintptrSize, + code.DisplayKey, + code.Offset, + ) +} + +func (c *Opcode) dumpKey(code *Opcode) string { + return fmt.Sprintf( + `[%03d]%s%s ([idx:%d])`, + code.DisplayIdx, + strings.Repeat("-", int(code.Indent)), + code.Op, + code.Idx/uintptrSize, + ) +} + +func (c *Opcode) dumpValue(code *Opcode) string { + return fmt.Sprintf( + `[%03d]%s%s ([idx:%d])`, + code.DisplayIdx, + strings.Repeat("-", int(code.Indent)), + code.Op, + code.Idx/uintptrSize, + ) +} + +func (c *Opcode) Dump() string { + codes := []string{} + for code := c; !code.IsEnd(); { + switch code.Op.CodeType() { + case CodeSliceHead: + codes = append(codes, c.dumpHead(code)) + code = code.Next + case CodeMapHead: + codes = append(codes, c.dumpMapHead(code)) + code = code.Next + case CodeArrayElem, CodeSliceElem: + codes = append(codes, c.dumpElem(code)) + code = code.End + case CodeMapKey: + codes = append(codes, c.dumpKey(code)) + code = code.End + case CodeMapValue: + codes = append(codes, c.dumpValue(code)) + code = code.Next + case CodeMapEnd: + codes = append(codes, c.dumpMapEnd(code)) + code = code.Next + case CodeStructField: + codes = append(codes, c.dumpField(code)) + code = code.Next + case CodeStructEnd: + codes = append(codes, c.dumpField(code)) + code = code.Next + default: + codes = append(codes, fmt.Sprintf( + "[%03d]%s%s ([idx:%d])", + code.DisplayIdx, + strings.Repeat("-", int(code.Indent)), + code.Op, + code.Idx/uintptrSize, + )) + code = code.Next + } + } + return strings.Join(codes, "\n") +} + +func newSliceHeaderCode(ctx *compileContext, typ *runtime.Type) *Opcode { + idx := opcodeOffset(ctx.ptrIndex) + ctx.incPtrIndex() + elemIdx := opcodeOffset(ctx.ptrIndex) + ctx.incPtrIndex() + length := opcodeOffset(ctx.ptrIndex) + return &Opcode{ + Op: OpSlice, + Type: typ, + Idx: idx, + DisplayIdx: ctx.opcodeIndex, + ElemIdx: elemIdx, + Length: length, + Indent: ctx.indent, + } +} + +func newSliceElemCode(ctx *compileContext, typ *runtime.Type, head *Opcode, size uintptr) *Opcode { + return &Opcode{ + Op: OpSliceElem, + Type: typ, + Idx: head.Idx, + DisplayIdx: ctx.opcodeIndex, + ElemIdx: head.ElemIdx, + Length: head.Length, + Indent: ctx.indent, + Size: uint32(size), + } +} + +func newArrayHeaderCode(ctx *compileContext, typ *runtime.Type, alen int) *Opcode { + idx := opcodeOffset(ctx.ptrIndex) + ctx.incPtrIndex() + elemIdx := opcodeOffset(ctx.ptrIndex) + return &Opcode{ + Op: OpArray, + Type: typ, + Idx: idx, + DisplayIdx: ctx.opcodeIndex, + ElemIdx: elemIdx, + Indent: ctx.indent, + Length: uint32(alen), + } +} + +func newArrayElemCode(ctx *compileContext, typ *runtime.Type, head *Opcode, length int, size uintptr) *Opcode { + return &Opcode{ + Op: OpArrayElem, + Type: typ, + Idx: head.Idx, + DisplayIdx: ctx.opcodeIndex, + ElemIdx: head.ElemIdx, + Length: uint32(length), + Indent: ctx.indent, + Size: uint32(size), + } +} + +func newMapHeaderCode(ctx *compileContext, typ *runtime.Type) *Opcode { + idx := opcodeOffset(ctx.ptrIndex) + ctx.incPtrIndex() + return &Opcode{ + Op: OpMap, + Type: typ, + Idx: idx, + DisplayIdx: ctx.opcodeIndex, + Indent: ctx.indent, + } +} + +func newMapKeyCode(ctx *compileContext, typ *runtime.Type, head *Opcode) *Opcode { + return &Opcode{ + Op: OpMapKey, + Type: typ, + Idx: head.Idx, + DisplayIdx: ctx.opcodeIndex, + Indent: ctx.indent, + } +} + +func newMapValueCode(ctx *compileContext, typ *runtime.Type, head *Opcode) *Opcode { + return &Opcode{ + Op: OpMapValue, + Type: typ, + Idx: head.Idx, + DisplayIdx: ctx.opcodeIndex, + Indent: ctx.indent, + } +} + +func newMapEndCode(ctx *compileContext, typ *runtime.Type, head *Opcode) *Opcode { + return &Opcode{ + Op: OpMapEnd, + Type: typ, + Idx: head.Idx, + DisplayIdx: ctx.opcodeIndex, + Indent: ctx.indent, + Next: newEndOp(ctx, typ), + } +} + +func newRecursiveCode(ctx *compileContext, typ *runtime.Type, jmp *CompiledCode) *Opcode { + return &Opcode{ + Op: OpRecursive, + Type: typ, + Idx: opcodeOffset(ctx.ptrIndex), + Next: newEndOp(ctx, typ), + DisplayIdx: ctx.opcodeIndex, + Indent: ctx.indent, + Jmp: jmp, + } +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/option.go b/vendor/github.com/goccy/go-json/internal/encoder/option.go new file mode 100644 index 000000000..82d5ce3e7 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/option.go @@ -0,0 +1,47 @@ +package encoder + +import ( + "context" + "io" +) + +type OptionFlag uint8 + +const ( + HTMLEscapeOption OptionFlag = 1 << iota + IndentOption + UnorderedMapOption + DebugOption + ColorizeOption + ContextOption + NormalizeUTF8Option + FieldQueryOption +) + +type Option struct { + Flag OptionFlag + ColorScheme *ColorScheme + Context context.Context + DebugOut io.Writer +} + +type EncodeFormat struct { + Header string + Footer string +} + +type EncodeFormatScheme struct { + Int EncodeFormat + Uint EncodeFormat + Float EncodeFormat + Bool EncodeFormat + String EncodeFormat + Binary EncodeFormat + ObjectKey EncodeFormat + Null EncodeFormat +} + +type ( + ColorScheme = EncodeFormatScheme + ColorFormat = EncodeFormat +) diff --git a/vendor/github.com/goccy/go-json/internal/encoder/optype.go b/vendor/github.com/goccy/go-json/internal/encoder/optype.go new file mode 100644 index 000000000..5c1241b47 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/optype.go @@ -0,0 +1,932 @@ +// Code generated by internal/cmd/generator. DO NOT EDIT! +package encoder + +import ( + "strings" +) + +type CodeType int + +const ( + CodeOp CodeType = 0 + CodeArrayHead CodeType = 1 + CodeArrayElem CodeType = 2 + CodeSliceHead CodeType = 3 + CodeSliceElem CodeType = 4 + CodeMapHead CodeType = 5 + CodeMapKey CodeType = 6 + CodeMapValue CodeType = 7 + CodeMapEnd CodeType = 8 + CodeRecursive CodeType = 9 + CodeStructField CodeType = 10 + CodeStructEnd CodeType = 11 +) + +var opTypeStrings = [400]string{ + "End", + "Interface", + "Ptr", + "SliceElem", + "SliceEnd", + "ArrayElem", + "ArrayEnd", + "MapKey", + "MapValue", + "MapEnd", + "Recursive", + "RecursivePtr", + "RecursiveEnd", + "InterfaceEnd", + "Int", + "Uint", + "Float32", + "Float64", + "Bool", + "String", + "Bytes", + "Number", + "Array", + "Map", + "Slice", + "Struct", + "MarshalJSON", + "MarshalText", + "IntString", + "UintString", + "Float32String", + "Float64String", + "BoolString", + "StringString", + "NumberString", + "IntPtr", + "UintPtr", + "Float32Ptr", + "Float64Ptr", + "BoolPtr", + "StringPtr", + "BytesPtr", + "NumberPtr", + "ArrayPtr", + "MapPtr", + "SlicePtr", + "MarshalJSONPtr", + "MarshalTextPtr", + "InterfacePtr", + "IntPtrString", + "UintPtrString", + "Float32PtrString", + "Float64PtrString", + "BoolPtrString", + "StringPtrString", + "NumberPtrString", + "StructHeadInt", + "StructHeadOmitEmptyInt", + "StructPtrHeadInt", + "StructPtrHeadOmitEmptyInt", + "StructHeadUint", + "StructHeadOmitEmptyUint", + "StructPtrHeadUint", + "StructPtrHeadOmitEmptyUint", + "StructHeadFloat32", + "StructHeadOmitEmptyFloat32", + "StructPtrHeadFloat32", + "StructPtrHeadOmitEmptyFloat32", + "StructHeadFloat64", + "StructHeadOmitEmptyFloat64", + "StructPtrHeadFloat64", + "StructPtrHeadOmitEmptyFloat64", + "StructHeadBool", + "StructHeadOmitEmptyBool", + "StructPtrHeadBool", + "StructPtrHeadOmitEmptyBool", + "StructHeadString", + "StructHeadOmitEmptyString", + "StructPtrHeadString", + "StructPtrHeadOmitEmptyString", + "StructHeadBytes", + "StructHeadOmitEmptyBytes", + "StructPtrHeadBytes", + "StructPtrHeadOmitEmptyBytes", + "StructHeadNumber", + "StructHeadOmitEmptyNumber", + "StructPtrHeadNumber", + "StructPtrHeadOmitEmptyNumber", + "StructHeadArray", + "StructHeadOmitEmptyArray", + "StructPtrHeadArray", + "StructPtrHeadOmitEmptyArray", + "StructHeadMap", + "StructHeadOmitEmptyMap", + "StructPtrHeadMap", + "StructPtrHeadOmitEmptyMap", + "StructHeadSlice", + "StructHeadOmitEmptySlice", + "StructPtrHeadSlice", + "StructPtrHeadOmitEmptySlice", + "StructHeadStruct", + "StructHeadOmitEmptyStruct", + "StructPtrHeadStruct", + "StructPtrHeadOmitEmptyStruct", + "StructHeadMarshalJSON", + "StructHeadOmitEmptyMarshalJSON", + "StructPtrHeadMarshalJSON", + "StructPtrHeadOmitEmptyMarshalJSON", + "StructHeadMarshalText", + "StructHeadOmitEmptyMarshalText", + "StructPtrHeadMarshalText", + "StructPtrHeadOmitEmptyMarshalText", + "StructHeadIntString", + "StructHeadOmitEmptyIntString", + "StructPtrHeadIntString", + "StructPtrHeadOmitEmptyIntString", + "StructHeadUintString", + "StructHeadOmitEmptyUintString", + "StructPtrHeadUintString", + "StructPtrHeadOmitEmptyUintString", + "StructHeadFloat32String", + "StructHeadOmitEmptyFloat32String", + "StructPtrHeadFloat32String", + "StructPtrHeadOmitEmptyFloat32String", + "StructHeadFloat64String", + "StructHeadOmitEmptyFloat64String", + "StructPtrHeadFloat64String", + "StructPtrHeadOmitEmptyFloat64String", + "StructHeadBoolString", + "StructHeadOmitEmptyBoolString", + "StructPtrHeadBoolString", + "StructPtrHeadOmitEmptyBoolString", + "StructHeadStringString", + "StructHeadOmitEmptyStringString", + "StructPtrHeadStringString", + "StructPtrHeadOmitEmptyStringString", + "StructHeadNumberString", + "StructHeadOmitEmptyNumberString", + "StructPtrHeadNumberString", + "StructPtrHeadOmitEmptyNumberString", + "StructHeadIntPtr", + "StructHeadOmitEmptyIntPtr", + "StructPtrHeadIntPtr", + "StructPtrHeadOmitEmptyIntPtr", + "StructHeadUintPtr", + "StructHeadOmitEmptyUintPtr", + "StructPtrHeadUintPtr", + "StructPtrHeadOmitEmptyUintPtr", + "StructHeadFloat32Ptr", + "StructHeadOmitEmptyFloat32Ptr", + "StructPtrHeadFloat32Ptr", + "StructPtrHeadOmitEmptyFloat32Ptr", + "StructHeadFloat64Ptr", + "StructHeadOmitEmptyFloat64Ptr", + "StructPtrHeadFloat64Ptr", + "StructPtrHeadOmitEmptyFloat64Ptr", + "StructHeadBoolPtr", + "StructHeadOmitEmptyBoolPtr", + "StructPtrHeadBoolPtr", + "StructPtrHeadOmitEmptyBoolPtr", + "StructHeadStringPtr", + "StructHeadOmitEmptyStringPtr", + "StructPtrHeadStringPtr", + "StructPtrHeadOmitEmptyStringPtr", + "StructHeadBytesPtr", + "StructHeadOmitEmptyBytesPtr", + "StructPtrHeadBytesPtr", + "StructPtrHeadOmitEmptyBytesPtr", + "StructHeadNumberPtr", + "StructHeadOmitEmptyNumberPtr", + "StructPtrHeadNumberPtr", + "StructPtrHeadOmitEmptyNumberPtr", + "StructHeadArrayPtr", + "StructHeadOmitEmptyArrayPtr", + "StructPtrHeadArrayPtr", + "StructPtrHeadOmitEmptyArrayPtr", + "StructHeadMapPtr", + "StructHeadOmitEmptyMapPtr", + "StructPtrHeadMapPtr", + "StructPtrHeadOmitEmptyMapPtr", + "StructHeadSlicePtr", + "StructHeadOmitEmptySlicePtr", + "StructPtrHeadSlicePtr", + "StructPtrHeadOmitEmptySlicePtr", + "StructHeadMarshalJSONPtr", + "StructHeadOmitEmptyMarshalJSONPtr", + "StructPtrHeadMarshalJSONPtr", + "StructPtrHeadOmitEmptyMarshalJSONPtr", + "StructHeadMarshalTextPtr", + "StructHeadOmitEmptyMarshalTextPtr", + "StructPtrHeadMarshalTextPtr", + "StructPtrHeadOmitEmptyMarshalTextPtr", + "StructHeadInterfacePtr", + "StructHeadOmitEmptyInterfacePtr", + "StructPtrHeadInterfacePtr", + "StructPtrHeadOmitEmptyInterfacePtr", + "StructHeadIntPtrString", + "StructHeadOmitEmptyIntPtrString", + "StructPtrHeadIntPtrString", + "StructPtrHeadOmitEmptyIntPtrString", + "StructHeadUintPtrString", + "StructHeadOmitEmptyUintPtrString", + "StructPtrHeadUintPtrString", + "StructPtrHeadOmitEmptyUintPtrString", + "StructHeadFloat32PtrString", + "StructHeadOmitEmptyFloat32PtrString", + "StructPtrHeadFloat32PtrString", + "StructPtrHeadOmitEmptyFloat32PtrString", + "StructHeadFloat64PtrString", + "StructHeadOmitEmptyFloat64PtrString", + "StructPtrHeadFloat64PtrString", + "StructPtrHeadOmitEmptyFloat64PtrString", + "StructHeadBoolPtrString", + "StructHeadOmitEmptyBoolPtrString", + "StructPtrHeadBoolPtrString", + "StructPtrHeadOmitEmptyBoolPtrString", + "StructHeadStringPtrString", + "StructHeadOmitEmptyStringPtrString", + "StructPtrHeadStringPtrString", + "StructPtrHeadOmitEmptyStringPtrString", + "StructHeadNumberPtrString", + "StructHeadOmitEmptyNumberPtrString", + "StructPtrHeadNumberPtrString", + "StructPtrHeadOmitEmptyNumberPtrString", + "StructHead", + "StructHeadOmitEmpty", + "StructPtrHead", + "StructPtrHeadOmitEmpty", + "StructFieldInt", + "StructFieldOmitEmptyInt", + "StructEndInt", + "StructEndOmitEmptyInt", + "StructFieldUint", + "StructFieldOmitEmptyUint", + "StructEndUint", + "StructEndOmitEmptyUint", + "StructFieldFloat32", + "StructFieldOmitEmptyFloat32", + "StructEndFloat32", + "StructEndOmitEmptyFloat32", + "StructFieldFloat64", + "StructFieldOmitEmptyFloat64", + "StructEndFloat64", + "StructEndOmitEmptyFloat64", + "StructFieldBool", + "StructFieldOmitEmptyBool", + "StructEndBool", + "StructEndOmitEmptyBool", + "StructFieldString", + "StructFieldOmitEmptyString", + "StructEndString", + "StructEndOmitEmptyString", + "StructFieldBytes", + "StructFieldOmitEmptyBytes", + "StructEndBytes", + "StructEndOmitEmptyBytes", + "StructFieldNumber", + "StructFieldOmitEmptyNumber", + "StructEndNumber", + "StructEndOmitEmptyNumber", + "StructFieldArray", + "StructFieldOmitEmptyArray", + "StructEndArray", + "StructEndOmitEmptyArray", + "StructFieldMap", + "StructFieldOmitEmptyMap", + "StructEndMap", + "StructEndOmitEmptyMap", + "StructFieldSlice", + "StructFieldOmitEmptySlice", + "StructEndSlice", + "StructEndOmitEmptySlice", + "StructFieldStruct", + "StructFieldOmitEmptyStruct", + "StructEndStruct", + "StructEndOmitEmptyStruct", + "StructFieldMarshalJSON", + "StructFieldOmitEmptyMarshalJSON", + "StructEndMarshalJSON", + "StructEndOmitEmptyMarshalJSON", + "StructFieldMarshalText", + "StructFieldOmitEmptyMarshalText", + "StructEndMarshalText", + "StructEndOmitEmptyMarshalText", + "StructFieldIntString", + "StructFieldOmitEmptyIntString", + "StructEndIntString", + "StructEndOmitEmptyIntString", + "StructFieldUintString", + "StructFieldOmitEmptyUintString", + "StructEndUintString", + "StructEndOmitEmptyUintString", + "StructFieldFloat32String", + "StructFieldOmitEmptyFloat32String", + "StructEndFloat32String", + "StructEndOmitEmptyFloat32String", + "StructFieldFloat64String", + "StructFieldOmitEmptyFloat64String", + "StructEndFloat64String", + "StructEndOmitEmptyFloat64String", + "StructFieldBoolString", + "StructFieldOmitEmptyBoolString", + "StructEndBoolString", + "StructEndOmitEmptyBoolString", + "StructFieldStringString", + "StructFieldOmitEmptyStringString", + "StructEndStringString", + "StructEndOmitEmptyStringString", + "StructFieldNumberString", + "StructFieldOmitEmptyNumberString", + "StructEndNumberString", + "StructEndOmitEmptyNumberString", + "StructFieldIntPtr", + "StructFieldOmitEmptyIntPtr", + "StructEndIntPtr", + "StructEndOmitEmptyIntPtr", + "StructFieldUintPtr", + "StructFieldOmitEmptyUintPtr", + "StructEndUintPtr", + "StructEndOmitEmptyUintPtr", + "StructFieldFloat32Ptr", + "StructFieldOmitEmptyFloat32Ptr", + "StructEndFloat32Ptr", + "StructEndOmitEmptyFloat32Ptr", + "StructFieldFloat64Ptr", + "StructFieldOmitEmptyFloat64Ptr", + "StructEndFloat64Ptr", + "StructEndOmitEmptyFloat64Ptr", + "StructFieldBoolPtr", + "StructFieldOmitEmptyBoolPtr", + "StructEndBoolPtr", + "StructEndOmitEmptyBoolPtr", + "StructFieldStringPtr", + "StructFieldOmitEmptyStringPtr", + "StructEndStringPtr", + "StructEndOmitEmptyStringPtr", + "StructFieldBytesPtr", + "StructFieldOmitEmptyBytesPtr", + "StructEndBytesPtr", + "StructEndOmitEmptyBytesPtr", + "StructFieldNumberPtr", + "StructFieldOmitEmptyNumberPtr", + "StructEndNumberPtr", + "StructEndOmitEmptyNumberPtr", + "StructFieldArrayPtr", + "StructFieldOmitEmptyArrayPtr", + "StructEndArrayPtr", + "StructEndOmitEmptyArrayPtr", + "StructFieldMapPtr", + "StructFieldOmitEmptyMapPtr", + "StructEndMapPtr", + "StructEndOmitEmptyMapPtr", + "StructFieldSlicePtr", + "StructFieldOmitEmptySlicePtr", + "StructEndSlicePtr", + "StructEndOmitEmptySlicePtr", + "StructFieldMarshalJSONPtr", + "StructFieldOmitEmptyMarshalJSONPtr", + "StructEndMarshalJSONPtr", + "StructEndOmitEmptyMarshalJSONPtr", + "StructFieldMarshalTextPtr", + "StructFieldOmitEmptyMarshalTextPtr", + "StructEndMarshalTextPtr", + "StructEndOmitEmptyMarshalTextPtr", + "StructFieldInterfacePtr", + "StructFieldOmitEmptyInterfacePtr", + "StructEndInterfacePtr", + "StructEndOmitEmptyInterfacePtr", + "StructFieldIntPtrString", + "StructFieldOmitEmptyIntPtrString", + "StructEndIntPtrString", + "StructEndOmitEmptyIntPtrString", + "StructFieldUintPtrString", + "StructFieldOmitEmptyUintPtrString", + "StructEndUintPtrString", + "StructEndOmitEmptyUintPtrString", + "StructFieldFloat32PtrString", + "StructFieldOmitEmptyFloat32PtrString", + "StructEndFloat32PtrString", + "StructEndOmitEmptyFloat32PtrString", + "StructFieldFloat64PtrString", + "StructFieldOmitEmptyFloat64PtrString", + "StructEndFloat64PtrString", + "StructEndOmitEmptyFloat64PtrString", + "StructFieldBoolPtrString", + "StructFieldOmitEmptyBoolPtrString", + "StructEndBoolPtrString", + "StructEndOmitEmptyBoolPtrString", + "StructFieldStringPtrString", + "StructFieldOmitEmptyStringPtrString", + "StructEndStringPtrString", + "StructEndOmitEmptyStringPtrString", + "StructFieldNumberPtrString", + "StructFieldOmitEmptyNumberPtrString", + "StructEndNumberPtrString", + "StructEndOmitEmptyNumberPtrString", + "StructField", + "StructFieldOmitEmpty", + "StructEnd", + "StructEndOmitEmpty", +} + +type OpType uint16 + +const ( + OpEnd OpType = 0 + OpInterface OpType = 1 + OpPtr OpType = 2 + OpSliceElem OpType = 3 + OpSliceEnd OpType = 4 + OpArrayElem OpType = 5 + OpArrayEnd OpType = 6 + OpMapKey OpType = 7 + OpMapValue OpType = 8 + OpMapEnd OpType = 9 + OpRecursive OpType = 10 + OpRecursivePtr OpType = 11 + OpRecursiveEnd OpType = 12 + OpInterfaceEnd OpType = 13 + OpInt OpType = 14 + OpUint OpType = 15 + OpFloat32 OpType = 16 + OpFloat64 OpType = 17 + OpBool OpType = 18 + OpString OpType = 19 + OpBytes OpType = 20 + OpNumber OpType = 21 + OpArray OpType = 22 + OpMap OpType = 23 + OpSlice OpType = 24 + OpStruct OpType = 25 + OpMarshalJSON OpType = 26 + OpMarshalText OpType = 27 + OpIntString OpType = 28 + OpUintString OpType = 29 + OpFloat32String OpType = 30 + OpFloat64String OpType = 31 + OpBoolString OpType = 32 + OpStringString OpType = 33 + OpNumberString OpType = 34 + OpIntPtr OpType = 35 + OpUintPtr OpType = 36 + OpFloat32Ptr OpType = 37 + OpFloat64Ptr OpType = 38 + OpBoolPtr OpType = 39 + OpStringPtr OpType = 40 + OpBytesPtr OpType = 41 + OpNumberPtr OpType = 42 + OpArrayPtr OpType = 43 + OpMapPtr OpType = 44 + OpSlicePtr OpType = 45 + OpMarshalJSONPtr OpType = 46 + OpMarshalTextPtr OpType = 47 + OpInterfacePtr OpType = 48 + OpIntPtrString OpType = 49 + OpUintPtrString OpType = 50 + OpFloat32PtrString OpType = 51 + OpFloat64PtrString OpType = 52 + OpBoolPtrString OpType = 53 + OpStringPtrString OpType = 54 + OpNumberPtrString OpType = 55 + OpStructHeadInt OpType = 56 + OpStructHeadOmitEmptyInt OpType = 57 + OpStructPtrHeadInt OpType = 58 + OpStructPtrHeadOmitEmptyInt OpType = 59 + OpStructHeadUint OpType = 60 + OpStructHeadOmitEmptyUint OpType = 61 + OpStructPtrHeadUint OpType = 62 + OpStructPtrHeadOmitEmptyUint OpType = 63 + OpStructHeadFloat32 OpType = 64 + OpStructHeadOmitEmptyFloat32 OpType = 65 + OpStructPtrHeadFloat32 OpType = 66 + OpStructPtrHeadOmitEmptyFloat32 OpType = 67 + OpStructHeadFloat64 OpType = 68 + OpStructHeadOmitEmptyFloat64 OpType = 69 + OpStructPtrHeadFloat64 OpType = 70 + OpStructPtrHeadOmitEmptyFloat64 OpType = 71 + OpStructHeadBool OpType = 72 + OpStructHeadOmitEmptyBool OpType = 73 + OpStructPtrHeadBool OpType = 74 + OpStructPtrHeadOmitEmptyBool OpType = 75 + OpStructHeadString OpType = 76 + OpStructHeadOmitEmptyString OpType = 77 + OpStructPtrHeadString OpType = 78 + OpStructPtrHeadOmitEmptyString OpType = 79 + OpStructHeadBytes OpType = 80 + OpStructHeadOmitEmptyBytes OpType = 81 + OpStructPtrHeadBytes OpType = 82 + OpStructPtrHeadOmitEmptyBytes OpType = 83 + OpStructHeadNumber OpType = 84 + OpStructHeadOmitEmptyNumber OpType = 85 + OpStructPtrHeadNumber OpType = 86 + OpStructPtrHeadOmitEmptyNumber OpType = 87 + OpStructHeadArray OpType = 88 + OpStructHeadOmitEmptyArray OpType = 89 + OpStructPtrHeadArray OpType = 90 + OpStructPtrHeadOmitEmptyArray OpType = 91 + OpStructHeadMap OpType = 92 + OpStructHeadOmitEmptyMap OpType = 93 + OpStructPtrHeadMap OpType = 94 + OpStructPtrHeadOmitEmptyMap OpType = 95 + OpStructHeadSlice OpType = 96 + OpStructHeadOmitEmptySlice OpType = 97 + OpStructPtrHeadSlice OpType = 98 + OpStructPtrHeadOmitEmptySlice OpType = 99 + OpStructHeadStruct OpType = 100 + OpStructHeadOmitEmptyStruct OpType = 101 + OpStructPtrHeadStruct OpType = 102 + OpStructPtrHeadOmitEmptyStruct OpType = 103 + OpStructHeadMarshalJSON OpType = 104 + OpStructHeadOmitEmptyMarshalJSON OpType = 105 + OpStructPtrHeadMarshalJSON OpType = 106 + OpStructPtrHeadOmitEmptyMarshalJSON OpType = 107 + OpStructHeadMarshalText OpType = 108 + OpStructHeadOmitEmptyMarshalText OpType = 109 + OpStructPtrHeadMarshalText OpType = 110 + OpStructPtrHeadOmitEmptyMarshalText OpType = 111 + OpStructHeadIntString OpType = 112 + OpStructHeadOmitEmptyIntString OpType = 113 + OpStructPtrHeadIntString OpType = 114 + OpStructPtrHeadOmitEmptyIntString OpType = 115 + OpStructHeadUintString OpType = 116 + OpStructHeadOmitEmptyUintString OpType = 117 + OpStructPtrHeadUintString OpType = 118 + OpStructPtrHeadOmitEmptyUintString OpType = 119 + OpStructHeadFloat32String OpType = 120 + OpStructHeadOmitEmptyFloat32String OpType = 121 + OpStructPtrHeadFloat32String OpType = 122 + OpStructPtrHeadOmitEmptyFloat32String OpType = 123 + OpStructHeadFloat64String OpType = 124 + OpStructHeadOmitEmptyFloat64String OpType = 125 + OpStructPtrHeadFloat64String OpType = 126 + OpStructPtrHeadOmitEmptyFloat64String OpType = 127 + OpStructHeadBoolString OpType = 128 + OpStructHeadOmitEmptyBoolString OpType = 129 + OpStructPtrHeadBoolString OpType = 130 + OpStructPtrHeadOmitEmptyBoolString OpType = 131 + OpStructHeadStringString OpType = 132 + OpStructHeadOmitEmptyStringString OpType = 133 + OpStructPtrHeadStringString OpType = 134 + OpStructPtrHeadOmitEmptyStringString OpType = 135 + OpStructHeadNumberString OpType = 136 + OpStructHeadOmitEmptyNumberString OpType = 137 + OpStructPtrHeadNumberString OpType = 138 + OpStructPtrHeadOmitEmptyNumberString OpType = 139 + OpStructHeadIntPtr OpType = 140 + OpStructHeadOmitEmptyIntPtr OpType = 141 + OpStructPtrHeadIntPtr OpType = 142 + OpStructPtrHeadOmitEmptyIntPtr OpType = 143 + OpStructHeadUintPtr OpType = 144 + OpStructHeadOmitEmptyUintPtr OpType = 145 + OpStructPtrHeadUintPtr OpType = 146 + OpStructPtrHeadOmitEmptyUintPtr OpType = 147 + OpStructHeadFloat32Ptr OpType = 148 + OpStructHeadOmitEmptyFloat32Ptr OpType = 149 + OpStructPtrHeadFloat32Ptr OpType = 150 + OpStructPtrHeadOmitEmptyFloat32Ptr OpType = 151 + OpStructHeadFloat64Ptr OpType = 152 + OpStructHeadOmitEmptyFloat64Ptr OpType = 153 + OpStructPtrHeadFloat64Ptr OpType = 154 + OpStructPtrHeadOmitEmptyFloat64Ptr OpType = 155 + OpStructHeadBoolPtr OpType = 156 + OpStructHeadOmitEmptyBoolPtr OpType = 157 + OpStructPtrHeadBoolPtr OpType = 158 + OpStructPtrHeadOmitEmptyBoolPtr OpType = 159 + OpStructHeadStringPtr OpType = 160 + OpStructHeadOmitEmptyStringPtr OpType = 161 + OpStructPtrHeadStringPtr OpType = 162 + OpStructPtrHeadOmitEmptyStringPtr OpType = 163 + OpStructHeadBytesPtr OpType = 164 + OpStructHeadOmitEmptyBytesPtr OpType = 165 + OpStructPtrHeadBytesPtr OpType = 166 + OpStructPtrHeadOmitEmptyBytesPtr OpType = 167 + OpStructHeadNumberPtr OpType = 168 + OpStructHeadOmitEmptyNumberPtr OpType = 169 + OpStructPtrHeadNumberPtr OpType = 170 + OpStructPtrHeadOmitEmptyNumberPtr OpType = 171 + OpStructHeadArrayPtr OpType = 172 + OpStructHeadOmitEmptyArrayPtr OpType = 173 + OpStructPtrHeadArrayPtr OpType = 174 + OpStructPtrHeadOmitEmptyArrayPtr OpType = 175 + OpStructHeadMapPtr OpType = 176 + OpStructHeadOmitEmptyMapPtr OpType = 177 + OpStructPtrHeadMapPtr OpType = 178 + OpStructPtrHeadOmitEmptyMapPtr OpType = 179 + OpStructHeadSlicePtr OpType = 180 + OpStructHeadOmitEmptySlicePtr OpType = 181 + OpStructPtrHeadSlicePtr OpType = 182 + OpStructPtrHeadOmitEmptySlicePtr OpType = 183 + OpStructHeadMarshalJSONPtr OpType = 184 + OpStructHeadOmitEmptyMarshalJSONPtr OpType = 185 + OpStructPtrHeadMarshalJSONPtr OpType = 186 + OpStructPtrHeadOmitEmptyMarshalJSONPtr OpType = 187 + OpStructHeadMarshalTextPtr OpType = 188 + OpStructHeadOmitEmptyMarshalTextPtr OpType = 189 + OpStructPtrHeadMarshalTextPtr OpType = 190 + OpStructPtrHeadOmitEmptyMarshalTextPtr OpType = 191 + OpStructHeadInterfacePtr OpType = 192 + OpStructHeadOmitEmptyInterfacePtr OpType = 193 + OpStructPtrHeadInterfacePtr OpType = 194 + OpStructPtrHeadOmitEmptyInterfacePtr OpType = 195 + OpStructHeadIntPtrString OpType = 196 + OpStructHeadOmitEmptyIntPtrString OpType = 197 + OpStructPtrHeadIntPtrString OpType = 198 + OpStructPtrHeadOmitEmptyIntPtrString OpType = 199 + OpStructHeadUintPtrString OpType = 200 + OpStructHeadOmitEmptyUintPtrString OpType = 201 + OpStructPtrHeadUintPtrString OpType = 202 + OpStructPtrHeadOmitEmptyUintPtrString OpType = 203 + OpStructHeadFloat32PtrString OpType = 204 + OpStructHeadOmitEmptyFloat32PtrString OpType = 205 + OpStructPtrHeadFloat32PtrString OpType = 206 + OpStructPtrHeadOmitEmptyFloat32PtrString OpType = 207 + OpStructHeadFloat64PtrString OpType = 208 + OpStructHeadOmitEmptyFloat64PtrString OpType = 209 + OpStructPtrHeadFloat64PtrString OpType = 210 + OpStructPtrHeadOmitEmptyFloat64PtrString OpType = 211 + OpStructHeadBoolPtrString OpType = 212 + OpStructHeadOmitEmptyBoolPtrString OpType = 213 + OpStructPtrHeadBoolPtrString OpType = 214 + OpStructPtrHeadOmitEmptyBoolPtrString OpType = 215 + OpStructHeadStringPtrString OpType = 216 + OpStructHeadOmitEmptyStringPtrString OpType = 217 + OpStructPtrHeadStringPtrString OpType = 218 + OpStructPtrHeadOmitEmptyStringPtrString OpType = 219 + OpStructHeadNumberPtrString OpType = 220 + OpStructHeadOmitEmptyNumberPtrString OpType = 221 + OpStructPtrHeadNumberPtrString OpType = 222 + OpStructPtrHeadOmitEmptyNumberPtrString OpType = 223 + OpStructHead OpType = 224 + OpStructHeadOmitEmpty OpType = 225 + OpStructPtrHead OpType = 226 + OpStructPtrHeadOmitEmpty OpType = 227 + OpStructFieldInt OpType = 228 + OpStructFieldOmitEmptyInt OpType = 229 + OpStructEndInt OpType = 230 + OpStructEndOmitEmptyInt OpType = 231 + OpStructFieldUint OpType = 232 + OpStructFieldOmitEmptyUint OpType = 233 + OpStructEndUint OpType = 234 + OpStructEndOmitEmptyUint OpType = 235 + OpStructFieldFloat32 OpType = 236 + OpStructFieldOmitEmptyFloat32 OpType = 237 + OpStructEndFloat32 OpType = 238 + OpStructEndOmitEmptyFloat32 OpType = 239 + OpStructFieldFloat64 OpType = 240 + OpStructFieldOmitEmptyFloat64 OpType = 241 + OpStructEndFloat64 OpType = 242 + OpStructEndOmitEmptyFloat64 OpType = 243 + OpStructFieldBool OpType = 244 + OpStructFieldOmitEmptyBool OpType = 245 + OpStructEndBool OpType = 246 + OpStructEndOmitEmptyBool OpType = 247 + OpStructFieldString OpType = 248 + OpStructFieldOmitEmptyString OpType = 249 + OpStructEndString OpType = 250 + OpStructEndOmitEmptyString OpType = 251 + OpStructFieldBytes OpType = 252 + OpStructFieldOmitEmptyBytes OpType = 253 + OpStructEndBytes OpType = 254 + OpStructEndOmitEmptyBytes OpType = 255 + OpStructFieldNumber OpType = 256 + OpStructFieldOmitEmptyNumber OpType = 257 + OpStructEndNumber OpType = 258 + OpStructEndOmitEmptyNumber OpType = 259 + OpStructFieldArray OpType = 260 + OpStructFieldOmitEmptyArray OpType = 261 + OpStructEndArray OpType = 262 + OpStructEndOmitEmptyArray OpType = 263 + OpStructFieldMap OpType = 264 + OpStructFieldOmitEmptyMap OpType = 265 + OpStructEndMap OpType = 266 + OpStructEndOmitEmptyMap OpType = 267 + OpStructFieldSlice OpType = 268 + OpStructFieldOmitEmptySlice OpType = 269 + OpStructEndSlice OpType = 270 + OpStructEndOmitEmptySlice OpType = 271 + OpStructFieldStruct OpType = 272 + OpStructFieldOmitEmptyStruct OpType = 273 + OpStructEndStruct OpType = 274 + OpStructEndOmitEmptyStruct OpType = 275 + OpStructFieldMarshalJSON OpType = 276 + OpStructFieldOmitEmptyMarshalJSON OpType = 277 + OpStructEndMarshalJSON OpType = 278 + OpStructEndOmitEmptyMarshalJSON OpType = 279 + OpStructFieldMarshalText OpType = 280 + OpStructFieldOmitEmptyMarshalText OpType = 281 + OpStructEndMarshalText OpType = 282 + OpStructEndOmitEmptyMarshalText OpType = 283 + OpStructFieldIntString OpType = 284 + OpStructFieldOmitEmptyIntString OpType = 285 + OpStructEndIntString OpType = 286 + OpStructEndOmitEmptyIntString OpType = 287 + OpStructFieldUintString OpType = 288 + OpStructFieldOmitEmptyUintString OpType = 289 + OpStructEndUintString OpType = 290 + OpStructEndOmitEmptyUintString OpType = 291 + OpStructFieldFloat32String OpType = 292 + OpStructFieldOmitEmptyFloat32String OpType = 293 + OpStructEndFloat32String OpType = 294 + OpStructEndOmitEmptyFloat32String OpType = 295 + OpStructFieldFloat64String OpType = 296 + OpStructFieldOmitEmptyFloat64String OpType = 297 + OpStructEndFloat64String OpType = 298 + OpStructEndOmitEmptyFloat64String OpType = 299 + OpStructFieldBoolString OpType = 300 + OpStructFieldOmitEmptyBoolString OpType = 301 + OpStructEndBoolString OpType = 302 + OpStructEndOmitEmptyBoolString OpType = 303 + OpStructFieldStringString OpType = 304 + OpStructFieldOmitEmptyStringString OpType = 305 + OpStructEndStringString OpType = 306 + OpStructEndOmitEmptyStringString OpType = 307 + OpStructFieldNumberString OpType = 308 + OpStructFieldOmitEmptyNumberString OpType = 309 + OpStructEndNumberString OpType = 310 + OpStructEndOmitEmptyNumberString OpType = 311 + OpStructFieldIntPtr OpType = 312 + OpStructFieldOmitEmptyIntPtr OpType = 313 + OpStructEndIntPtr OpType = 314 + OpStructEndOmitEmptyIntPtr OpType = 315 + OpStructFieldUintPtr OpType = 316 + OpStructFieldOmitEmptyUintPtr OpType = 317 + OpStructEndUintPtr OpType = 318 + OpStructEndOmitEmptyUintPtr OpType = 319 + OpStructFieldFloat32Ptr OpType = 320 + OpStructFieldOmitEmptyFloat32Ptr OpType = 321 + OpStructEndFloat32Ptr OpType = 322 + OpStructEndOmitEmptyFloat32Ptr OpType = 323 + OpStructFieldFloat64Ptr OpType = 324 + OpStructFieldOmitEmptyFloat64Ptr OpType = 325 + OpStructEndFloat64Ptr OpType = 326 + OpStructEndOmitEmptyFloat64Ptr OpType = 327 + OpStructFieldBoolPtr OpType = 328 + OpStructFieldOmitEmptyBoolPtr OpType = 329 + OpStructEndBoolPtr OpType = 330 + OpStructEndOmitEmptyBoolPtr OpType = 331 + OpStructFieldStringPtr OpType = 332 + OpStructFieldOmitEmptyStringPtr OpType = 333 + OpStructEndStringPtr OpType = 334 + OpStructEndOmitEmptyStringPtr OpType = 335 + OpStructFieldBytesPtr OpType = 336 + OpStructFieldOmitEmptyBytesPtr OpType = 337 + OpStructEndBytesPtr OpType = 338 + OpStructEndOmitEmptyBytesPtr OpType = 339 + OpStructFieldNumberPtr OpType = 340 + OpStructFieldOmitEmptyNumberPtr OpType = 341 + OpStructEndNumberPtr OpType = 342 + OpStructEndOmitEmptyNumberPtr OpType = 343 + OpStructFieldArrayPtr OpType = 344 + OpStructFieldOmitEmptyArrayPtr OpType = 345 + OpStructEndArrayPtr OpType = 346 + OpStructEndOmitEmptyArrayPtr OpType = 347 + OpStructFieldMapPtr OpType = 348 + OpStructFieldOmitEmptyMapPtr OpType = 349 + OpStructEndMapPtr OpType = 350 + OpStructEndOmitEmptyMapPtr OpType = 351 + OpStructFieldSlicePtr OpType = 352 + OpStructFieldOmitEmptySlicePtr OpType = 353 + OpStructEndSlicePtr OpType = 354 + OpStructEndOmitEmptySlicePtr OpType = 355 + OpStructFieldMarshalJSONPtr OpType = 356 + OpStructFieldOmitEmptyMarshalJSONPtr OpType = 357 + OpStructEndMarshalJSONPtr OpType = 358 + OpStructEndOmitEmptyMarshalJSONPtr OpType = 359 + OpStructFieldMarshalTextPtr OpType = 360 + OpStructFieldOmitEmptyMarshalTextPtr OpType = 361 + OpStructEndMarshalTextPtr OpType = 362 + OpStructEndOmitEmptyMarshalTextPtr OpType = 363 + OpStructFieldInterfacePtr OpType = 364 + OpStructFieldOmitEmptyInterfacePtr OpType = 365 + OpStructEndInterfacePtr OpType = 366 + OpStructEndOmitEmptyInterfacePtr OpType = 367 + OpStructFieldIntPtrString OpType = 368 + OpStructFieldOmitEmptyIntPtrString OpType = 369 + OpStructEndIntPtrString OpType = 370 + OpStructEndOmitEmptyIntPtrString OpType = 371 + OpStructFieldUintPtrString OpType = 372 + OpStructFieldOmitEmptyUintPtrString OpType = 373 + OpStructEndUintPtrString OpType = 374 + OpStructEndOmitEmptyUintPtrString OpType = 375 + OpStructFieldFloat32PtrString OpType = 376 + OpStructFieldOmitEmptyFloat32PtrString OpType = 377 + OpStructEndFloat32PtrString OpType = 378 + OpStructEndOmitEmptyFloat32PtrString OpType = 379 + OpStructFieldFloat64PtrString OpType = 380 + OpStructFieldOmitEmptyFloat64PtrString OpType = 381 + OpStructEndFloat64PtrString OpType = 382 + OpStructEndOmitEmptyFloat64PtrString OpType = 383 + OpStructFieldBoolPtrString OpType = 384 + OpStructFieldOmitEmptyBoolPtrString OpType = 385 + OpStructEndBoolPtrString OpType = 386 + OpStructEndOmitEmptyBoolPtrString OpType = 387 + OpStructFieldStringPtrString OpType = 388 + OpStructFieldOmitEmptyStringPtrString OpType = 389 + OpStructEndStringPtrString OpType = 390 + OpStructEndOmitEmptyStringPtrString OpType = 391 + OpStructFieldNumberPtrString OpType = 392 + OpStructFieldOmitEmptyNumberPtrString OpType = 393 + OpStructEndNumberPtrString OpType = 394 + OpStructEndOmitEmptyNumberPtrString OpType = 395 + OpStructField OpType = 396 + OpStructFieldOmitEmpty OpType = 397 + OpStructEnd OpType = 398 + OpStructEndOmitEmpty OpType = 399 +) + +func (t OpType) String() string { + if int(t) >= 400 { + return "" + } + return opTypeStrings[int(t)] +} + +func (t OpType) CodeType() CodeType { + if strings.Contains(t.String(), "Struct") { + if strings.Contains(t.String(), "End") { + return CodeStructEnd + } + return CodeStructField + } + switch t { + case OpArray, OpArrayPtr: + return CodeArrayHead + case OpArrayElem: + return CodeArrayElem + case OpSlice, OpSlicePtr: + return CodeSliceHead + case OpSliceElem: + return CodeSliceElem + case OpMap, OpMapPtr: + return CodeMapHead + case OpMapKey: + return CodeMapKey + case OpMapValue: + return CodeMapValue + case OpMapEnd: + return CodeMapEnd + } + + return CodeOp +} + +func (t OpType) HeadToPtrHead() OpType { + if strings.Index(t.String(), "PtrHead") > 0 { + return t + } + + idx := strings.Index(t.String(), "Head") + if idx == -1 { + return t + } + suffix := "PtrHead" + t.String()[idx+len("Head"):] + + const toPtrOffset = 2 + if strings.Contains(OpType(int(t)+toPtrOffset).String(), suffix) { + return OpType(int(t) + toPtrOffset) + } + return t +} + +func (t OpType) HeadToOmitEmptyHead() OpType { + const toOmitEmptyOffset = 1 + if strings.Contains(OpType(int(t)+toOmitEmptyOffset).String(), "OmitEmpty") { + return OpType(int(t) + toOmitEmptyOffset) + } + + return t +} + +func (t OpType) PtrHeadToHead() OpType { + idx := strings.Index(t.String(), "PtrHead") + if idx == -1 { + return t + } + suffix := t.String()[idx+len("Ptr"):] + + const toPtrOffset = 2 + if strings.Contains(OpType(int(t)-toPtrOffset).String(), suffix) { + return OpType(int(t) - toPtrOffset) + } + return t +} + +func (t OpType) FieldToEnd() OpType { + idx := strings.Index(t.String(), "Field") + if idx == -1 { + return t + } + suffix := t.String()[idx+len("Field"):] + if suffix == "" || suffix == "OmitEmpty" { + return t + } + const toEndOffset = 2 + if strings.Contains(OpType(int(t)+toEndOffset).String(), "End"+suffix) { + return OpType(int(t) + toEndOffset) + } + return t +} + +func (t OpType) FieldToOmitEmptyField() OpType { + const toOmitEmptyOffset = 1 + if strings.Contains(OpType(int(t)+toOmitEmptyOffset).String(), "OmitEmpty") { + return OpType(int(t) + toOmitEmptyOffset) + } + return t +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/query.go b/vendor/github.com/goccy/go-json/internal/encoder/query.go new file mode 100644 index 000000000..1e1850cc1 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/query.go @@ -0,0 +1,135 @@ +package encoder + +import ( + "context" + "fmt" + "reflect" +) + +var ( + Marshal func(interface{}) ([]byte, error) + Unmarshal func([]byte, interface{}) error +) + +type FieldQuery struct { + Name string + Fields []*FieldQuery + hash string +} + +func (q *FieldQuery) Hash() string { + if q.hash != "" { + return q.hash + } + b, _ := Marshal(q) + q.hash = string(b) + return q.hash +} + +func (q *FieldQuery) MarshalJSON() ([]byte, error) { + if q.Name != "" { + if len(q.Fields) > 0 { + return Marshal(map[string][]*FieldQuery{q.Name: q.Fields}) + } + return Marshal(q.Name) + } + return Marshal(q.Fields) +} + +func (q *FieldQuery) QueryString() (FieldQueryString, error) { + b, err := Marshal(q) + if err != nil { + return "", err + } + return FieldQueryString(b), nil +} + +type FieldQueryString string + +func (s FieldQueryString) Build() (*FieldQuery, error) { + var query interface{} + if err := Unmarshal([]byte(s), &query); err != nil { + return nil, err + } + return s.build(reflect.ValueOf(query)) +} + +func (s FieldQueryString) build(v reflect.Value) (*FieldQuery, error) { + switch v.Type().Kind() { + case reflect.String: + return s.buildString(v) + case reflect.Map: + return s.buildMap(v) + case reflect.Slice: + return s.buildSlice(v) + case reflect.Interface: + return s.build(reflect.ValueOf(v.Interface())) + } + return nil, fmt.Errorf("failed to build field query") +} + +func (s FieldQueryString) buildString(v reflect.Value) (*FieldQuery, error) { + b := []byte(v.String()) + switch b[0] { + case '[', '{': + var query interface{} + if err := Unmarshal(b, &query); err != nil { + return nil, err + } + if str, ok := query.(string); ok { + return &FieldQuery{Name: str}, nil + } + return s.build(reflect.ValueOf(query)) + } + return &FieldQuery{Name: string(b)}, nil +} + +func (s FieldQueryString) buildSlice(v reflect.Value) (*FieldQuery, error) { + fields := make([]*FieldQuery, 0, v.Len()) + for i := 0; i < v.Len(); i++ { + def, err := s.build(v.Index(i)) + if err != nil { + return nil, err + } + fields = append(fields, def) + } + return &FieldQuery{Fields: fields}, nil +} + +func (s FieldQueryString) buildMap(v reflect.Value) (*FieldQuery, error) { + keys := v.MapKeys() + if len(keys) != 1 { + return nil, fmt.Errorf("failed to build field query object") + } + key := keys[0] + if key.Type().Kind() != reflect.String { + return nil, fmt.Errorf("failed to build field query. invalid object key type") + } + name := key.String() + def, err := s.build(v.MapIndex(key)) + if err != nil { + return nil, err + } + return &FieldQuery{ + Name: name, + Fields: def.Fields, + }, nil +} + +type queryKey struct{} + +func FieldQueryFromContext(ctx context.Context) *FieldQuery { + query := ctx.Value(queryKey{}) + if query == nil { + return nil + } + q, ok := query.(*FieldQuery) + if !ok { + return nil + } + return q +} + +func SetFieldQueryToContext(ctx context.Context, query *FieldQuery) context.Context { + return context.WithValue(ctx, queryKey{}, query) +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/string.go b/vendor/github.com/goccy/go-json/internal/encoder/string.go new file mode 100644 index 000000000..e4152b27c --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/string.go @@ -0,0 +1,459 @@ +package encoder + +import ( + "math/bits" + "reflect" + "unsafe" +) + +const ( + lsb = 0x0101010101010101 + msb = 0x8080808080808080 +) + +var hex = "0123456789abcdef" + +//nolint:govet +func stringToUint64Slice(s string) []uint64 { + return *(*[]uint64)(unsafe.Pointer(&reflect.SliceHeader{ + Data: ((*reflect.StringHeader)(unsafe.Pointer(&s))).Data, + Len: len(s) / 8, + Cap: len(s) / 8, + })) +} + +func AppendString(ctx *RuntimeContext, buf []byte, s string) []byte { + if ctx.Option.Flag&HTMLEscapeOption != 0 { + if ctx.Option.Flag&NormalizeUTF8Option != 0 { + return appendNormalizedHTMLString(buf, s) + } + return appendHTMLString(buf, s) + } + if ctx.Option.Flag&NormalizeUTF8Option != 0 { + return appendNormalizedString(buf, s) + } + return appendString(buf, s) +} + +func appendNormalizedHTMLString(buf []byte, s string) []byte { + valLen := len(s) + if valLen == 0 { + return append(buf, `""`...) + } + buf = append(buf, '"') + var ( + i, j int + ) + if valLen >= 8 { + chunks := stringToUint64Slice(s) + for _, n := range chunks { + // combine masks before checking for the MSB of each byte. We include + // `n` in the mask to check whether any of the *input* byte MSBs were + // set (i.e. the byte was outside the ASCII range). + mask := n | (n - (lsb * 0x20)) | + ((n ^ (lsb * '"')) - lsb) | + ((n ^ (lsb * '\\')) - lsb) | + ((n ^ (lsb * '<')) - lsb) | + ((n ^ (lsb * '>')) - lsb) | + ((n ^ (lsb * '&')) - lsb) + if (mask & msb) != 0 { + j = bits.TrailingZeros64(mask&msb) / 8 + goto ESCAPE_END + } + } + for i := len(chunks) * 8; i < valLen; i++ { + if needEscapeHTMLNormalizeUTF8[s[i]] { + j = i + goto ESCAPE_END + } + } + // no found any escape characters. + return append(append(buf, s...), '"') + } +ESCAPE_END: + for j < valLen { + c := s[j] + + if !needEscapeHTMLNormalizeUTF8[c] { + // fast path: most of the time, printable ascii characters are used + j++ + continue + } + + switch c { + case '\\', '"': + buf = append(buf, s[i:j]...) + buf = append(buf, '\\', c) + i = j + 1 + j = j + 1 + continue + + case '\n': + buf = append(buf, s[i:j]...) + buf = append(buf, '\\', 'n') + i = j + 1 + j = j + 1 + continue + + case '\r': + buf = append(buf, s[i:j]...) + buf = append(buf, '\\', 'r') + i = j + 1 + j = j + 1 + continue + + case '\t': + buf = append(buf, s[i:j]...) + buf = append(buf, '\\', 't') + i = j + 1 + j = j + 1 + continue + + case '<', '>', '&': + buf = append(buf, s[i:j]...) + buf = append(buf, `\u00`...) + buf = append(buf, hex[c>>4], hex[c&0xF]) + i = j + 1 + j = j + 1 + continue + + case 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x0B, 0x0C, 0x0E, 0x0F, // 0x00-0x0F + 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, 0x17, 0x18, 0x19, 0x1A, 0x1B, 0x1C, 0x1D, 0x1E, 0x1F: // 0x10-0x1F + buf = append(buf, s[i:j]...) + buf = append(buf, `\u00`...) + buf = append(buf, hex[c>>4], hex[c&0xF]) + i = j + 1 + j = j + 1 + continue + } + state, size := decodeRuneInString(s[j:]) + switch state { + case runeErrorState: + buf = append(buf, s[i:j]...) + buf = append(buf, `\ufffd`...) + i = j + 1 + j = j + 1 + continue + // U+2028 is LINE SEPARATOR. + // U+2029 is PARAGRAPH SEPARATOR. + // They are both technically valid characters in JSON strings, + // but don't work in JSONP, which has to be evaluated as JavaScript, + // and can lead to security holes there. It is valid JSON to + // escape them, so we do so unconditionally. + // See http://timelessrepo.com/json-isnt-a-javascript-subset for discussion. + case lineSepState: + buf = append(buf, s[i:j]...) + buf = append(buf, `\u2028`...) + i = j + 3 + j = j + 3 + continue + case paragraphSepState: + buf = append(buf, s[i:j]...) + buf = append(buf, `\u2029`...) + i = j + 3 + j = j + 3 + continue + } + j += size + } + + return append(append(buf, s[i:]...), '"') +} + +func appendHTMLString(buf []byte, s string) []byte { + valLen := len(s) + if valLen == 0 { + return append(buf, `""`...) + } + buf = append(buf, '"') + var ( + i, j int + ) + if valLen >= 8 { + chunks := stringToUint64Slice(s) + for _, n := range chunks { + // combine masks before checking for the MSB of each byte. We include + // `n` in the mask to check whether any of the *input* byte MSBs were + // set (i.e. the byte was outside the ASCII range). + mask := n | (n - (lsb * 0x20)) | + ((n ^ (lsb * '"')) - lsb) | + ((n ^ (lsb * '\\')) - lsb) | + ((n ^ (lsb * '<')) - lsb) | + ((n ^ (lsb * '>')) - lsb) | + ((n ^ (lsb * '&')) - lsb) + if (mask & msb) != 0 { + j = bits.TrailingZeros64(mask&msb) / 8 + goto ESCAPE_END + } + } + for i := len(chunks) * 8; i < valLen; i++ { + if needEscapeHTML[s[i]] { + j = i + goto ESCAPE_END + } + } + // no found any escape characters. + return append(append(buf, s...), '"') + } +ESCAPE_END: + for j < valLen { + c := s[j] + + if !needEscapeHTML[c] { + // fast path: most of the time, printable ascii characters are used + j++ + continue + } + + switch c { + case '\\', '"': + buf = append(buf, s[i:j]...) + buf = append(buf, '\\', c) + i = j + 1 + j = j + 1 + continue + + case '\n': + buf = append(buf, s[i:j]...) + buf = append(buf, '\\', 'n') + i = j + 1 + j = j + 1 + continue + + case '\r': + buf = append(buf, s[i:j]...) + buf = append(buf, '\\', 'r') + i = j + 1 + j = j + 1 + continue + + case '\t': + buf = append(buf, s[i:j]...) + buf = append(buf, '\\', 't') + i = j + 1 + j = j + 1 + continue + + case '<', '>', '&': + buf = append(buf, s[i:j]...) + buf = append(buf, `\u00`...) + buf = append(buf, hex[c>>4], hex[c&0xF]) + i = j + 1 + j = j + 1 + continue + + case 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x0B, 0x0C, 0x0E, 0x0F, // 0x00-0x0F + 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, 0x17, 0x18, 0x19, 0x1A, 0x1B, 0x1C, 0x1D, 0x1E, 0x1F: // 0x10-0x1F + buf = append(buf, s[i:j]...) + buf = append(buf, `\u00`...) + buf = append(buf, hex[c>>4], hex[c&0xF]) + i = j + 1 + j = j + 1 + continue + } + j++ + } + + return append(append(buf, s[i:]...), '"') +} + +func appendNormalizedString(buf []byte, s string) []byte { + valLen := len(s) + if valLen == 0 { + return append(buf, `""`...) + } + buf = append(buf, '"') + var ( + i, j int + ) + if valLen >= 8 { + chunks := stringToUint64Slice(s) + for _, n := range chunks { + // combine masks before checking for the MSB of each byte. We include + // `n` in the mask to check whether any of the *input* byte MSBs were + // set (i.e. the byte was outside the ASCII range). + mask := n | (n - (lsb * 0x20)) | + ((n ^ (lsb * '"')) - lsb) | + ((n ^ (lsb * '\\')) - lsb) + if (mask & msb) != 0 { + j = bits.TrailingZeros64(mask&msb) / 8 + goto ESCAPE_END + } + } + valLen := len(s) + for i := len(chunks) * 8; i < valLen; i++ { + if needEscapeNormalizeUTF8[s[i]] { + j = i + goto ESCAPE_END + } + } + return append(append(buf, s...), '"') + } +ESCAPE_END: + for j < valLen { + c := s[j] + + if !needEscapeNormalizeUTF8[c] { + // fast path: most of the time, printable ascii characters are used + j++ + continue + } + + switch c { + case '\\', '"': + buf = append(buf, s[i:j]...) + buf = append(buf, '\\', c) + i = j + 1 + j = j + 1 + continue + + case '\n': + buf = append(buf, s[i:j]...) + buf = append(buf, '\\', 'n') + i = j + 1 + j = j + 1 + continue + + case '\r': + buf = append(buf, s[i:j]...) + buf = append(buf, '\\', 'r') + i = j + 1 + j = j + 1 + continue + + case '\t': + buf = append(buf, s[i:j]...) + buf = append(buf, '\\', 't') + i = j + 1 + j = j + 1 + continue + + case 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x0B, 0x0C, 0x0E, 0x0F, // 0x00-0x0F + 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, 0x17, 0x18, 0x19, 0x1A, 0x1B, 0x1C, 0x1D, 0x1E, 0x1F: // 0x10-0x1F + buf = append(buf, s[i:j]...) + buf = append(buf, `\u00`...) + buf = append(buf, hex[c>>4], hex[c&0xF]) + i = j + 1 + j = j + 1 + continue + } + + state, size := decodeRuneInString(s[j:]) + switch state { + case runeErrorState: + buf = append(buf, s[i:j]...) + buf = append(buf, `\ufffd`...) + i = j + 1 + j = j + 1 + continue + // U+2028 is LINE SEPARATOR. + // U+2029 is PARAGRAPH SEPARATOR. + // They are both technically valid characters in JSON strings, + // but don't work in JSONP, which has to be evaluated as JavaScript, + // and can lead to security holes there. It is valid JSON to + // escape them, so we do so unconditionally. + // See http://timelessrepo.com/json-isnt-a-javascript-subset for discussion. + case lineSepState: + buf = append(buf, s[i:j]...) + buf = append(buf, `\u2028`...) + i = j + 3 + j = j + 3 + continue + case paragraphSepState: + buf = append(buf, s[i:j]...) + buf = append(buf, `\u2029`...) + i = j + 3 + j = j + 3 + continue + } + j += size + } + + return append(append(buf, s[i:]...), '"') +} + +func appendString(buf []byte, s string) []byte { + valLen := len(s) + if valLen == 0 { + return append(buf, `""`...) + } + buf = append(buf, '"') + var ( + i, j int + ) + if valLen >= 8 { + chunks := stringToUint64Slice(s) + for _, n := range chunks { + // combine masks before checking for the MSB of each byte. We include + // `n` in the mask to check whether any of the *input* byte MSBs were + // set (i.e. the byte was outside the ASCII range). + mask := n | (n - (lsb * 0x20)) | + ((n ^ (lsb * '"')) - lsb) | + ((n ^ (lsb * '\\')) - lsb) + if (mask & msb) != 0 { + j = bits.TrailingZeros64(mask&msb) / 8 + goto ESCAPE_END + } + } + valLen := len(s) + for i := len(chunks) * 8; i < valLen; i++ { + if needEscape[s[i]] { + j = i + goto ESCAPE_END + } + } + return append(append(buf, s...), '"') + } +ESCAPE_END: + for j < valLen { + c := s[j] + + if !needEscape[c] { + // fast path: most of the time, printable ascii characters are used + j++ + continue + } + + switch c { + case '\\', '"': + buf = append(buf, s[i:j]...) + buf = append(buf, '\\', c) + i = j + 1 + j = j + 1 + continue + + case '\n': + buf = append(buf, s[i:j]...) + buf = append(buf, '\\', 'n') + i = j + 1 + j = j + 1 + continue + + case '\r': + buf = append(buf, s[i:j]...) + buf = append(buf, '\\', 'r') + i = j + 1 + j = j + 1 + continue + + case '\t': + buf = append(buf, s[i:j]...) + buf = append(buf, '\\', 't') + i = j + 1 + j = j + 1 + continue + + case 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x0B, 0x0C, 0x0E, 0x0F, // 0x00-0x0F + 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, 0x17, 0x18, 0x19, 0x1A, 0x1B, 0x1C, 0x1D, 0x1E, 0x1F: // 0x10-0x1F + buf = append(buf, s[i:j]...) + buf = append(buf, `\u00`...) + buf = append(buf, hex[c>>4], hex[c&0xF]) + i = j + 1 + j = j + 1 + continue + } + j++ + } + + return append(append(buf, s[i:]...), '"') +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/string_table.go b/vendor/github.com/goccy/go-json/internal/encoder/string_table.go new file mode 100644 index 000000000..ebe42c92d --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/string_table.go @@ -0,0 +1,415 @@ +package encoder + +var needEscapeHTMLNormalizeUTF8 = [256]bool{ + '"': true, + '&': true, + '<': true, + '>': true, + '\\': true, + 0x00: true, + 0x01: true, + 0x02: true, + 0x03: true, + 0x04: true, + 0x05: true, + 0x06: true, + 0x07: true, + 0x08: true, + 0x09: true, + 0x0a: true, + 0x0b: true, + 0x0c: true, + 0x0d: true, + 0x0e: true, + 0x0f: true, + 0x10: true, + 0x11: true, + 0x12: true, + 0x13: true, + 0x14: true, + 0x15: true, + 0x16: true, + 0x17: true, + 0x18: true, + 0x19: true, + 0x1a: true, + 0x1b: true, + 0x1c: true, + 0x1d: true, + 0x1e: true, + 0x1f: true, + /* 0x20 - 0x7f */ + 0x80: true, + 0x81: true, + 0x82: true, + 0x83: true, + 0x84: true, + 0x85: true, + 0x86: true, + 0x87: true, + 0x88: true, + 0x89: true, + 0x8a: true, + 0x8b: true, + 0x8c: true, + 0x8d: true, + 0x8e: true, + 0x8f: true, + 0x90: true, + 0x91: true, + 0x92: true, + 0x93: true, + 0x94: true, + 0x95: true, + 0x96: true, + 0x97: true, + 0x98: true, + 0x99: true, + 0x9a: true, + 0x9b: true, + 0x9c: true, + 0x9d: true, + 0x9e: true, + 0x9f: true, + 0xa0: true, + 0xa1: true, + 0xa2: true, + 0xa3: true, + 0xa4: true, + 0xa5: true, + 0xa6: true, + 0xa7: true, + 0xa8: true, + 0xa9: true, + 0xaa: true, + 0xab: true, + 0xac: true, + 0xad: true, + 0xae: true, + 0xaf: true, + 0xb0: true, + 0xb1: true, + 0xb2: true, + 0xb3: true, + 0xb4: true, + 0xb5: true, + 0xb6: true, + 0xb7: true, + 0xb8: true, + 0xb9: true, + 0xba: true, + 0xbb: true, + 0xbc: true, + 0xbd: true, + 0xbe: true, + 0xbf: true, + 0xc0: true, + 0xc1: true, + 0xc2: true, + 0xc3: true, + 0xc4: true, + 0xc5: true, + 0xc6: true, + 0xc7: true, + 0xc8: true, + 0xc9: true, + 0xca: true, + 0xcb: true, + 0xcc: true, + 0xcd: true, + 0xce: true, + 0xcf: true, + 0xd0: true, + 0xd1: true, + 0xd2: true, + 0xd3: true, + 0xd4: true, + 0xd5: true, + 0xd6: true, + 0xd7: true, + 0xd8: true, + 0xd9: true, + 0xda: true, + 0xdb: true, + 0xdc: true, + 0xdd: true, + 0xde: true, + 0xdf: true, + 0xe0: true, + 0xe1: true, + 0xe2: true, + 0xe3: true, + 0xe4: true, + 0xe5: true, + 0xe6: true, + 0xe7: true, + 0xe8: true, + 0xe9: true, + 0xea: true, + 0xeb: true, + 0xec: true, + 0xed: true, + 0xee: true, + 0xef: true, + 0xf0: true, + 0xf1: true, + 0xf2: true, + 0xf3: true, + 0xf4: true, + 0xf5: true, + 0xf6: true, + 0xf7: true, + 0xf8: true, + 0xf9: true, + 0xfa: true, + 0xfb: true, + 0xfc: true, + 0xfd: true, + 0xfe: true, + 0xff: true, +} + +var needEscapeNormalizeUTF8 = [256]bool{ + '"': true, + '\\': true, + 0x00: true, + 0x01: true, + 0x02: true, + 0x03: true, + 0x04: true, + 0x05: true, + 0x06: true, + 0x07: true, + 0x08: true, + 0x09: true, + 0x0a: true, + 0x0b: true, + 0x0c: true, + 0x0d: true, + 0x0e: true, + 0x0f: true, + 0x10: true, + 0x11: true, + 0x12: true, + 0x13: true, + 0x14: true, + 0x15: true, + 0x16: true, + 0x17: true, + 0x18: true, + 0x19: true, + 0x1a: true, + 0x1b: true, + 0x1c: true, + 0x1d: true, + 0x1e: true, + 0x1f: true, + /* 0x20 - 0x7f */ + 0x80: true, + 0x81: true, + 0x82: true, + 0x83: true, + 0x84: true, + 0x85: true, + 0x86: true, + 0x87: true, + 0x88: true, + 0x89: true, + 0x8a: true, + 0x8b: true, + 0x8c: true, + 0x8d: true, + 0x8e: true, + 0x8f: true, + 0x90: true, + 0x91: true, + 0x92: true, + 0x93: true, + 0x94: true, + 0x95: true, + 0x96: true, + 0x97: true, + 0x98: true, + 0x99: true, + 0x9a: true, + 0x9b: true, + 0x9c: true, + 0x9d: true, + 0x9e: true, + 0x9f: true, + 0xa0: true, + 0xa1: true, + 0xa2: true, + 0xa3: true, + 0xa4: true, + 0xa5: true, + 0xa6: true, + 0xa7: true, + 0xa8: true, + 0xa9: true, + 0xaa: true, + 0xab: true, + 0xac: true, + 0xad: true, + 0xae: true, + 0xaf: true, + 0xb0: true, + 0xb1: true, + 0xb2: true, + 0xb3: true, + 0xb4: true, + 0xb5: true, + 0xb6: true, + 0xb7: true, + 0xb8: true, + 0xb9: true, + 0xba: true, + 0xbb: true, + 0xbc: true, + 0xbd: true, + 0xbe: true, + 0xbf: true, + 0xc0: true, + 0xc1: true, + 0xc2: true, + 0xc3: true, + 0xc4: true, + 0xc5: true, + 0xc6: true, + 0xc7: true, + 0xc8: true, + 0xc9: true, + 0xca: true, + 0xcb: true, + 0xcc: true, + 0xcd: true, + 0xce: true, + 0xcf: true, + 0xd0: true, + 0xd1: true, + 0xd2: true, + 0xd3: true, + 0xd4: true, + 0xd5: true, + 0xd6: true, + 0xd7: true, + 0xd8: true, + 0xd9: true, + 0xda: true, + 0xdb: true, + 0xdc: true, + 0xdd: true, + 0xde: true, + 0xdf: true, + 0xe0: true, + 0xe1: true, + 0xe2: true, + 0xe3: true, + 0xe4: true, + 0xe5: true, + 0xe6: true, + 0xe7: true, + 0xe8: true, + 0xe9: true, + 0xea: true, + 0xeb: true, + 0xec: true, + 0xed: true, + 0xee: true, + 0xef: true, + 0xf0: true, + 0xf1: true, + 0xf2: true, + 0xf3: true, + 0xf4: true, + 0xf5: true, + 0xf6: true, + 0xf7: true, + 0xf8: true, + 0xf9: true, + 0xfa: true, + 0xfb: true, + 0xfc: true, + 0xfd: true, + 0xfe: true, + 0xff: true, +} + +var needEscapeHTML = [256]bool{ + '"': true, + '&': true, + '<': true, + '>': true, + '\\': true, + 0x00: true, + 0x01: true, + 0x02: true, + 0x03: true, + 0x04: true, + 0x05: true, + 0x06: true, + 0x07: true, + 0x08: true, + 0x09: true, + 0x0a: true, + 0x0b: true, + 0x0c: true, + 0x0d: true, + 0x0e: true, + 0x0f: true, + 0x10: true, + 0x11: true, + 0x12: true, + 0x13: true, + 0x14: true, + 0x15: true, + 0x16: true, + 0x17: true, + 0x18: true, + 0x19: true, + 0x1a: true, + 0x1b: true, + 0x1c: true, + 0x1d: true, + 0x1e: true, + 0x1f: true, + /* 0x20 - 0xff */ +} + +var needEscape = [256]bool{ + '"': true, + '\\': true, + 0x00: true, + 0x01: true, + 0x02: true, + 0x03: true, + 0x04: true, + 0x05: true, + 0x06: true, + 0x07: true, + 0x08: true, + 0x09: true, + 0x0a: true, + 0x0b: true, + 0x0c: true, + 0x0d: true, + 0x0e: true, + 0x0f: true, + 0x10: true, + 0x11: true, + 0x12: true, + 0x13: true, + 0x14: true, + 0x15: true, + 0x16: true, + 0x17: true, + 0x18: true, + 0x19: true, + 0x1a: true, + 0x1b: true, + 0x1c: true, + 0x1d: true, + 0x1e: true, + 0x1f: true, + /* 0x20 - 0xff */ +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm/debug_vm.go b/vendor/github.com/goccy/go-json/internal/encoder/vm/debug_vm.go new file mode 100644 index 000000000..fbbc0de44 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm/debug_vm.go @@ -0,0 +1,35 @@ +package vm + +import ( + "fmt" + + "github.com/goccy/go-json/internal/encoder" +) + +func DebugRun(ctx *encoder.RuntimeContext, b []byte, codeSet *encoder.OpcodeSet) ([]byte, error) { + defer func() { + var code *encoder.Opcode + if (ctx.Option.Flag & encoder.HTMLEscapeOption) != 0 { + code = codeSet.EscapeKeyCode + } else { + code = codeSet.NoescapeKeyCode + } + + if err := recover(); err != nil { + w := ctx.Option.DebugOut + fmt.Fprintln(w, "=============[DEBUG]===============") + fmt.Fprintln(w, "* [TYPE]") + fmt.Fprintln(w, codeSet.Type) + fmt.Fprintf(w, "\n") + fmt.Fprintln(w, "* [ALL OPCODE]") + fmt.Fprintln(w, code.Dump()) + fmt.Fprintf(w, "\n") + fmt.Fprintln(w, "* [CONTEXT]") + fmt.Fprintf(w, "%+v\n", ctx) + fmt.Fprintln(w, "===================================") + panic(err) + } + }() + + return Run(ctx, b, codeSet) +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm/hack.go b/vendor/github.com/goccy/go-json/internal/encoder/vm/hack.go new file mode 100644 index 000000000..65252b4a5 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm/hack.go @@ -0,0 +1,9 @@ +package vm + +import ( + // HACK: compile order + // `vm`, `vm_indent`, `vm_color`, `vm_color_indent` packages uses a lot of memory to compile, + // so forcibly make dependencies and avoid compiling in concurrent. + // dependency order: vm => vm_indent => vm_color => vm_color_indent + _ "github.com/goccy/go-json/internal/encoder/vm_indent" +) diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm/util.go b/vendor/github.com/goccy/go-json/internal/encoder/vm/util.go new file mode 100644 index 000000000..86291d7bb --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm/util.go @@ -0,0 +1,207 @@ +package vm + +import ( + "encoding/json" + "fmt" + "unsafe" + + "github.com/goccy/go-json/internal/encoder" + "github.com/goccy/go-json/internal/runtime" +) + +const uintptrSize = 4 << (^uintptr(0) >> 63) + +var ( + appendInt = encoder.AppendInt + appendUint = encoder.AppendUint + appendFloat32 = encoder.AppendFloat32 + appendFloat64 = encoder.AppendFloat64 + appendString = encoder.AppendString + appendByteSlice = encoder.AppendByteSlice + appendNumber = encoder.AppendNumber + errUnsupportedValue = encoder.ErrUnsupportedValue + errUnsupportedFloat = encoder.ErrUnsupportedFloat + mapiterinit = encoder.MapIterInit + mapiterkey = encoder.MapIterKey + mapitervalue = encoder.MapIterValue + mapiternext = encoder.MapIterNext + maplen = encoder.MapLen +) + +type emptyInterface struct { + typ *runtime.Type + ptr unsafe.Pointer +} + +type nonEmptyInterface struct { + itab *struct { + ityp *runtime.Type // static interface type + typ *runtime.Type // dynamic concrete type + // unused fields... + } + ptr unsafe.Pointer +} + +func errUnimplementedOp(op encoder.OpType) error { + return fmt.Errorf("encoder: opcode %s has not been implemented", op) +} + +func load(base uintptr, idx uint32) uintptr { + addr := base + uintptr(idx) + return **(**uintptr)(unsafe.Pointer(&addr)) +} + +func store(base uintptr, idx uint32, p uintptr) { + addr := base + uintptr(idx) + **(**uintptr)(unsafe.Pointer(&addr)) = p +} + +func loadNPtr(base uintptr, idx uint32, ptrNum uint8) uintptr { + addr := base + uintptr(idx) + p := **(**uintptr)(unsafe.Pointer(&addr)) + for i := uint8(0); i < ptrNum; i++ { + if p == 0 { + return 0 + } + p = ptrToPtr(p) + } + return p +} + +func ptrToUint64(p uintptr, bitSize uint8) uint64 { + switch bitSize { + case 8: + return (uint64)(**(**uint8)(unsafe.Pointer(&p))) + case 16: + return (uint64)(**(**uint16)(unsafe.Pointer(&p))) + case 32: + return (uint64)(**(**uint32)(unsafe.Pointer(&p))) + case 64: + return **(**uint64)(unsafe.Pointer(&p)) + } + return 0 +} +func ptrToFloat32(p uintptr) float32 { return **(**float32)(unsafe.Pointer(&p)) } +func ptrToFloat64(p uintptr) float64 { return **(**float64)(unsafe.Pointer(&p)) } +func ptrToBool(p uintptr) bool { return **(**bool)(unsafe.Pointer(&p)) } +func ptrToBytes(p uintptr) []byte { return **(**[]byte)(unsafe.Pointer(&p)) } +func ptrToNumber(p uintptr) json.Number { return **(**json.Number)(unsafe.Pointer(&p)) } +func ptrToString(p uintptr) string { return **(**string)(unsafe.Pointer(&p)) } +func ptrToSlice(p uintptr) *runtime.SliceHeader { return *(**runtime.SliceHeader)(unsafe.Pointer(&p)) } +func ptrToPtr(p uintptr) uintptr { + return uintptr(**(**unsafe.Pointer)(unsafe.Pointer(&p))) +} +func ptrToNPtr(p uintptr, ptrNum uint8) uintptr { + for i := uint8(0); i < ptrNum; i++ { + if p == 0 { + return 0 + } + p = ptrToPtr(p) + } + return p +} + +func ptrToUnsafePtr(p uintptr) unsafe.Pointer { + return *(*unsafe.Pointer)(unsafe.Pointer(&p)) +} +func ptrToInterface(code *encoder.Opcode, p uintptr) interface{} { + return *(*interface{})(unsafe.Pointer(&emptyInterface{ + typ: code.Type, + ptr: *(*unsafe.Pointer)(unsafe.Pointer(&p)), + })) +} + +func appendBool(_ *encoder.RuntimeContext, b []byte, v bool) []byte { + if v { + return append(b, "true"...) + } + return append(b, "false"...) +} + +func appendNull(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, "null"...) +} + +func appendComma(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, ',') +} + +func appendNullComma(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, "null,"...) +} + +func appendColon(_ *encoder.RuntimeContext, b []byte) []byte { + last := len(b) - 1 + b[last] = ':' + return b +} + +func appendMapKeyValue(_ *encoder.RuntimeContext, _ *encoder.Opcode, b, key, value []byte) []byte { + b = append(b, key...) + b[len(b)-1] = ':' + return append(b, value...) +} + +func appendMapEnd(_ *encoder.RuntimeContext, _ *encoder.Opcode, b []byte) []byte { + b[len(b)-1] = '}' + b = append(b, ',') + return b +} + +func appendMarshalJSON(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte, v interface{}) ([]byte, error) { + return encoder.AppendMarshalJSON(ctx, code, b, v) +} + +func appendMarshalText(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte, v interface{}) ([]byte, error) { + return encoder.AppendMarshalText(ctx, code, b, v) +} + +func appendArrayHead(_ *encoder.RuntimeContext, _ *encoder.Opcode, b []byte) []byte { + return append(b, '[') +} + +func appendArrayEnd(_ *encoder.RuntimeContext, _ *encoder.Opcode, b []byte) []byte { + last := len(b) - 1 + b[last] = ']' + return append(b, ',') +} + +func appendEmptyArray(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, '[', ']', ',') +} + +func appendEmptyObject(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, '{', '}', ',') +} + +func appendObjectEnd(_ *encoder.RuntimeContext, _ *encoder.Opcode, b []byte) []byte { + last := len(b) - 1 + b[last] = '}' + return append(b, ',') +} + +func appendStructHead(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, '{') +} + +func appendStructKey(_ *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + return append(b, code.Key...) +} + +func appendStructEnd(_ *encoder.RuntimeContext, _ *encoder.Opcode, b []byte) []byte { + return append(b, '}', ',') +} + +func appendStructEndSkipLast(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + last := len(b) - 1 + if b[last] == ',' { + b[last] = '}' + return appendComma(ctx, b) + } + return appendStructEnd(ctx, code, b) +} + +func restoreIndent(_ *encoder.RuntimeContext, _ *encoder.Opcode, _ uintptr) {} +func storeIndent(_ uintptr, _ *encoder.Opcode, _ uintptr) {} +func appendMapKeyIndent(_ *encoder.RuntimeContext, _ *encoder.Opcode, b []byte) []byte { return b } +func appendArrayElemIndent(_ *encoder.RuntimeContext, _ *encoder.Opcode, b []byte) []byte { return b } diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm/vm.go b/vendor/github.com/goccy/go-json/internal/encoder/vm/vm.go new file mode 100644 index 000000000..645d20f9f --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm/vm.go @@ -0,0 +1,4859 @@ +// Code generated by internal/cmd/generator. DO NOT EDIT! +package vm + +import ( + "math" + "reflect" + "sort" + "unsafe" + + "github.com/goccy/go-json/internal/encoder" + "github.com/goccy/go-json/internal/runtime" +) + +func Run(ctx *encoder.RuntimeContext, b []byte, codeSet *encoder.OpcodeSet) ([]byte, error) { + recursiveLevel := 0 + ptrOffset := uintptr(0) + ctxptr := ctx.Ptr() + var code *encoder.Opcode + if (ctx.Option.Flag & encoder.HTMLEscapeOption) != 0 { + code = codeSet.EscapeKeyCode + } else { + code = codeSet.NoescapeKeyCode + } + + for { + switch code.Op { + default: + return nil, errUnimplementedOp(code.Op) + case encoder.OpPtr: + p := load(ctxptr, code.Idx) + code = code.Next + store(ctxptr, code.Idx, ptrToPtr(p)) + case encoder.OpIntPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpInt: + b = appendInt(ctx, b, load(ctxptr, code.Idx), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpUintPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpUint: + b = appendUint(ctx, b, load(ctxptr, code.Idx), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpIntString: + b = append(b, '"') + b = appendInt(ctx, b, load(ctxptr, code.Idx), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpUintString: + b = append(b, '"') + b = appendUint(ctx, b, load(ctxptr, code.Idx), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpFloat32Ptr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + b = appendComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpFloat32: + b = appendFloat32(ctx, b, ptrToFloat32(load(ctxptr, code.Idx))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpFloat64Ptr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpFloat64: + v := ptrToFloat64(load(ctxptr, code.Idx)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStringPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpString: + b = appendString(ctx, b, ptrToString(load(ctxptr, code.Idx))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpBoolPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpBool: + b = appendBool(ctx, b, ptrToBool(load(ctxptr, code.Idx))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpBytesPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpBytes: + b = appendByteSlice(ctx, b, ptrToBytes(load(ctxptr, code.Idx))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpNumberPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpNumber: + bb, err := appendNumber(ctx, b, ptrToNumber(load(ctxptr, code.Idx))) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpInterfacePtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpInterface: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + if recursiveLevel > encoder.StartDetectingCyclesAfter { + for _, seen := range ctx.SeenPtr { + if p == seen { + return nil, errUnsupportedValue(code, p) + } + } + } + ctx.SeenPtr = append(ctx.SeenPtr, p) + var ( + typ *runtime.Type + ifacePtr unsafe.Pointer + ) + up := ptrToUnsafePtr(p) + if code.Flags&encoder.NonEmptyInterfaceFlags != 0 { + iface := (*nonEmptyInterface)(up) + ifacePtr = iface.ptr + if iface.itab != nil { + typ = iface.itab.typ + } + } else { + iface := (*emptyInterface)(up) + ifacePtr = iface.ptr + typ = iface.typ + } + if ifacePtr == nil { + isDirectedNil := typ != nil && typ.Kind() == reflect.Struct && !runtime.IfaceIndir(typ) + if !isDirectedNil { + b = appendNullComma(ctx, b) + code = code.Next + break + } + } + ctx.KeepRefs = append(ctx.KeepRefs, up) + ifaceCodeSet, err := encoder.CompileToGetCodeSet(ctx, uintptr(unsafe.Pointer(typ))) + if err != nil { + return nil, err + } + + totalLength := uintptr(code.Length) + 3 + nextTotalLength := uintptr(ifaceCodeSet.CodeLength) + 3 + + var c *encoder.Opcode + if (ctx.Option.Flag & encoder.HTMLEscapeOption) != 0 { + c = ifaceCodeSet.InterfaceEscapeKeyCode + } else { + c = ifaceCodeSet.InterfaceNoescapeKeyCode + } + curlen := uintptr(len(ctx.Ptrs)) + offsetNum := ptrOffset / uintptrSize + oldOffset := ptrOffset + ptrOffset += totalLength * uintptrSize + oldBaseIndent := ctx.BaseIndent + ctx.BaseIndent += code.Indent + + newLen := offsetNum + totalLength + nextTotalLength + if curlen < newLen { + ctx.Ptrs = append(ctx.Ptrs, make([]uintptr, newLen-curlen)...) + } + ctxptr = ctx.Ptr() + ptrOffset // assign new ctxptr + + end := ifaceCodeSet.EndCode + store(ctxptr, c.Idx, uintptr(ifacePtr)) + store(ctxptr, end.Idx, oldOffset) + store(ctxptr, end.ElemIdx, uintptr(unsafe.Pointer(code.Next))) + storeIndent(ctxptr, end, uintptr(oldBaseIndent)) + code = c + recursiveLevel++ + case encoder.OpInterfaceEnd: + recursiveLevel-- + + // restore ctxptr + offset := load(ctxptr, code.Idx) + restoreIndent(ctx, code, ctxptr) + ctx.SeenPtr = ctx.SeenPtr[:len(ctx.SeenPtr)-1] + + codePtr := load(ctxptr, code.ElemIdx) + code = (*encoder.Opcode)(ptrToUnsafePtr(codePtr)) + ctxptr = ctx.Ptr() + offset + ptrOffset = offset + case encoder.OpMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, ptrToPtr(p)) + fallthrough + case encoder.OpMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + if (code.Flags&encoder.IsNilableTypeFlags) != 0 && (code.Flags&encoder.IndirectFlags) != 0 { + p = ptrToPtr(p) + } + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, ptrToPtr(p)) + fallthrough + case encoder.OpMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 { + b = append(b, `""`...) + b = appendComma(ctx, b) + code = code.Next + break + } + if (code.Flags&encoder.IsNilableTypeFlags) != 0 && (code.Flags&encoder.IndirectFlags) != 0 { + p = ptrToPtr(p) + } + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpSlicePtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpSlice: + p := load(ctxptr, code.Idx) + slice := ptrToSlice(p) + if p == 0 || slice.Data == nil { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + store(ctxptr, code.ElemIdx, 0) + store(ctxptr, code.Length, uintptr(slice.Len)) + store(ctxptr, code.Idx, uintptr(slice.Data)) + if slice.Len > 0 { + b = appendArrayHead(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, uintptr(slice.Data)) + } else { + b = appendEmptyArray(ctx, b) + code = code.End.Next + } + case encoder.OpSliceElem: + idx := load(ctxptr, code.ElemIdx) + length := load(ctxptr, code.Length) + idx++ + if idx < length { + b = appendArrayElemIndent(ctx, code, b) + store(ctxptr, code.ElemIdx, idx) + data := load(ctxptr, code.Idx) + size := uintptr(code.Size) + code = code.Next + store(ctxptr, code.Idx, data+idx*size) + } else { + b = appendArrayEnd(ctx, code, b) + code = code.End.Next + } + case encoder.OpArrayPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpArray: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + if code.Length > 0 { + b = appendArrayHead(ctx, code, b) + store(ctxptr, code.ElemIdx, 0) + code = code.Next + store(ctxptr, code.Idx, p) + } else { + b = appendEmptyArray(ctx, b) + code = code.End.Next + } + case encoder.OpArrayElem: + idx := load(ctxptr, code.ElemIdx) + idx++ + if idx < uintptr(code.Length) { + b = appendArrayElemIndent(ctx, code, b) + store(ctxptr, code.ElemIdx, idx) + p := load(ctxptr, code.Idx) + size := uintptr(code.Size) + code = code.Next + store(ctxptr, code.Idx, p+idx*size) + } else { + b = appendArrayEnd(ctx, code, b) + code = code.End.Next + } + case encoder.OpMapPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpMap: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + uptr := ptrToUnsafePtr(p) + mlen := maplen(uptr) + if mlen <= 0 { + b = appendEmptyObject(ctx, b) + code = code.End.Next + break + } + b = appendStructHead(ctx, b) + unorderedMap := (ctx.Option.Flag & encoder.UnorderedMapOption) != 0 + mapCtx := encoder.NewMapContext(mlen, unorderedMap) + mapiterinit(code.Type, uptr, &mapCtx.Iter) + store(ctxptr, code.Idx, uintptr(unsafe.Pointer(mapCtx))) + ctx.KeepRefs = append(ctx.KeepRefs, unsafe.Pointer(mapCtx)) + if unorderedMap { + b = appendMapKeyIndent(ctx, code.Next, b) + } else { + mapCtx.Start = len(b) + mapCtx.First = len(b) + } + key := mapiterkey(&mapCtx.Iter) + store(ctxptr, code.Next.Idx, uintptr(key)) + code = code.Next + case encoder.OpMapKey: + mapCtx := (*encoder.MapContext)(ptrToUnsafePtr(load(ctxptr, code.Idx))) + idx := mapCtx.Idx + idx++ + if (ctx.Option.Flag & encoder.UnorderedMapOption) != 0 { + if idx < mapCtx.Len { + b = appendMapKeyIndent(ctx, code, b) + mapCtx.Idx = int(idx) + key := mapiterkey(&mapCtx.Iter) + store(ctxptr, code.Next.Idx, uintptr(key)) + code = code.Next + } else { + b = appendObjectEnd(ctx, code, b) + encoder.ReleaseMapContext(mapCtx) + code = code.End.Next + } + } else { + mapCtx.Slice.Items[mapCtx.Idx].Value = b[mapCtx.Start:len(b)] + if idx < mapCtx.Len { + mapCtx.Idx = int(idx) + mapCtx.Start = len(b) + key := mapiterkey(&mapCtx.Iter) + store(ctxptr, code.Next.Idx, uintptr(key)) + code = code.Next + } else { + code = code.End + } + } + case encoder.OpMapValue: + mapCtx := (*encoder.MapContext)(ptrToUnsafePtr(load(ctxptr, code.Idx))) + if (ctx.Option.Flag & encoder.UnorderedMapOption) != 0 { + b = appendColon(ctx, b) + } else { + mapCtx.Slice.Items[mapCtx.Idx].Key = b[mapCtx.Start:len(b)] + mapCtx.Start = len(b) + } + value := mapitervalue(&mapCtx.Iter) + store(ctxptr, code.Next.Idx, uintptr(value)) + mapiternext(&mapCtx.Iter) + code = code.Next + case encoder.OpMapEnd: + // this operation only used by sorted map. + mapCtx := (*encoder.MapContext)(ptrToUnsafePtr(load(ctxptr, code.Idx))) + sort.Sort(mapCtx.Slice) + buf := mapCtx.Buf + for _, item := range mapCtx.Slice.Items { + buf = appendMapKeyValue(ctx, code, buf, item.Key, item.Value) + } + buf = appendMapEnd(ctx, code, buf) + b = b[:mapCtx.First] + b = append(b, buf...) + mapCtx.Buf = buf + encoder.ReleaseMapContext(mapCtx) + code = code.Next + case encoder.OpRecursivePtr: + p := load(ctxptr, code.Idx) + if p == 0 { + code = code.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpRecursive: + ptr := load(ctxptr, code.Idx) + if ptr != 0 { + if recursiveLevel > encoder.StartDetectingCyclesAfter { + for _, seen := range ctx.SeenPtr { + if ptr == seen { + return nil, errUnsupportedValue(code, ptr) + } + } + } + } + ctx.SeenPtr = append(ctx.SeenPtr, ptr) + c := code.Jmp.Code + curlen := uintptr(len(ctx.Ptrs)) + offsetNum := ptrOffset / uintptrSize + oldOffset := ptrOffset + ptrOffset += code.Jmp.CurLen * uintptrSize + oldBaseIndent := ctx.BaseIndent + indentDiffFromTop := c.Indent - 1 + ctx.BaseIndent += code.Indent - indentDiffFromTop + + newLen := offsetNum + code.Jmp.CurLen + code.Jmp.NextLen + if curlen < newLen { + ctx.Ptrs = append(ctx.Ptrs, make([]uintptr, newLen-curlen)...) + } + ctxptr = ctx.Ptr() + ptrOffset // assign new ctxptr + + store(ctxptr, c.Idx, ptr) + store(ctxptr, c.End.Next.Idx, oldOffset) + store(ctxptr, c.End.Next.ElemIdx, uintptr(unsafe.Pointer(code.Next))) + storeIndent(ctxptr, c.End.Next, uintptr(oldBaseIndent)) + code = c + recursiveLevel++ + case encoder.OpRecursiveEnd: + recursiveLevel-- + + // restore ctxptr + restoreIndent(ctx, code, ctxptr) + offset := load(ctxptr, code.Idx) + ctx.SeenPtr = ctx.SeenPtr[:len(ctx.SeenPtr)-1] + + codePtr := load(ctxptr, code.ElemIdx) + code = (*encoder.Opcode)(ptrToUnsafePtr(codePtr)) + ctxptr = ctx.Ptr() + offset + ptrOffset = offset + case encoder.OpStructPtrHead: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHead: + p := load(ctxptr, code.Idx) + if p == 0 && ((code.Flags&encoder.IndirectFlags) != 0 || code.Next.Op == encoder.OpStructEnd) { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if len(code.Key) > 0 { + if (code.Flags&encoder.IsTaggedKeyFlags) != 0 || code.Flags&encoder.AnonymousKeyFlags == 0 { + b = appendStructKey(ctx, code, b) + } + } + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructPtrHeadOmitEmpty: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmpty: + p := load(ctxptr, code.Idx) + if p == 0 && ((code.Flags&encoder.IndirectFlags) != 0 || code.Next.Op == encoder.OpStructEnd) { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + if p == 0 || (ptrToPtr(p) == 0 && (code.Flags&encoder.IsNextOpPtrTypeFlags) != 0) { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadInt: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadInt: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyInt: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyInt: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadIntString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadIntString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyIntString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyIntString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + u64 := ptrToUint64(p, code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadIntPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadIntPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendInt(ctx, b, p, code) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyIntPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyIntPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p, code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadIntPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadIntPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyIntPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyIntPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadUint: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadUint: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyUint: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyUint: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadUintString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadUintString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyUintString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyUintString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadUintPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadUintPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendUint(ctx, b, p, code) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyUintPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyUintPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p, code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadUintPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadUintPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyUintPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyUintPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadFloat32: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadFloat32: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat32: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyFloat32: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat32(p + uintptr(code.Offset)) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadFloat32String: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadFloat32String: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat32String: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyFloat32String: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat32(p + uintptr(code.Offset)) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadFloat32Ptr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadFloat32Ptr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendFloat32(ctx, b, ptrToFloat32(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat32Ptr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyFloat32Ptr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadFloat32PtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadFloat32PtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat32PtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyFloat32PtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadFloat64: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadFloat64: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat64: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyFloat64: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat64(p + uintptr(code.Offset)) + if v == 0 { + code = code.NextField + } else { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadFloat64String: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadFloat64String: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat64String: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyFloat64String: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat64(p + uintptr(code.Offset)) + if v == 0 { + code = code.NextField + } else { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadFloat64Ptr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadFloat64Ptr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat64Ptr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyFloat64Ptr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadFloat64PtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadFloat64PtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat64PtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyFloat64PtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNull(ctx, b) + b = appendComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToString(p + uintptr(code.Offset)) + if v == "" { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadStringString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadStringString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p+uintptr(code.Offset))))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyStringString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyStringString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToString(p + uintptr(code.Offset)) + if v == "" { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, v))) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadStringPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadStringPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, ptrToString(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyStringPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyStringPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadStringPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadStringPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyStringPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyStringPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadBool: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadBool: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBool: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyBool: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } else { + code = code.NextField + } + case encoder.OpStructPtrHeadBoolString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadBoolString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBoolString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyBoolString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } else { + code = code.NextField + } + case encoder.OpStructPtrHeadBoolPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadBoolPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendBool(ctx, b, ptrToBool(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBoolPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyBoolPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadBoolPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadBoolPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBoolPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyBoolPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadBytes: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadBytes: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBytes: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyBytes: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToBytes(p + uintptr(code.Offset)) + if len(v) == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadBytesPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadBytesPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendByteSlice(ctx, b, ptrToBytes(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBytesPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyBytesPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadNumber: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadNumber: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyNumber: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyNumber: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToNumber(p + uintptr(code.Offset)) + if v == "" { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + } + case encoder.OpStructPtrHeadNumberString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadNumberString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyNumberString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyNumberString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToNumber(p + uintptr(code.Offset)) + if v == "" { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadNumberPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadNumberPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyNumberPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyNumberPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructPtrHeadNumberPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadNumberPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyNumberPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyNumberPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadArray, encoder.OpStructPtrHeadSlice: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadArray, encoder.OpStructHeadSlice: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructPtrHeadOmitEmptyArray: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyArray: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructPtrHeadOmitEmptySlice: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptySlice: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + slice := ptrToSlice(p) + if slice.Len == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadArrayPtr, encoder.OpStructPtrHeadSlicePtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadArrayPtr, encoder.OpStructHeadSlicePtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNullComma(ctx, b) + code = code.NextField + } else { + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadOmitEmptyArrayPtr, encoder.OpStructPtrHeadOmitEmptySlicePtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyArrayPtr, encoder.OpStructHeadOmitEmptySlicePtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadMap: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadMap: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if p != 0 && (code.Flags&encoder.IndirectFlags) != 0 { + p = ptrToPtr(p + uintptr(code.Offset)) + } + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructPtrHeadOmitEmptyMap: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyMap: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if p != 0 && (code.Flags&encoder.IndirectFlags) != 0 { + p = ptrToPtr(p + uintptr(code.Offset)) + } + if maplen(ptrToUnsafePtr(p)) == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadMapPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadMapPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.NextField + break + } + p = ptrToPtr(p + uintptr(code.Offset)) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.NextField + } else { + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p, code.PtrNum) + } + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadOmitEmptyMapPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyMapPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if p == 0 { + code = code.NextField + break + } + p = ptrToPtr(p + uintptr(code.Offset)) + if p == 0 { + code = code.NextField + } else { + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p, code.PtrNum) + } + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + if (code.Flags&encoder.IndirectFlags) != 0 || code.Op == encoder.OpStructPtrHeadMarshalJSON { + p = ptrToPtr(p) + } + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + if (code.Flags&encoder.IndirectFlags) != 0 || code.Op == encoder.OpStructPtrHeadOmitEmptyMarshalJSON { + p = ptrToPtr(p) + } + } + iface := ptrToInterface(code, p) + if (code.Flags&encoder.NilCheckFlags) != 0 && encoder.IsNilForMarshaler(iface) { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalJSON(ctx, code, b, iface) + if err != nil { + return nil, err + } + b = bb + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if p == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + if (code.Flags&encoder.IndirectFlags) != 0 || code.Op == encoder.OpStructPtrHeadMarshalText { + p = ptrToPtr(p) + } + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + if (code.Flags&encoder.IndirectFlags) != 0 || code.Op == encoder.OpStructPtrHeadOmitEmptyMarshalText { + p = ptrToPtr(p) + } + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if p == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructField: + if code.Flags&encoder.IsTaggedKeyFlags != 0 || code.Flags&encoder.AnonymousKeyFlags == 0 { + b = appendStructKey(ctx, code, b) + } + p := load(ctxptr, code.Idx) + uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmpty: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + if ptrToPtr(p) == 0 && (code.Flags&encoder.IsNextOpPtrTypeFlags) != 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructFieldInt: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyInt: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldIntString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyIntString: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldIntPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendInt(ctx, b, p, code) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyIntPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p, code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldIntPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyIntPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldUint: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyUint: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldUintString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyUintString: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldUintPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendUint(ctx, b, p, code) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyUintPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p, code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldUintPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyUintPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat32: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat32: + p := load(ctxptr, code.Idx) + v := ptrToFloat32(p + uintptr(code.Offset)) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat32String: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat32String: + p := load(ctxptr, code.Idx) + v := ptrToFloat32(p + uintptr(code.Offset)) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat32Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendFloat32(ctx, b, ptrToFloat32(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat32Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat32PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat32PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat64: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat64: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if v != 0 { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat64String: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat64String: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if v != 0 { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat64Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat64Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat64PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat64PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyString: + p := load(ctxptr, code.Idx) + v := ptrToString(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldStringString: + p := load(ctxptr, code.Idx) + s := ptrToString(p + uintptr(code.Offset)) + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, s))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyStringString: + p := load(ctxptr, code.Idx) + v := ptrToString(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, v))) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldStringPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, ptrToString(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyStringPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldStringPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyStringPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBool: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBool: + p := load(ctxptr, code.Idx) + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBoolString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBoolString: + p := load(ctxptr, code.Idx) + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBoolPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendBool(ctx, b, ptrToBool(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBoolPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBoolPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBoolPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBytes: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBytes: + p := load(ctxptr, code.Idx) + v := ptrToBytes(p + uintptr(code.Offset)) + if len(v) > 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBytesPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendByteSlice(ctx, b, ptrToBytes(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBytesPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldNumber: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpStructFieldOmitEmptyNumber: + p := load(ctxptr, code.Idx) + v := ptrToNumber(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructFieldNumberString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyNumberString: + p := load(ctxptr, code.Idx) + v := ptrToNumber(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldNumberPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyNumberPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructFieldNumberPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyNumberPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldMarshalJSON: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + p = ptrToPtr(p) + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyMarshalJSON: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + p = ptrToPtr(p) + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + code = code.NextField + break + } + iface := ptrToInterface(code, p) + if (code.Flags&encoder.NilCheckFlags) != 0 && encoder.IsNilForMarshaler(iface) { + code = code.NextField + break + } + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalJSON(ctx, code, b, iface) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpStructFieldMarshalJSONPtr: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyMarshalJSONPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructFieldMarshalText: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + p = ptrToPtr(p) + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyMarshalText: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + p = ptrToPtr(p) + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + code = code.NextField + break + } + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpStructFieldMarshalTextPtr: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyMarshalTextPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructFieldArray: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyArray: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldArrayPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyArrayPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } else { + code = code.NextField + } + case encoder.OpStructFieldSlice: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptySlice: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + slice := ptrToSlice(p) + if slice.Len == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructFieldSlicePtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptySlicePtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } else { + code = code.NextField + } + case encoder.OpStructFieldMap: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToPtr(p + uintptr(code.Offset)) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyMap: + p := load(ctxptr, code.Idx) + p = ptrToPtr(p + uintptr(code.Offset)) + if p == 0 || maplen(ptrToUnsafePtr(p)) == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructFieldMapPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToPtr(p + uintptr(code.Offset)) + if p != 0 { + p = ptrToNPtr(p, code.PtrNum) + } + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyMapPtr: + p := load(ctxptr, code.Idx) + p = ptrToPtr(p + uintptr(code.Offset)) + if p != 0 { + p = ptrToNPtr(p, code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } else { + code = code.NextField + } + case encoder.OpStructFieldStruct: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyStruct: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + if ptrToPtr(p) == 0 && (code.Flags&encoder.IsNextOpPtrTypeFlags) != 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructEnd: + b = appendStructEndSkipLast(ctx, code, b) + code = code.Next + case encoder.OpStructEndInt: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyInt: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndIntString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyIntString: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndIntPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendInt(ctx, b, p, code) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyIntPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p, code) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndIntPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyIntPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndUint: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyUint: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndUintString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyUintString: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndUintPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendUint(ctx, b, p, code) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyUintPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p, code) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndUintPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyUintPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat32: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat32: + p := load(ctxptr, code.Idx) + v := ptrToFloat32(p + uintptr(code.Offset)) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat32String: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat32String: + p := load(ctxptr, code.Idx) + v := ptrToFloat32(p + uintptr(code.Offset)) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat32Ptr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendFloat32(ctx, b, ptrToFloat32(p)) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat32Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat32PtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat32PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat64: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat64: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if v != 0 { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat64String: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat64String: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if v != 0 { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat64Ptr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + b = appendStructEnd(ctx, code, b) + code = code.Next + break + } + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat64Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat64PtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat64PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p+uintptr(code.Offset))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyString: + p := load(ctxptr, code.Idx) + v := ptrToString(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndStringString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + s := ptrToString(p + uintptr(code.Offset)) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, s))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyStringString: + p := load(ctxptr, code.Idx) + v := ptrToString(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, v))) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndStringPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, ptrToString(p)) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyStringPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p)) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndStringPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyStringPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBool: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBool: + p := load(ctxptr, code.Idx) + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBoolString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBoolString: + p := load(ctxptr, code.Idx) + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBoolPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendBool(ctx, b, ptrToBool(p)) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBoolPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p)) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBoolPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBoolPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBytes: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p+uintptr(code.Offset))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBytes: + p := load(ctxptr, code.Idx) + v := ptrToBytes(p + uintptr(code.Offset)) + if len(v) > 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBytesPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendByteSlice(ctx, b, ptrToBytes(p)) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBytesPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p)) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndNumber: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = appendStructEnd(ctx, code, bb) + code = code.Next + case encoder.OpStructEndOmitEmptyNumber: + p := load(ctxptr, code.Idx) + v := ptrToNumber(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = appendStructEnd(ctx, code, bb) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndNumberString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyNumberString: + p := load(ctxptr, code.Idx) + v := ptrToNumber(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndNumberPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyNumberPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = appendStructEnd(ctx, code, bb) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndNumberPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyNumberPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpEnd: + goto END + } + } +END: + return b, nil +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm_color/debug_vm.go b/vendor/github.com/goccy/go-json/internal/encoder/vm_color/debug_vm.go new file mode 100644 index 000000000..925f61ed8 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm_color/debug_vm.go @@ -0,0 +1,35 @@ +package vm_color + +import ( + "fmt" + + "github.com/goccy/go-json/internal/encoder" +) + +func DebugRun(ctx *encoder.RuntimeContext, b []byte, codeSet *encoder.OpcodeSet) ([]byte, error) { + var code *encoder.Opcode + if (ctx.Option.Flag & encoder.HTMLEscapeOption) != 0 { + code = codeSet.EscapeKeyCode + } else { + code = codeSet.NoescapeKeyCode + } + + defer func() { + if err := recover(); err != nil { + w := ctx.Option.DebugOut + fmt.Fprintln(w, "=============[DEBUG]===============") + fmt.Fprintln(w, "* [TYPE]") + fmt.Fprintln(w, codeSet.Type) + fmt.Fprintf(w, "\n") + fmt.Fprintln(w, "* [ALL OPCODE]") + fmt.Fprintln(w, code.Dump()) + fmt.Fprintf(w, "\n") + fmt.Fprintln(w, "* [CONTEXT]") + fmt.Fprintf(w, "%+v\n", ctx) + fmt.Fprintln(w, "===================================") + panic(err) + } + }() + + return Run(ctx, b, codeSet) +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm_color/hack.go b/vendor/github.com/goccy/go-json/internal/encoder/vm_color/hack.go new file mode 100644 index 000000000..12ec56c5b --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm_color/hack.go @@ -0,0 +1,9 @@ +package vm_color + +import ( + // HACK: compile order + // `vm`, `vm_indent`, `vm_color`, `vm_color_indent` packages uses a lot of memory to compile, + // so forcibly make dependencies and avoid compiling in concurrent. + // dependency order: vm => vm_indent => vm_color => vm_color_indent + _ "github.com/goccy/go-json/internal/encoder/vm_color_indent" +) diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm_color/util.go b/vendor/github.com/goccy/go-json/internal/encoder/vm_color/util.go new file mode 100644 index 000000000..33f29aee4 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm_color/util.go @@ -0,0 +1,274 @@ +package vm_color + +import ( + "encoding/json" + "fmt" + "unsafe" + + "github.com/goccy/go-json/internal/encoder" + "github.com/goccy/go-json/internal/runtime" +) + +const uintptrSize = 4 << (^uintptr(0) >> 63) + +var ( + errUnsupportedValue = encoder.ErrUnsupportedValue + errUnsupportedFloat = encoder.ErrUnsupportedFloat + mapiterinit = encoder.MapIterInit + mapiterkey = encoder.MapIterKey + mapitervalue = encoder.MapIterValue + mapiternext = encoder.MapIterNext + maplen = encoder.MapLen +) + +type emptyInterface struct { + typ *runtime.Type + ptr unsafe.Pointer +} + +type nonEmptyInterface struct { + itab *struct { + ityp *runtime.Type // static interface type + typ *runtime.Type // dynamic concrete type + // unused fields... + } + ptr unsafe.Pointer +} + +func errUnimplementedOp(op encoder.OpType) error { + return fmt.Errorf("encoder: opcode %s has not been implemented", op) +} + +func load(base uintptr, idx uint32) uintptr { + addr := base + uintptr(idx) + return **(**uintptr)(unsafe.Pointer(&addr)) +} + +func store(base uintptr, idx uint32, p uintptr) { + addr := base + uintptr(idx) + **(**uintptr)(unsafe.Pointer(&addr)) = p +} + +func loadNPtr(base uintptr, idx uint32, ptrNum uint8) uintptr { + addr := base + uintptr(idx) + p := **(**uintptr)(unsafe.Pointer(&addr)) + for i := uint8(0); i < ptrNum; i++ { + if p == 0 { + return 0 + } + p = ptrToPtr(p) + } + return p +} + +func ptrToUint64(p uintptr, bitSize uint8) uint64 { + switch bitSize { + case 8: + return (uint64)(**(**uint8)(unsafe.Pointer(&p))) + case 16: + return (uint64)(**(**uint16)(unsafe.Pointer(&p))) + case 32: + return (uint64)(**(**uint32)(unsafe.Pointer(&p))) + case 64: + return **(**uint64)(unsafe.Pointer(&p)) + } + return 0 +} +func ptrToFloat32(p uintptr) float32 { return **(**float32)(unsafe.Pointer(&p)) } +func ptrToFloat64(p uintptr) float64 { return **(**float64)(unsafe.Pointer(&p)) } +func ptrToBool(p uintptr) bool { return **(**bool)(unsafe.Pointer(&p)) } +func ptrToBytes(p uintptr) []byte { return **(**[]byte)(unsafe.Pointer(&p)) } +func ptrToNumber(p uintptr) json.Number { return **(**json.Number)(unsafe.Pointer(&p)) } +func ptrToString(p uintptr) string { return **(**string)(unsafe.Pointer(&p)) } +func ptrToSlice(p uintptr) *runtime.SliceHeader { return *(**runtime.SliceHeader)(unsafe.Pointer(&p)) } +func ptrToPtr(p uintptr) uintptr { + return uintptr(**(**unsafe.Pointer)(unsafe.Pointer(&p))) +} +func ptrToNPtr(p uintptr, ptrNum uint8) uintptr { + for i := uint8(0); i < ptrNum; i++ { + if p == 0 { + return 0 + } + p = ptrToPtr(p) + } + return p +} + +func ptrToUnsafePtr(p uintptr) unsafe.Pointer { + return *(*unsafe.Pointer)(unsafe.Pointer(&p)) +} +func ptrToInterface(code *encoder.Opcode, p uintptr) interface{} { + return *(*interface{})(unsafe.Pointer(&emptyInterface{ + typ: code.Type, + ptr: *(*unsafe.Pointer)(unsafe.Pointer(&p)), + })) +} + +func appendInt(ctx *encoder.RuntimeContext, b []byte, p uintptr, code *encoder.Opcode) []byte { + format := ctx.Option.ColorScheme.Int + b = append(b, format.Header...) + b = encoder.AppendInt(ctx, b, p, code) + return append(b, format.Footer...) +} + +func appendUint(ctx *encoder.RuntimeContext, b []byte, p uintptr, code *encoder.Opcode) []byte { + format := ctx.Option.ColorScheme.Uint + b = append(b, format.Header...) + b = encoder.AppendUint(ctx, b, p, code) + return append(b, format.Footer...) +} + +func appendFloat32(ctx *encoder.RuntimeContext, b []byte, v float32) []byte { + format := ctx.Option.ColorScheme.Float + b = append(b, format.Header...) + b = encoder.AppendFloat32(ctx, b, v) + return append(b, format.Footer...) +} + +func appendFloat64(ctx *encoder.RuntimeContext, b []byte, v float64) []byte { + format := ctx.Option.ColorScheme.Float + b = append(b, format.Header...) + b = encoder.AppendFloat64(ctx, b, v) + return append(b, format.Footer...) +} + +func appendString(ctx *encoder.RuntimeContext, b []byte, v string) []byte { + format := ctx.Option.ColorScheme.String + b = append(b, format.Header...) + b = encoder.AppendString(ctx, b, v) + return append(b, format.Footer...) +} + +func appendByteSlice(ctx *encoder.RuntimeContext, b []byte, src []byte) []byte { + format := ctx.Option.ColorScheme.Binary + b = append(b, format.Header...) + b = encoder.AppendByteSlice(ctx, b, src) + return append(b, format.Footer...) +} + +func appendNumber(ctx *encoder.RuntimeContext, b []byte, n json.Number) ([]byte, error) { + format := ctx.Option.ColorScheme.Int + b = append(b, format.Header...) + bb, err := encoder.AppendNumber(ctx, b, n) + if err != nil { + return nil, err + } + return append(bb, format.Footer...), nil +} + +func appendBool(ctx *encoder.RuntimeContext, b []byte, v bool) []byte { + format := ctx.Option.ColorScheme.Bool + b = append(b, format.Header...) + if v { + b = append(b, "true"...) + } else { + b = append(b, "false"...) + } + return append(b, format.Footer...) +} + +func appendNull(ctx *encoder.RuntimeContext, b []byte) []byte { + format := ctx.Option.ColorScheme.Null + b = append(b, format.Header...) + b = append(b, "null"...) + return append(b, format.Footer...) +} + +func appendComma(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, ',') +} + +func appendNullComma(ctx *encoder.RuntimeContext, b []byte) []byte { + format := ctx.Option.ColorScheme.Null + b = append(b, format.Header...) + b = append(b, "null"...) + return append(append(b, format.Footer...), ',') +} + +func appendColon(_ *encoder.RuntimeContext, b []byte) []byte { + last := len(b) - 1 + b[last] = ':' + return b +} + +func appendMapKeyValue(_ *encoder.RuntimeContext, _ *encoder.Opcode, b, key, value []byte) []byte { + b = append(b, key[:len(key)-1]...) + b = append(b, ':') + return append(b, value...) +} + +func appendMapEnd(_ *encoder.RuntimeContext, _ *encoder.Opcode, b []byte) []byte { + last := len(b) - 1 + b[last] = '}' + b = append(b, ',') + return b +} + +func appendMarshalJSON(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte, v interface{}) ([]byte, error) { + return encoder.AppendMarshalJSON(ctx, code, b, v) +} + +func appendMarshalText(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte, v interface{}) ([]byte, error) { + format := ctx.Option.ColorScheme.String + b = append(b, format.Header...) + bb, err := encoder.AppendMarshalText(ctx, code, b, v) + if err != nil { + return nil, err + } + return append(bb, format.Footer...), nil +} + +func appendArrayHead(_ *encoder.RuntimeContext, _ *encoder.Opcode, b []byte) []byte { + return append(b, '[') +} + +func appendArrayEnd(_ *encoder.RuntimeContext, _ *encoder.Opcode, b []byte) []byte { + last := len(b) - 1 + b[last] = ']' + return append(b, ',') +} + +func appendEmptyArray(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, '[', ']', ',') +} + +func appendEmptyObject(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, '{', '}', ',') +} + +func appendObjectEnd(_ *encoder.RuntimeContext, _ *encoder.Opcode, b []byte) []byte { + last := len(b) - 1 + b[last] = '}' + return append(b, ',') +} + +func appendStructHead(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, '{') +} + +func appendStructKey(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + format := ctx.Option.ColorScheme.ObjectKey + b = append(b, format.Header...) + b = append(b, code.Key[:len(code.Key)-1]...) + b = append(b, format.Footer...) + + return append(b, ':') +} + +func appendStructEnd(_ *encoder.RuntimeContext, _ *encoder.Opcode, b []byte) []byte { + return append(b, '}', ',') +} + +func appendStructEndSkipLast(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + last := len(b) - 1 + if b[last] == ',' { + b[last] = '}' + return appendComma(ctx, b) + } + return appendStructEnd(ctx, code, b) +} + +func restoreIndent(_ *encoder.RuntimeContext, _ *encoder.Opcode, _ uintptr) {} +func storeIndent(_ uintptr, _ *encoder.Opcode, _ uintptr) {} +func appendMapKeyIndent(_ *encoder.RuntimeContext, _ *encoder.Opcode, b []byte) []byte { return b } +func appendArrayElemIndent(_ *encoder.RuntimeContext, _ *encoder.Opcode, b []byte) []byte { return b } diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm_color/vm.go b/vendor/github.com/goccy/go-json/internal/encoder/vm_color/vm.go new file mode 100644 index 000000000..a63e83e55 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm_color/vm.go @@ -0,0 +1,4859 @@ +// Code generated by internal/cmd/generator. DO NOT EDIT! +package vm_color + +import ( + "math" + "reflect" + "sort" + "unsafe" + + "github.com/goccy/go-json/internal/encoder" + "github.com/goccy/go-json/internal/runtime" +) + +func Run(ctx *encoder.RuntimeContext, b []byte, codeSet *encoder.OpcodeSet) ([]byte, error) { + recursiveLevel := 0 + ptrOffset := uintptr(0) + ctxptr := ctx.Ptr() + var code *encoder.Opcode + if (ctx.Option.Flag & encoder.HTMLEscapeOption) != 0 { + code = codeSet.EscapeKeyCode + } else { + code = codeSet.NoescapeKeyCode + } + + for { + switch code.Op { + default: + return nil, errUnimplementedOp(code.Op) + case encoder.OpPtr: + p := load(ctxptr, code.Idx) + code = code.Next + store(ctxptr, code.Idx, ptrToPtr(p)) + case encoder.OpIntPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpInt: + b = appendInt(ctx, b, load(ctxptr, code.Idx), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpUintPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpUint: + b = appendUint(ctx, b, load(ctxptr, code.Idx), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpIntString: + b = append(b, '"') + b = appendInt(ctx, b, load(ctxptr, code.Idx), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpUintString: + b = append(b, '"') + b = appendUint(ctx, b, load(ctxptr, code.Idx), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpFloat32Ptr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + b = appendComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpFloat32: + b = appendFloat32(ctx, b, ptrToFloat32(load(ctxptr, code.Idx))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpFloat64Ptr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpFloat64: + v := ptrToFloat64(load(ctxptr, code.Idx)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStringPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpString: + b = appendString(ctx, b, ptrToString(load(ctxptr, code.Idx))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpBoolPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpBool: + b = appendBool(ctx, b, ptrToBool(load(ctxptr, code.Idx))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpBytesPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpBytes: + b = appendByteSlice(ctx, b, ptrToBytes(load(ctxptr, code.Idx))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpNumberPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpNumber: + bb, err := appendNumber(ctx, b, ptrToNumber(load(ctxptr, code.Idx))) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpInterfacePtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpInterface: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + if recursiveLevel > encoder.StartDetectingCyclesAfter { + for _, seen := range ctx.SeenPtr { + if p == seen { + return nil, errUnsupportedValue(code, p) + } + } + } + ctx.SeenPtr = append(ctx.SeenPtr, p) + var ( + typ *runtime.Type + ifacePtr unsafe.Pointer + ) + up := ptrToUnsafePtr(p) + if code.Flags&encoder.NonEmptyInterfaceFlags != 0 { + iface := (*nonEmptyInterface)(up) + ifacePtr = iface.ptr + if iface.itab != nil { + typ = iface.itab.typ + } + } else { + iface := (*emptyInterface)(up) + ifacePtr = iface.ptr + typ = iface.typ + } + if ifacePtr == nil { + isDirectedNil := typ != nil && typ.Kind() == reflect.Struct && !runtime.IfaceIndir(typ) + if !isDirectedNil { + b = appendNullComma(ctx, b) + code = code.Next + break + } + } + ctx.KeepRefs = append(ctx.KeepRefs, up) + ifaceCodeSet, err := encoder.CompileToGetCodeSet(ctx, uintptr(unsafe.Pointer(typ))) + if err != nil { + return nil, err + } + + totalLength := uintptr(code.Length) + 3 + nextTotalLength := uintptr(ifaceCodeSet.CodeLength) + 3 + + var c *encoder.Opcode + if (ctx.Option.Flag & encoder.HTMLEscapeOption) != 0 { + c = ifaceCodeSet.InterfaceEscapeKeyCode + } else { + c = ifaceCodeSet.InterfaceNoescapeKeyCode + } + curlen := uintptr(len(ctx.Ptrs)) + offsetNum := ptrOffset / uintptrSize + oldOffset := ptrOffset + ptrOffset += totalLength * uintptrSize + oldBaseIndent := ctx.BaseIndent + ctx.BaseIndent += code.Indent + + newLen := offsetNum + totalLength + nextTotalLength + if curlen < newLen { + ctx.Ptrs = append(ctx.Ptrs, make([]uintptr, newLen-curlen)...) + } + ctxptr = ctx.Ptr() + ptrOffset // assign new ctxptr + + end := ifaceCodeSet.EndCode + store(ctxptr, c.Idx, uintptr(ifacePtr)) + store(ctxptr, end.Idx, oldOffset) + store(ctxptr, end.ElemIdx, uintptr(unsafe.Pointer(code.Next))) + storeIndent(ctxptr, end, uintptr(oldBaseIndent)) + code = c + recursiveLevel++ + case encoder.OpInterfaceEnd: + recursiveLevel-- + + // restore ctxptr + offset := load(ctxptr, code.Idx) + restoreIndent(ctx, code, ctxptr) + ctx.SeenPtr = ctx.SeenPtr[:len(ctx.SeenPtr)-1] + + codePtr := load(ctxptr, code.ElemIdx) + code = (*encoder.Opcode)(ptrToUnsafePtr(codePtr)) + ctxptr = ctx.Ptr() + offset + ptrOffset = offset + case encoder.OpMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, ptrToPtr(p)) + fallthrough + case encoder.OpMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + if (code.Flags&encoder.IsNilableTypeFlags) != 0 && (code.Flags&encoder.IndirectFlags) != 0 { + p = ptrToPtr(p) + } + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, ptrToPtr(p)) + fallthrough + case encoder.OpMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 { + b = append(b, `""`...) + b = appendComma(ctx, b) + code = code.Next + break + } + if (code.Flags&encoder.IsNilableTypeFlags) != 0 && (code.Flags&encoder.IndirectFlags) != 0 { + p = ptrToPtr(p) + } + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpSlicePtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpSlice: + p := load(ctxptr, code.Idx) + slice := ptrToSlice(p) + if p == 0 || slice.Data == nil { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + store(ctxptr, code.ElemIdx, 0) + store(ctxptr, code.Length, uintptr(slice.Len)) + store(ctxptr, code.Idx, uintptr(slice.Data)) + if slice.Len > 0 { + b = appendArrayHead(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, uintptr(slice.Data)) + } else { + b = appendEmptyArray(ctx, b) + code = code.End.Next + } + case encoder.OpSliceElem: + idx := load(ctxptr, code.ElemIdx) + length := load(ctxptr, code.Length) + idx++ + if idx < length { + b = appendArrayElemIndent(ctx, code, b) + store(ctxptr, code.ElemIdx, idx) + data := load(ctxptr, code.Idx) + size := uintptr(code.Size) + code = code.Next + store(ctxptr, code.Idx, data+idx*size) + } else { + b = appendArrayEnd(ctx, code, b) + code = code.End.Next + } + case encoder.OpArrayPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpArray: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + if code.Length > 0 { + b = appendArrayHead(ctx, code, b) + store(ctxptr, code.ElemIdx, 0) + code = code.Next + store(ctxptr, code.Idx, p) + } else { + b = appendEmptyArray(ctx, b) + code = code.End.Next + } + case encoder.OpArrayElem: + idx := load(ctxptr, code.ElemIdx) + idx++ + if idx < uintptr(code.Length) { + b = appendArrayElemIndent(ctx, code, b) + store(ctxptr, code.ElemIdx, idx) + p := load(ctxptr, code.Idx) + size := uintptr(code.Size) + code = code.Next + store(ctxptr, code.Idx, p+idx*size) + } else { + b = appendArrayEnd(ctx, code, b) + code = code.End.Next + } + case encoder.OpMapPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpMap: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + uptr := ptrToUnsafePtr(p) + mlen := maplen(uptr) + if mlen <= 0 { + b = appendEmptyObject(ctx, b) + code = code.End.Next + break + } + b = appendStructHead(ctx, b) + unorderedMap := (ctx.Option.Flag & encoder.UnorderedMapOption) != 0 + mapCtx := encoder.NewMapContext(mlen, unorderedMap) + mapiterinit(code.Type, uptr, &mapCtx.Iter) + store(ctxptr, code.Idx, uintptr(unsafe.Pointer(mapCtx))) + ctx.KeepRefs = append(ctx.KeepRefs, unsafe.Pointer(mapCtx)) + if unorderedMap { + b = appendMapKeyIndent(ctx, code.Next, b) + } else { + mapCtx.Start = len(b) + mapCtx.First = len(b) + } + key := mapiterkey(&mapCtx.Iter) + store(ctxptr, code.Next.Idx, uintptr(key)) + code = code.Next + case encoder.OpMapKey: + mapCtx := (*encoder.MapContext)(ptrToUnsafePtr(load(ctxptr, code.Idx))) + idx := mapCtx.Idx + idx++ + if (ctx.Option.Flag & encoder.UnorderedMapOption) != 0 { + if idx < mapCtx.Len { + b = appendMapKeyIndent(ctx, code, b) + mapCtx.Idx = int(idx) + key := mapiterkey(&mapCtx.Iter) + store(ctxptr, code.Next.Idx, uintptr(key)) + code = code.Next + } else { + b = appendObjectEnd(ctx, code, b) + encoder.ReleaseMapContext(mapCtx) + code = code.End.Next + } + } else { + mapCtx.Slice.Items[mapCtx.Idx].Value = b[mapCtx.Start:len(b)] + if idx < mapCtx.Len { + mapCtx.Idx = int(idx) + mapCtx.Start = len(b) + key := mapiterkey(&mapCtx.Iter) + store(ctxptr, code.Next.Idx, uintptr(key)) + code = code.Next + } else { + code = code.End + } + } + case encoder.OpMapValue: + mapCtx := (*encoder.MapContext)(ptrToUnsafePtr(load(ctxptr, code.Idx))) + if (ctx.Option.Flag & encoder.UnorderedMapOption) != 0 { + b = appendColon(ctx, b) + } else { + mapCtx.Slice.Items[mapCtx.Idx].Key = b[mapCtx.Start:len(b)] + mapCtx.Start = len(b) + } + value := mapitervalue(&mapCtx.Iter) + store(ctxptr, code.Next.Idx, uintptr(value)) + mapiternext(&mapCtx.Iter) + code = code.Next + case encoder.OpMapEnd: + // this operation only used by sorted map. + mapCtx := (*encoder.MapContext)(ptrToUnsafePtr(load(ctxptr, code.Idx))) + sort.Sort(mapCtx.Slice) + buf := mapCtx.Buf + for _, item := range mapCtx.Slice.Items { + buf = appendMapKeyValue(ctx, code, buf, item.Key, item.Value) + } + buf = appendMapEnd(ctx, code, buf) + b = b[:mapCtx.First] + b = append(b, buf...) + mapCtx.Buf = buf + encoder.ReleaseMapContext(mapCtx) + code = code.Next + case encoder.OpRecursivePtr: + p := load(ctxptr, code.Idx) + if p == 0 { + code = code.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpRecursive: + ptr := load(ctxptr, code.Idx) + if ptr != 0 { + if recursiveLevel > encoder.StartDetectingCyclesAfter { + for _, seen := range ctx.SeenPtr { + if ptr == seen { + return nil, errUnsupportedValue(code, ptr) + } + } + } + } + ctx.SeenPtr = append(ctx.SeenPtr, ptr) + c := code.Jmp.Code + curlen := uintptr(len(ctx.Ptrs)) + offsetNum := ptrOffset / uintptrSize + oldOffset := ptrOffset + ptrOffset += code.Jmp.CurLen * uintptrSize + oldBaseIndent := ctx.BaseIndent + indentDiffFromTop := c.Indent - 1 + ctx.BaseIndent += code.Indent - indentDiffFromTop + + newLen := offsetNum + code.Jmp.CurLen + code.Jmp.NextLen + if curlen < newLen { + ctx.Ptrs = append(ctx.Ptrs, make([]uintptr, newLen-curlen)...) + } + ctxptr = ctx.Ptr() + ptrOffset // assign new ctxptr + + store(ctxptr, c.Idx, ptr) + store(ctxptr, c.End.Next.Idx, oldOffset) + store(ctxptr, c.End.Next.ElemIdx, uintptr(unsafe.Pointer(code.Next))) + storeIndent(ctxptr, c.End.Next, uintptr(oldBaseIndent)) + code = c + recursiveLevel++ + case encoder.OpRecursiveEnd: + recursiveLevel-- + + // restore ctxptr + restoreIndent(ctx, code, ctxptr) + offset := load(ctxptr, code.Idx) + ctx.SeenPtr = ctx.SeenPtr[:len(ctx.SeenPtr)-1] + + codePtr := load(ctxptr, code.ElemIdx) + code = (*encoder.Opcode)(ptrToUnsafePtr(codePtr)) + ctxptr = ctx.Ptr() + offset + ptrOffset = offset + case encoder.OpStructPtrHead: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHead: + p := load(ctxptr, code.Idx) + if p == 0 && ((code.Flags&encoder.IndirectFlags) != 0 || code.Next.Op == encoder.OpStructEnd) { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if len(code.Key) > 0 { + if (code.Flags&encoder.IsTaggedKeyFlags) != 0 || code.Flags&encoder.AnonymousKeyFlags == 0 { + b = appendStructKey(ctx, code, b) + } + } + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructPtrHeadOmitEmpty: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmpty: + p := load(ctxptr, code.Idx) + if p == 0 && ((code.Flags&encoder.IndirectFlags) != 0 || code.Next.Op == encoder.OpStructEnd) { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + if p == 0 || (ptrToPtr(p) == 0 && (code.Flags&encoder.IsNextOpPtrTypeFlags) != 0) { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadInt: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadInt: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyInt: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyInt: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadIntString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadIntString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyIntString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyIntString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + u64 := ptrToUint64(p, code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadIntPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadIntPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendInt(ctx, b, p, code) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyIntPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyIntPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p, code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadIntPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadIntPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyIntPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyIntPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadUint: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadUint: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyUint: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyUint: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadUintString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadUintString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyUintString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyUintString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadUintPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadUintPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendUint(ctx, b, p, code) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyUintPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyUintPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p, code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadUintPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadUintPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyUintPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyUintPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadFloat32: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadFloat32: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat32: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyFloat32: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat32(p + uintptr(code.Offset)) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadFloat32String: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadFloat32String: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat32String: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyFloat32String: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat32(p + uintptr(code.Offset)) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadFloat32Ptr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadFloat32Ptr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendFloat32(ctx, b, ptrToFloat32(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat32Ptr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyFloat32Ptr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadFloat32PtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadFloat32PtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat32PtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyFloat32PtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadFloat64: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadFloat64: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat64: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyFloat64: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat64(p + uintptr(code.Offset)) + if v == 0 { + code = code.NextField + } else { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadFloat64String: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadFloat64String: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat64String: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyFloat64String: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat64(p + uintptr(code.Offset)) + if v == 0 { + code = code.NextField + } else { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadFloat64Ptr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadFloat64Ptr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat64Ptr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyFloat64Ptr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadFloat64PtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadFloat64PtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat64PtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyFloat64PtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNull(ctx, b) + b = appendComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToString(p + uintptr(code.Offset)) + if v == "" { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadStringString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadStringString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p+uintptr(code.Offset))))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyStringString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyStringString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToString(p + uintptr(code.Offset)) + if v == "" { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, v))) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadStringPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadStringPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, ptrToString(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyStringPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyStringPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadStringPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadStringPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyStringPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyStringPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadBool: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadBool: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBool: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyBool: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } else { + code = code.NextField + } + case encoder.OpStructPtrHeadBoolString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadBoolString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBoolString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyBoolString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } else { + code = code.NextField + } + case encoder.OpStructPtrHeadBoolPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadBoolPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendBool(ctx, b, ptrToBool(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBoolPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyBoolPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadBoolPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadBoolPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBoolPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyBoolPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadBytes: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadBytes: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBytes: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyBytes: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToBytes(p + uintptr(code.Offset)) + if len(v) == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadBytesPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadBytesPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendByteSlice(ctx, b, ptrToBytes(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBytesPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyBytesPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadNumber: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadNumber: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyNumber: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyNumber: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToNumber(p + uintptr(code.Offset)) + if v == "" { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + } + case encoder.OpStructPtrHeadNumberString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadNumberString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyNumberString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyNumberString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToNumber(p + uintptr(code.Offset)) + if v == "" { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadNumberPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadNumberPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyNumberPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyNumberPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructPtrHeadNumberPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadNumberPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyNumberPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyNumberPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadArray, encoder.OpStructPtrHeadSlice: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadArray, encoder.OpStructHeadSlice: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructPtrHeadOmitEmptyArray: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyArray: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructPtrHeadOmitEmptySlice: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptySlice: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + slice := ptrToSlice(p) + if slice.Len == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadArrayPtr, encoder.OpStructPtrHeadSlicePtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadArrayPtr, encoder.OpStructHeadSlicePtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNullComma(ctx, b) + code = code.NextField + } else { + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadOmitEmptyArrayPtr, encoder.OpStructPtrHeadOmitEmptySlicePtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyArrayPtr, encoder.OpStructHeadOmitEmptySlicePtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadMap: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadMap: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if p != 0 && (code.Flags&encoder.IndirectFlags) != 0 { + p = ptrToPtr(p + uintptr(code.Offset)) + } + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructPtrHeadOmitEmptyMap: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyMap: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if p != 0 && (code.Flags&encoder.IndirectFlags) != 0 { + p = ptrToPtr(p + uintptr(code.Offset)) + } + if maplen(ptrToUnsafePtr(p)) == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadMapPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadMapPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.NextField + break + } + p = ptrToPtr(p + uintptr(code.Offset)) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.NextField + } else { + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p, code.PtrNum) + } + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadOmitEmptyMapPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyMapPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if p == 0 { + code = code.NextField + break + } + p = ptrToPtr(p + uintptr(code.Offset)) + if p == 0 { + code = code.NextField + } else { + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p, code.PtrNum) + } + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + if (code.Flags&encoder.IndirectFlags) != 0 || code.Op == encoder.OpStructPtrHeadMarshalJSON { + p = ptrToPtr(p) + } + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + if (code.Flags&encoder.IndirectFlags) != 0 || code.Op == encoder.OpStructPtrHeadOmitEmptyMarshalJSON { + p = ptrToPtr(p) + } + } + iface := ptrToInterface(code, p) + if (code.Flags&encoder.NilCheckFlags) != 0 && encoder.IsNilForMarshaler(iface) { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalJSON(ctx, code, b, iface) + if err != nil { + return nil, err + } + b = bb + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if p == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + if (code.Flags&encoder.IndirectFlags) != 0 || code.Op == encoder.OpStructPtrHeadMarshalText { + p = ptrToPtr(p) + } + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + if (code.Flags&encoder.IndirectFlags) != 0 || code.Op == encoder.OpStructPtrHeadOmitEmptyMarshalText { + p = ptrToPtr(p) + } + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if p == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructField: + if code.Flags&encoder.IsTaggedKeyFlags != 0 || code.Flags&encoder.AnonymousKeyFlags == 0 { + b = appendStructKey(ctx, code, b) + } + p := load(ctxptr, code.Idx) + uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmpty: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + if ptrToPtr(p) == 0 && (code.Flags&encoder.IsNextOpPtrTypeFlags) != 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructFieldInt: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyInt: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldIntString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyIntString: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldIntPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendInt(ctx, b, p, code) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyIntPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p, code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldIntPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyIntPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldUint: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyUint: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldUintString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyUintString: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldUintPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendUint(ctx, b, p, code) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyUintPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p, code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldUintPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyUintPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat32: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat32: + p := load(ctxptr, code.Idx) + v := ptrToFloat32(p + uintptr(code.Offset)) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat32String: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat32String: + p := load(ctxptr, code.Idx) + v := ptrToFloat32(p + uintptr(code.Offset)) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat32Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendFloat32(ctx, b, ptrToFloat32(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat32Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat32PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat32PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat64: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat64: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if v != 0 { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat64String: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat64String: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if v != 0 { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat64Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat64Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat64PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat64PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyString: + p := load(ctxptr, code.Idx) + v := ptrToString(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldStringString: + p := load(ctxptr, code.Idx) + s := ptrToString(p + uintptr(code.Offset)) + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, s))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyStringString: + p := load(ctxptr, code.Idx) + v := ptrToString(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, v))) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldStringPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, ptrToString(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyStringPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldStringPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyStringPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBool: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBool: + p := load(ctxptr, code.Idx) + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBoolString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBoolString: + p := load(ctxptr, code.Idx) + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBoolPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendBool(ctx, b, ptrToBool(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBoolPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBoolPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBoolPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBytes: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBytes: + p := load(ctxptr, code.Idx) + v := ptrToBytes(p + uintptr(code.Offset)) + if len(v) > 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBytesPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendByteSlice(ctx, b, ptrToBytes(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBytesPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldNumber: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpStructFieldOmitEmptyNumber: + p := load(ctxptr, code.Idx) + v := ptrToNumber(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructFieldNumberString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyNumberString: + p := load(ctxptr, code.Idx) + v := ptrToNumber(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldNumberPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyNumberPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructFieldNumberPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyNumberPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldMarshalJSON: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + p = ptrToPtr(p) + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyMarshalJSON: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + p = ptrToPtr(p) + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + code = code.NextField + break + } + iface := ptrToInterface(code, p) + if (code.Flags&encoder.NilCheckFlags) != 0 && encoder.IsNilForMarshaler(iface) { + code = code.NextField + break + } + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalJSON(ctx, code, b, iface) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpStructFieldMarshalJSONPtr: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyMarshalJSONPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructFieldMarshalText: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + p = ptrToPtr(p) + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyMarshalText: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + p = ptrToPtr(p) + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + code = code.NextField + break + } + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpStructFieldMarshalTextPtr: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyMarshalTextPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructFieldArray: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyArray: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldArrayPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyArrayPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } else { + code = code.NextField + } + case encoder.OpStructFieldSlice: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptySlice: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + slice := ptrToSlice(p) + if slice.Len == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructFieldSlicePtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptySlicePtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } else { + code = code.NextField + } + case encoder.OpStructFieldMap: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToPtr(p + uintptr(code.Offset)) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyMap: + p := load(ctxptr, code.Idx) + p = ptrToPtr(p + uintptr(code.Offset)) + if p == 0 || maplen(ptrToUnsafePtr(p)) == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructFieldMapPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToPtr(p + uintptr(code.Offset)) + if p != 0 { + p = ptrToNPtr(p, code.PtrNum) + } + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyMapPtr: + p := load(ctxptr, code.Idx) + p = ptrToPtr(p + uintptr(code.Offset)) + if p != 0 { + p = ptrToNPtr(p, code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } else { + code = code.NextField + } + case encoder.OpStructFieldStruct: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyStruct: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + if ptrToPtr(p) == 0 && (code.Flags&encoder.IsNextOpPtrTypeFlags) != 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructEnd: + b = appendStructEndSkipLast(ctx, code, b) + code = code.Next + case encoder.OpStructEndInt: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyInt: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndIntString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyIntString: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndIntPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendInt(ctx, b, p, code) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyIntPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p, code) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndIntPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyIntPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndUint: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyUint: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndUintString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyUintString: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndUintPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendUint(ctx, b, p, code) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyUintPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p, code) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndUintPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyUintPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat32: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat32: + p := load(ctxptr, code.Idx) + v := ptrToFloat32(p + uintptr(code.Offset)) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat32String: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat32String: + p := load(ctxptr, code.Idx) + v := ptrToFloat32(p + uintptr(code.Offset)) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat32Ptr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendFloat32(ctx, b, ptrToFloat32(p)) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat32Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat32PtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat32PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat64: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat64: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if v != 0 { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat64String: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat64String: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if v != 0 { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat64Ptr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + b = appendStructEnd(ctx, code, b) + code = code.Next + break + } + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat64Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat64PtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat64PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p+uintptr(code.Offset))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyString: + p := load(ctxptr, code.Idx) + v := ptrToString(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndStringString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + s := ptrToString(p + uintptr(code.Offset)) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, s))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyStringString: + p := load(ctxptr, code.Idx) + v := ptrToString(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, v))) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndStringPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, ptrToString(p)) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyStringPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p)) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndStringPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyStringPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBool: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBool: + p := load(ctxptr, code.Idx) + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBoolString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBoolString: + p := load(ctxptr, code.Idx) + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBoolPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendBool(ctx, b, ptrToBool(p)) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBoolPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p)) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBoolPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBoolPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBytes: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p+uintptr(code.Offset))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBytes: + p := load(ctxptr, code.Idx) + v := ptrToBytes(p + uintptr(code.Offset)) + if len(v) > 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBytesPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendByteSlice(ctx, b, ptrToBytes(p)) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBytesPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p)) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndNumber: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = appendStructEnd(ctx, code, bb) + code = code.Next + case encoder.OpStructEndOmitEmptyNumber: + p := load(ctxptr, code.Idx) + v := ptrToNumber(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = appendStructEnd(ctx, code, bb) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndNumberString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyNumberString: + p := load(ctxptr, code.Idx) + v := ptrToNumber(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndNumberPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyNumberPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = appendStructEnd(ctx, code, bb) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndNumberPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyNumberPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpEnd: + goto END + } + } +END: + return b, nil +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm_color_indent/debug_vm.go b/vendor/github.com/goccy/go-json/internal/encoder/vm_color_indent/debug_vm.go new file mode 100644 index 000000000..dd4cd489e --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm_color_indent/debug_vm.go @@ -0,0 +1,35 @@ +package vm_color_indent + +import ( + "fmt" + + "github.com/goccy/go-json/internal/encoder" +) + +func DebugRun(ctx *encoder.RuntimeContext, b []byte, codeSet *encoder.OpcodeSet) ([]byte, error) { + var code *encoder.Opcode + if (ctx.Option.Flag & encoder.HTMLEscapeOption) != 0 { + code = codeSet.EscapeKeyCode + } else { + code = codeSet.NoescapeKeyCode + } + + defer func() { + if err := recover(); err != nil { + w := ctx.Option.DebugOut + fmt.Fprintln(w, "=============[DEBUG]===============") + fmt.Fprintln(w, "* [TYPE]") + fmt.Fprintln(w, codeSet.Type) + fmt.Fprintf(w, "\n") + fmt.Fprintln(w, "* [ALL OPCODE]") + fmt.Fprintln(w, code.Dump()) + fmt.Fprintf(w, "\n") + fmt.Fprintln(w, "* [CONTEXT]") + fmt.Fprintf(w, "%+v\n", ctx) + fmt.Fprintln(w, "===================================") + panic(err) + } + }() + + return Run(ctx, b, codeSet) +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm_color_indent/util.go b/vendor/github.com/goccy/go-json/internal/encoder/vm_color_indent/util.go new file mode 100644 index 000000000..60e4a8ed5 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm_color_indent/util.go @@ -0,0 +1,296 @@ +package vm_color_indent + +import ( + "encoding/json" + "fmt" + "unsafe" + + "github.com/goccy/go-json/internal/encoder" + "github.com/goccy/go-json/internal/runtime" +) + +const uintptrSize = 4 << (^uintptr(0) >> 63) + +var ( + appendIndent = encoder.AppendIndent + appendStructEnd = encoder.AppendStructEndIndent + errUnsupportedValue = encoder.ErrUnsupportedValue + errUnsupportedFloat = encoder.ErrUnsupportedFloat + mapiterinit = encoder.MapIterInit + mapiterkey = encoder.MapIterKey + mapitervalue = encoder.MapIterValue + mapiternext = encoder.MapIterNext + maplen = encoder.MapLen +) + +type emptyInterface struct { + typ *runtime.Type + ptr unsafe.Pointer +} + +type nonEmptyInterface struct { + itab *struct { + ityp *runtime.Type // static interface type + typ *runtime.Type // dynamic concrete type + // unused fields... + } + ptr unsafe.Pointer +} + +func errUnimplementedOp(op encoder.OpType) error { + return fmt.Errorf("encoder (indent): opcode %s has not been implemented", op) +} + +func load(base uintptr, idx uint32) uintptr { + addr := base + uintptr(idx) + return **(**uintptr)(unsafe.Pointer(&addr)) +} + +func store(base uintptr, idx uint32, p uintptr) { + addr := base + uintptr(idx) + **(**uintptr)(unsafe.Pointer(&addr)) = p +} + +func loadNPtr(base uintptr, idx uint32, ptrNum uint8) uintptr { + addr := base + uintptr(idx) + p := **(**uintptr)(unsafe.Pointer(&addr)) + for i := uint8(0); i < ptrNum; i++ { + if p == 0 { + return 0 + } + p = ptrToPtr(p) + } + return p +} + +func ptrToUint64(p uintptr, bitSize uint8) uint64 { + switch bitSize { + case 8: + return (uint64)(**(**uint8)(unsafe.Pointer(&p))) + case 16: + return (uint64)(**(**uint16)(unsafe.Pointer(&p))) + case 32: + return (uint64)(**(**uint32)(unsafe.Pointer(&p))) + case 64: + return **(**uint64)(unsafe.Pointer(&p)) + } + return 0 +} + +func ptrToFloat32(p uintptr) float32 { return **(**float32)(unsafe.Pointer(&p)) } +func ptrToFloat64(p uintptr) float64 { return **(**float64)(unsafe.Pointer(&p)) } +func ptrToBool(p uintptr) bool { return **(**bool)(unsafe.Pointer(&p)) } +func ptrToBytes(p uintptr) []byte { return **(**[]byte)(unsafe.Pointer(&p)) } +func ptrToNumber(p uintptr) json.Number { return **(**json.Number)(unsafe.Pointer(&p)) } +func ptrToString(p uintptr) string { return **(**string)(unsafe.Pointer(&p)) } +func ptrToSlice(p uintptr) *runtime.SliceHeader { return *(**runtime.SliceHeader)(unsafe.Pointer(&p)) } +func ptrToPtr(p uintptr) uintptr { + return uintptr(**(**unsafe.Pointer)(unsafe.Pointer(&p))) +} +func ptrToNPtr(p uintptr, ptrNum uint8) uintptr { + for i := uint8(0); i < ptrNum; i++ { + if p == 0 { + return 0 + } + p = ptrToPtr(p) + } + return p +} + +func ptrToUnsafePtr(p uintptr) unsafe.Pointer { + return *(*unsafe.Pointer)(unsafe.Pointer(&p)) +} +func ptrToInterface(code *encoder.Opcode, p uintptr) interface{} { + return *(*interface{})(unsafe.Pointer(&emptyInterface{ + typ: code.Type, + ptr: *(*unsafe.Pointer)(unsafe.Pointer(&p)), + })) +} + +func appendInt(ctx *encoder.RuntimeContext, b []byte, p uintptr, code *encoder.Opcode) []byte { + format := ctx.Option.ColorScheme.Int + b = append(b, format.Header...) + b = encoder.AppendInt(ctx, b, p, code) + return append(b, format.Footer...) +} + +func appendUint(ctx *encoder.RuntimeContext, b []byte, p uintptr, code *encoder.Opcode) []byte { + format := ctx.Option.ColorScheme.Uint + b = append(b, format.Header...) + b = encoder.AppendUint(ctx, b, p, code) + return append(b, format.Footer...) +} + +func appendFloat32(ctx *encoder.RuntimeContext, b []byte, v float32) []byte { + format := ctx.Option.ColorScheme.Float + b = append(b, format.Header...) + b = encoder.AppendFloat32(ctx, b, v) + return append(b, format.Footer...) +} + +func appendFloat64(ctx *encoder.RuntimeContext, b []byte, v float64) []byte { + format := ctx.Option.ColorScheme.Float + b = append(b, format.Header...) + b = encoder.AppendFloat64(ctx, b, v) + return append(b, format.Footer...) +} + +func appendString(ctx *encoder.RuntimeContext, b []byte, v string) []byte { + format := ctx.Option.ColorScheme.String + b = append(b, format.Header...) + b = encoder.AppendString(ctx, b, v) + return append(b, format.Footer...) +} + +func appendByteSlice(ctx *encoder.RuntimeContext, b []byte, src []byte) []byte { + format := ctx.Option.ColorScheme.Binary + b = append(b, format.Header...) + b = encoder.AppendByteSlice(ctx, b, src) + return append(b, format.Footer...) +} + +func appendNumber(ctx *encoder.RuntimeContext, b []byte, n json.Number) ([]byte, error) { + format := ctx.Option.ColorScheme.Int + b = append(b, format.Header...) + bb, err := encoder.AppendNumber(ctx, b, n) + if err != nil { + return nil, err + } + return append(bb, format.Footer...), nil +} + +func appendBool(ctx *encoder.RuntimeContext, b []byte, v bool) []byte { + format := ctx.Option.ColorScheme.Bool + b = append(b, format.Header...) + if v { + b = append(b, "true"...) + } else { + b = append(b, "false"...) + } + return append(b, format.Footer...) +} + +func appendNull(ctx *encoder.RuntimeContext, b []byte) []byte { + format := ctx.Option.ColorScheme.Null + b = append(b, format.Header...) + b = append(b, "null"...) + return append(b, format.Footer...) +} + +func appendComma(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, ',', '\n') +} + +func appendNullComma(ctx *encoder.RuntimeContext, b []byte) []byte { + format := ctx.Option.ColorScheme.Null + b = append(b, format.Header...) + b = append(b, "null"...) + return append(append(b, format.Footer...), ',', '\n') +} + +func appendColon(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, ':', ' ') +} + +func appendMapKeyValue(ctx *encoder.RuntimeContext, code *encoder.Opcode, b, key, value []byte) []byte { + b = appendIndent(ctx, b, code.Indent+1) + b = append(b, key...) + b[len(b)-2] = ':' + b[len(b)-1] = ' ' + return append(b, value...) +} + +func appendMapEnd(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + b = b[:len(b)-2] + b = append(b, '\n') + b = appendIndent(ctx, b, code.Indent) + return append(b, '}', ',', '\n') +} + +func appendArrayHead(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + b = append(b, '[', '\n') + return appendIndent(ctx, b, code.Indent+1) +} + +func appendArrayEnd(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + b = b[:len(b)-2] + b = append(b, '\n') + b = appendIndent(ctx, b, code.Indent) + return append(b, ']', ',', '\n') +} + +func appendEmptyArray(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, '[', ']', ',', '\n') +} + +func appendEmptyObject(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, '{', '}', ',', '\n') +} + +func appendObjectEnd(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + last := len(b) - 1 + b[last] = '\n' + b = appendIndent(ctx, b, code.Indent-1) + return append(b, '}', ',', '\n') +} + +func appendMarshalJSON(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte, v interface{}) ([]byte, error) { + return encoder.AppendMarshalJSONIndent(ctx, code, b, v) +} + +func appendMarshalText(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte, v interface{}) ([]byte, error) { + format := ctx.Option.ColorScheme.String + b = append(b, format.Header...) + bb, err := encoder.AppendMarshalTextIndent(ctx, code, b, v) + if err != nil { + return nil, err + } + return append(bb, format.Footer...), nil +} + +func appendStructHead(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, '{', '\n') +} + +func appendStructKey(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + b = appendIndent(ctx, b, code.Indent) + + format := ctx.Option.ColorScheme.ObjectKey + b = append(b, format.Header...) + b = append(b, code.Key[:len(code.Key)-1]...) + b = append(b, format.Footer...) + + return append(b, ':', ' ') +} + +func appendStructEndSkipLast(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + last := len(b) - 1 + if b[last-1] == '{' { + b[last] = '}' + } else { + if b[last] == '\n' { + // to remove ',' and '\n' characters + b = b[:len(b)-2] + } + b = append(b, '\n') + b = appendIndent(ctx, b, code.Indent-1) + b = append(b, '}') + } + return appendComma(ctx, b) +} + +func restoreIndent(ctx *encoder.RuntimeContext, code *encoder.Opcode, ctxptr uintptr) { + ctx.BaseIndent = uint32(load(ctxptr, code.Length)) +} + +func storeIndent(ctxptr uintptr, code *encoder.Opcode, indent uintptr) { + store(ctxptr, code.Length, indent) +} + +func appendArrayElemIndent(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + return appendIndent(ctx, b, code.Indent+1) +} + +func appendMapKeyIndent(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + return appendIndent(ctx, b, code.Indent) +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm_color_indent/vm.go b/vendor/github.com/goccy/go-json/internal/encoder/vm_color_indent/vm.go new file mode 100644 index 000000000..3b4e22e5d --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm_color_indent/vm.go @@ -0,0 +1,4859 @@ +// Code generated by internal/cmd/generator. DO NOT EDIT! +package vm_color_indent + +import ( + "math" + "reflect" + "sort" + "unsafe" + + "github.com/goccy/go-json/internal/encoder" + "github.com/goccy/go-json/internal/runtime" +) + +func Run(ctx *encoder.RuntimeContext, b []byte, codeSet *encoder.OpcodeSet) ([]byte, error) { + recursiveLevel := 0 + ptrOffset := uintptr(0) + ctxptr := ctx.Ptr() + var code *encoder.Opcode + if (ctx.Option.Flag & encoder.HTMLEscapeOption) != 0 { + code = codeSet.EscapeKeyCode + } else { + code = codeSet.NoescapeKeyCode + } + + for { + switch code.Op { + default: + return nil, errUnimplementedOp(code.Op) + case encoder.OpPtr: + p := load(ctxptr, code.Idx) + code = code.Next + store(ctxptr, code.Idx, ptrToPtr(p)) + case encoder.OpIntPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpInt: + b = appendInt(ctx, b, load(ctxptr, code.Idx), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpUintPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpUint: + b = appendUint(ctx, b, load(ctxptr, code.Idx), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpIntString: + b = append(b, '"') + b = appendInt(ctx, b, load(ctxptr, code.Idx), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpUintString: + b = append(b, '"') + b = appendUint(ctx, b, load(ctxptr, code.Idx), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpFloat32Ptr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + b = appendComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpFloat32: + b = appendFloat32(ctx, b, ptrToFloat32(load(ctxptr, code.Idx))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpFloat64Ptr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpFloat64: + v := ptrToFloat64(load(ctxptr, code.Idx)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStringPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpString: + b = appendString(ctx, b, ptrToString(load(ctxptr, code.Idx))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpBoolPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpBool: + b = appendBool(ctx, b, ptrToBool(load(ctxptr, code.Idx))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpBytesPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpBytes: + b = appendByteSlice(ctx, b, ptrToBytes(load(ctxptr, code.Idx))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpNumberPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpNumber: + bb, err := appendNumber(ctx, b, ptrToNumber(load(ctxptr, code.Idx))) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpInterfacePtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpInterface: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + if recursiveLevel > encoder.StartDetectingCyclesAfter { + for _, seen := range ctx.SeenPtr { + if p == seen { + return nil, errUnsupportedValue(code, p) + } + } + } + ctx.SeenPtr = append(ctx.SeenPtr, p) + var ( + typ *runtime.Type + ifacePtr unsafe.Pointer + ) + up := ptrToUnsafePtr(p) + if code.Flags&encoder.NonEmptyInterfaceFlags != 0 { + iface := (*nonEmptyInterface)(up) + ifacePtr = iface.ptr + if iface.itab != nil { + typ = iface.itab.typ + } + } else { + iface := (*emptyInterface)(up) + ifacePtr = iface.ptr + typ = iface.typ + } + if ifacePtr == nil { + isDirectedNil := typ != nil && typ.Kind() == reflect.Struct && !runtime.IfaceIndir(typ) + if !isDirectedNil { + b = appendNullComma(ctx, b) + code = code.Next + break + } + } + ctx.KeepRefs = append(ctx.KeepRefs, up) + ifaceCodeSet, err := encoder.CompileToGetCodeSet(ctx, uintptr(unsafe.Pointer(typ))) + if err != nil { + return nil, err + } + + totalLength := uintptr(code.Length) + 3 + nextTotalLength := uintptr(ifaceCodeSet.CodeLength) + 3 + + var c *encoder.Opcode + if (ctx.Option.Flag & encoder.HTMLEscapeOption) != 0 { + c = ifaceCodeSet.InterfaceEscapeKeyCode + } else { + c = ifaceCodeSet.InterfaceNoescapeKeyCode + } + curlen := uintptr(len(ctx.Ptrs)) + offsetNum := ptrOffset / uintptrSize + oldOffset := ptrOffset + ptrOffset += totalLength * uintptrSize + oldBaseIndent := ctx.BaseIndent + ctx.BaseIndent += code.Indent + + newLen := offsetNum + totalLength + nextTotalLength + if curlen < newLen { + ctx.Ptrs = append(ctx.Ptrs, make([]uintptr, newLen-curlen)...) + } + ctxptr = ctx.Ptr() + ptrOffset // assign new ctxptr + + end := ifaceCodeSet.EndCode + store(ctxptr, c.Idx, uintptr(ifacePtr)) + store(ctxptr, end.Idx, oldOffset) + store(ctxptr, end.ElemIdx, uintptr(unsafe.Pointer(code.Next))) + storeIndent(ctxptr, end, uintptr(oldBaseIndent)) + code = c + recursiveLevel++ + case encoder.OpInterfaceEnd: + recursiveLevel-- + + // restore ctxptr + offset := load(ctxptr, code.Idx) + restoreIndent(ctx, code, ctxptr) + ctx.SeenPtr = ctx.SeenPtr[:len(ctx.SeenPtr)-1] + + codePtr := load(ctxptr, code.ElemIdx) + code = (*encoder.Opcode)(ptrToUnsafePtr(codePtr)) + ctxptr = ctx.Ptr() + offset + ptrOffset = offset + case encoder.OpMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, ptrToPtr(p)) + fallthrough + case encoder.OpMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + if (code.Flags&encoder.IsNilableTypeFlags) != 0 && (code.Flags&encoder.IndirectFlags) != 0 { + p = ptrToPtr(p) + } + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, ptrToPtr(p)) + fallthrough + case encoder.OpMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 { + b = append(b, `""`...) + b = appendComma(ctx, b) + code = code.Next + break + } + if (code.Flags&encoder.IsNilableTypeFlags) != 0 && (code.Flags&encoder.IndirectFlags) != 0 { + p = ptrToPtr(p) + } + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpSlicePtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpSlice: + p := load(ctxptr, code.Idx) + slice := ptrToSlice(p) + if p == 0 || slice.Data == nil { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + store(ctxptr, code.ElemIdx, 0) + store(ctxptr, code.Length, uintptr(slice.Len)) + store(ctxptr, code.Idx, uintptr(slice.Data)) + if slice.Len > 0 { + b = appendArrayHead(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, uintptr(slice.Data)) + } else { + b = appendEmptyArray(ctx, b) + code = code.End.Next + } + case encoder.OpSliceElem: + idx := load(ctxptr, code.ElemIdx) + length := load(ctxptr, code.Length) + idx++ + if idx < length { + b = appendArrayElemIndent(ctx, code, b) + store(ctxptr, code.ElemIdx, idx) + data := load(ctxptr, code.Idx) + size := uintptr(code.Size) + code = code.Next + store(ctxptr, code.Idx, data+idx*size) + } else { + b = appendArrayEnd(ctx, code, b) + code = code.End.Next + } + case encoder.OpArrayPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpArray: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + if code.Length > 0 { + b = appendArrayHead(ctx, code, b) + store(ctxptr, code.ElemIdx, 0) + code = code.Next + store(ctxptr, code.Idx, p) + } else { + b = appendEmptyArray(ctx, b) + code = code.End.Next + } + case encoder.OpArrayElem: + idx := load(ctxptr, code.ElemIdx) + idx++ + if idx < uintptr(code.Length) { + b = appendArrayElemIndent(ctx, code, b) + store(ctxptr, code.ElemIdx, idx) + p := load(ctxptr, code.Idx) + size := uintptr(code.Size) + code = code.Next + store(ctxptr, code.Idx, p+idx*size) + } else { + b = appendArrayEnd(ctx, code, b) + code = code.End.Next + } + case encoder.OpMapPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpMap: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + uptr := ptrToUnsafePtr(p) + mlen := maplen(uptr) + if mlen <= 0 { + b = appendEmptyObject(ctx, b) + code = code.End.Next + break + } + b = appendStructHead(ctx, b) + unorderedMap := (ctx.Option.Flag & encoder.UnorderedMapOption) != 0 + mapCtx := encoder.NewMapContext(mlen, unorderedMap) + mapiterinit(code.Type, uptr, &mapCtx.Iter) + store(ctxptr, code.Idx, uintptr(unsafe.Pointer(mapCtx))) + ctx.KeepRefs = append(ctx.KeepRefs, unsafe.Pointer(mapCtx)) + if unorderedMap { + b = appendMapKeyIndent(ctx, code.Next, b) + } else { + mapCtx.Start = len(b) + mapCtx.First = len(b) + } + key := mapiterkey(&mapCtx.Iter) + store(ctxptr, code.Next.Idx, uintptr(key)) + code = code.Next + case encoder.OpMapKey: + mapCtx := (*encoder.MapContext)(ptrToUnsafePtr(load(ctxptr, code.Idx))) + idx := mapCtx.Idx + idx++ + if (ctx.Option.Flag & encoder.UnorderedMapOption) != 0 { + if idx < mapCtx.Len { + b = appendMapKeyIndent(ctx, code, b) + mapCtx.Idx = int(idx) + key := mapiterkey(&mapCtx.Iter) + store(ctxptr, code.Next.Idx, uintptr(key)) + code = code.Next + } else { + b = appendObjectEnd(ctx, code, b) + encoder.ReleaseMapContext(mapCtx) + code = code.End.Next + } + } else { + mapCtx.Slice.Items[mapCtx.Idx].Value = b[mapCtx.Start:len(b)] + if idx < mapCtx.Len { + mapCtx.Idx = int(idx) + mapCtx.Start = len(b) + key := mapiterkey(&mapCtx.Iter) + store(ctxptr, code.Next.Idx, uintptr(key)) + code = code.Next + } else { + code = code.End + } + } + case encoder.OpMapValue: + mapCtx := (*encoder.MapContext)(ptrToUnsafePtr(load(ctxptr, code.Idx))) + if (ctx.Option.Flag & encoder.UnorderedMapOption) != 0 { + b = appendColon(ctx, b) + } else { + mapCtx.Slice.Items[mapCtx.Idx].Key = b[mapCtx.Start:len(b)] + mapCtx.Start = len(b) + } + value := mapitervalue(&mapCtx.Iter) + store(ctxptr, code.Next.Idx, uintptr(value)) + mapiternext(&mapCtx.Iter) + code = code.Next + case encoder.OpMapEnd: + // this operation only used by sorted map. + mapCtx := (*encoder.MapContext)(ptrToUnsafePtr(load(ctxptr, code.Idx))) + sort.Sort(mapCtx.Slice) + buf := mapCtx.Buf + for _, item := range mapCtx.Slice.Items { + buf = appendMapKeyValue(ctx, code, buf, item.Key, item.Value) + } + buf = appendMapEnd(ctx, code, buf) + b = b[:mapCtx.First] + b = append(b, buf...) + mapCtx.Buf = buf + encoder.ReleaseMapContext(mapCtx) + code = code.Next + case encoder.OpRecursivePtr: + p := load(ctxptr, code.Idx) + if p == 0 { + code = code.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpRecursive: + ptr := load(ctxptr, code.Idx) + if ptr != 0 { + if recursiveLevel > encoder.StartDetectingCyclesAfter { + for _, seen := range ctx.SeenPtr { + if ptr == seen { + return nil, errUnsupportedValue(code, ptr) + } + } + } + } + ctx.SeenPtr = append(ctx.SeenPtr, ptr) + c := code.Jmp.Code + curlen := uintptr(len(ctx.Ptrs)) + offsetNum := ptrOffset / uintptrSize + oldOffset := ptrOffset + ptrOffset += code.Jmp.CurLen * uintptrSize + oldBaseIndent := ctx.BaseIndent + indentDiffFromTop := c.Indent - 1 + ctx.BaseIndent += code.Indent - indentDiffFromTop + + newLen := offsetNum + code.Jmp.CurLen + code.Jmp.NextLen + if curlen < newLen { + ctx.Ptrs = append(ctx.Ptrs, make([]uintptr, newLen-curlen)...) + } + ctxptr = ctx.Ptr() + ptrOffset // assign new ctxptr + + store(ctxptr, c.Idx, ptr) + store(ctxptr, c.End.Next.Idx, oldOffset) + store(ctxptr, c.End.Next.ElemIdx, uintptr(unsafe.Pointer(code.Next))) + storeIndent(ctxptr, c.End.Next, uintptr(oldBaseIndent)) + code = c + recursiveLevel++ + case encoder.OpRecursiveEnd: + recursiveLevel-- + + // restore ctxptr + restoreIndent(ctx, code, ctxptr) + offset := load(ctxptr, code.Idx) + ctx.SeenPtr = ctx.SeenPtr[:len(ctx.SeenPtr)-1] + + codePtr := load(ctxptr, code.ElemIdx) + code = (*encoder.Opcode)(ptrToUnsafePtr(codePtr)) + ctxptr = ctx.Ptr() + offset + ptrOffset = offset + case encoder.OpStructPtrHead: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHead: + p := load(ctxptr, code.Idx) + if p == 0 && ((code.Flags&encoder.IndirectFlags) != 0 || code.Next.Op == encoder.OpStructEnd) { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if len(code.Key) > 0 { + if (code.Flags&encoder.IsTaggedKeyFlags) != 0 || code.Flags&encoder.AnonymousKeyFlags == 0 { + b = appendStructKey(ctx, code, b) + } + } + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructPtrHeadOmitEmpty: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmpty: + p := load(ctxptr, code.Idx) + if p == 0 && ((code.Flags&encoder.IndirectFlags) != 0 || code.Next.Op == encoder.OpStructEnd) { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + if p == 0 || (ptrToPtr(p) == 0 && (code.Flags&encoder.IsNextOpPtrTypeFlags) != 0) { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadInt: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadInt: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyInt: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyInt: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadIntString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadIntString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyIntString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyIntString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + u64 := ptrToUint64(p, code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadIntPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadIntPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendInt(ctx, b, p, code) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyIntPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyIntPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p, code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadIntPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadIntPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyIntPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyIntPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadUint: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadUint: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyUint: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyUint: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadUintString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadUintString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyUintString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyUintString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadUintPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadUintPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendUint(ctx, b, p, code) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyUintPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyUintPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p, code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadUintPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadUintPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyUintPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyUintPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadFloat32: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadFloat32: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat32: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyFloat32: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat32(p + uintptr(code.Offset)) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadFloat32String: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadFloat32String: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat32String: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyFloat32String: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat32(p + uintptr(code.Offset)) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadFloat32Ptr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadFloat32Ptr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendFloat32(ctx, b, ptrToFloat32(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat32Ptr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyFloat32Ptr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadFloat32PtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadFloat32PtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat32PtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyFloat32PtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadFloat64: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadFloat64: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat64: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyFloat64: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat64(p + uintptr(code.Offset)) + if v == 0 { + code = code.NextField + } else { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadFloat64String: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadFloat64String: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat64String: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyFloat64String: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat64(p + uintptr(code.Offset)) + if v == 0 { + code = code.NextField + } else { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadFloat64Ptr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadFloat64Ptr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat64Ptr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyFloat64Ptr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadFloat64PtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadFloat64PtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat64PtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyFloat64PtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNull(ctx, b) + b = appendComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToString(p + uintptr(code.Offset)) + if v == "" { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadStringString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadStringString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p+uintptr(code.Offset))))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyStringString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyStringString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToString(p + uintptr(code.Offset)) + if v == "" { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, v))) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadStringPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadStringPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, ptrToString(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyStringPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyStringPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadStringPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadStringPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyStringPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyStringPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadBool: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadBool: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBool: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyBool: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } else { + code = code.NextField + } + case encoder.OpStructPtrHeadBoolString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadBoolString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBoolString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyBoolString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } else { + code = code.NextField + } + case encoder.OpStructPtrHeadBoolPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadBoolPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendBool(ctx, b, ptrToBool(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBoolPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyBoolPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadBoolPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadBoolPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBoolPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyBoolPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadBytes: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadBytes: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBytes: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyBytes: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToBytes(p + uintptr(code.Offset)) + if len(v) == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadBytesPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadBytesPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendByteSlice(ctx, b, ptrToBytes(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBytesPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyBytesPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadNumber: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadNumber: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyNumber: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyNumber: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToNumber(p + uintptr(code.Offset)) + if v == "" { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + } + case encoder.OpStructPtrHeadNumberString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadNumberString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyNumberString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyNumberString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToNumber(p + uintptr(code.Offset)) + if v == "" { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadNumberPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadNumberPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyNumberPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyNumberPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructPtrHeadNumberPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadNumberPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyNumberPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyNumberPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadArray, encoder.OpStructPtrHeadSlice: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadArray, encoder.OpStructHeadSlice: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructPtrHeadOmitEmptyArray: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyArray: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructPtrHeadOmitEmptySlice: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptySlice: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + slice := ptrToSlice(p) + if slice.Len == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadArrayPtr, encoder.OpStructPtrHeadSlicePtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadArrayPtr, encoder.OpStructHeadSlicePtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNullComma(ctx, b) + code = code.NextField + } else { + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadOmitEmptyArrayPtr, encoder.OpStructPtrHeadOmitEmptySlicePtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyArrayPtr, encoder.OpStructHeadOmitEmptySlicePtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadMap: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadMap: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if p != 0 && (code.Flags&encoder.IndirectFlags) != 0 { + p = ptrToPtr(p + uintptr(code.Offset)) + } + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructPtrHeadOmitEmptyMap: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyMap: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if p != 0 && (code.Flags&encoder.IndirectFlags) != 0 { + p = ptrToPtr(p + uintptr(code.Offset)) + } + if maplen(ptrToUnsafePtr(p)) == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadMapPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadMapPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.NextField + break + } + p = ptrToPtr(p + uintptr(code.Offset)) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.NextField + } else { + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p, code.PtrNum) + } + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadOmitEmptyMapPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyMapPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if p == 0 { + code = code.NextField + break + } + p = ptrToPtr(p + uintptr(code.Offset)) + if p == 0 { + code = code.NextField + } else { + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p, code.PtrNum) + } + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + if (code.Flags&encoder.IndirectFlags) != 0 || code.Op == encoder.OpStructPtrHeadMarshalJSON { + p = ptrToPtr(p) + } + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + if (code.Flags&encoder.IndirectFlags) != 0 || code.Op == encoder.OpStructPtrHeadOmitEmptyMarshalJSON { + p = ptrToPtr(p) + } + } + iface := ptrToInterface(code, p) + if (code.Flags&encoder.NilCheckFlags) != 0 && encoder.IsNilForMarshaler(iface) { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalJSON(ctx, code, b, iface) + if err != nil { + return nil, err + } + b = bb + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if p == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + if (code.Flags&encoder.IndirectFlags) != 0 || code.Op == encoder.OpStructPtrHeadMarshalText { + p = ptrToPtr(p) + } + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + if (code.Flags&encoder.IndirectFlags) != 0 || code.Op == encoder.OpStructPtrHeadOmitEmptyMarshalText { + p = ptrToPtr(p) + } + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if p == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructField: + if code.Flags&encoder.IsTaggedKeyFlags != 0 || code.Flags&encoder.AnonymousKeyFlags == 0 { + b = appendStructKey(ctx, code, b) + } + p := load(ctxptr, code.Idx) + uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmpty: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + if ptrToPtr(p) == 0 && (code.Flags&encoder.IsNextOpPtrTypeFlags) != 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructFieldInt: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyInt: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldIntString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyIntString: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldIntPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendInt(ctx, b, p, code) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyIntPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p, code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldIntPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyIntPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldUint: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyUint: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldUintString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyUintString: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldUintPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendUint(ctx, b, p, code) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyUintPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p, code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldUintPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyUintPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat32: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat32: + p := load(ctxptr, code.Idx) + v := ptrToFloat32(p + uintptr(code.Offset)) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat32String: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat32String: + p := load(ctxptr, code.Idx) + v := ptrToFloat32(p + uintptr(code.Offset)) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat32Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendFloat32(ctx, b, ptrToFloat32(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat32Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat32PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat32PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat64: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat64: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if v != 0 { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat64String: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat64String: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if v != 0 { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat64Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat64Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat64PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat64PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyString: + p := load(ctxptr, code.Idx) + v := ptrToString(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldStringString: + p := load(ctxptr, code.Idx) + s := ptrToString(p + uintptr(code.Offset)) + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, s))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyStringString: + p := load(ctxptr, code.Idx) + v := ptrToString(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, v))) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldStringPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, ptrToString(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyStringPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldStringPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyStringPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBool: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBool: + p := load(ctxptr, code.Idx) + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBoolString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBoolString: + p := load(ctxptr, code.Idx) + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBoolPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendBool(ctx, b, ptrToBool(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBoolPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBoolPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBoolPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBytes: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBytes: + p := load(ctxptr, code.Idx) + v := ptrToBytes(p + uintptr(code.Offset)) + if len(v) > 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBytesPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendByteSlice(ctx, b, ptrToBytes(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBytesPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldNumber: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpStructFieldOmitEmptyNumber: + p := load(ctxptr, code.Idx) + v := ptrToNumber(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructFieldNumberString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyNumberString: + p := load(ctxptr, code.Idx) + v := ptrToNumber(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldNumberPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyNumberPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructFieldNumberPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyNumberPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldMarshalJSON: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + p = ptrToPtr(p) + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyMarshalJSON: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + p = ptrToPtr(p) + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + code = code.NextField + break + } + iface := ptrToInterface(code, p) + if (code.Flags&encoder.NilCheckFlags) != 0 && encoder.IsNilForMarshaler(iface) { + code = code.NextField + break + } + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalJSON(ctx, code, b, iface) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpStructFieldMarshalJSONPtr: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyMarshalJSONPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructFieldMarshalText: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + p = ptrToPtr(p) + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyMarshalText: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + p = ptrToPtr(p) + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + code = code.NextField + break + } + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpStructFieldMarshalTextPtr: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyMarshalTextPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructFieldArray: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyArray: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldArrayPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyArrayPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } else { + code = code.NextField + } + case encoder.OpStructFieldSlice: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptySlice: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + slice := ptrToSlice(p) + if slice.Len == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructFieldSlicePtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptySlicePtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } else { + code = code.NextField + } + case encoder.OpStructFieldMap: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToPtr(p + uintptr(code.Offset)) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyMap: + p := load(ctxptr, code.Idx) + p = ptrToPtr(p + uintptr(code.Offset)) + if p == 0 || maplen(ptrToUnsafePtr(p)) == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructFieldMapPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToPtr(p + uintptr(code.Offset)) + if p != 0 { + p = ptrToNPtr(p, code.PtrNum) + } + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyMapPtr: + p := load(ctxptr, code.Idx) + p = ptrToPtr(p + uintptr(code.Offset)) + if p != 0 { + p = ptrToNPtr(p, code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } else { + code = code.NextField + } + case encoder.OpStructFieldStruct: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyStruct: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + if ptrToPtr(p) == 0 && (code.Flags&encoder.IsNextOpPtrTypeFlags) != 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructEnd: + b = appendStructEndSkipLast(ctx, code, b) + code = code.Next + case encoder.OpStructEndInt: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyInt: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndIntString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyIntString: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndIntPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendInt(ctx, b, p, code) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyIntPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p, code) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndIntPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyIntPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndUint: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyUint: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndUintString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyUintString: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndUintPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendUint(ctx, b, p, code) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyUintPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p, code) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndUintPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyUintPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat32: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat32: + p := load(ctxptr, code.Idx) + v := ptrToFloat32(p + uintptr(code.Offset)) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat32String: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat32String: + p := load(ctxptr, code.Idx) + v := ptrToFloat32(p + uintptr(code.Offset)) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat32Ptr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendFloat32(ctx, b, ptrToFloat32(p)) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat32Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat32PtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat32PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat64: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat64: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if v != 0 { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat64String: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat64String: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if v != 0 { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat64Ptr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + b = appendStructEnd(ctx, code, b) + code = code.Next + break + } + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat64Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat64PtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat64PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p+uintptr(code.Offset))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyString: + p := load(ctxptr, code.Idx) + v := ptrToString(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndStringString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + s := ptrToString(p + uintptr(code.Offset)) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, s))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyStringString: + p := load(ctxptr, code.Idx) + v := ptrToString(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, v))) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndStringPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, ptrToString(p)) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyStringPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p)) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndStringPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyStringPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBool: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBool: + p := load(ctxptr, code.Idx) + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBoolString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBoolString: + p := load(ctxptr, code.Idx) + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBoolPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendBool(ctx, b, ptrToBool(p)) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBoolPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p)) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBoolPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBoolPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBytes: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p+uintptr(code.Offset))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBytes: + p := load(ctxptr, code.Idx) + v := ptrToBytes(p + uintptr(code.Offset)) + if len(v) > 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBytesPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendByteSlice(ctx, b, ptrToBytes(p)) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBytesPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p)) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndNumber: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = appendStructEnd(ctx, code, bb) + code = code.Next + case encoder.OpStructEndOmitEmptyNumber: + p := load(ctxptr, code.Idx) + v := ptrToNumber(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = appendStructEnd(ctx, code, bb) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndNumberString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyNumberString: + p := load(ctxptr, code.Idx) + v := ptrToNumber(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndNumberPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyNumberPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = appendStructEnd(ctx, code, bb) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndNumberPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyNumberPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpEnd: + goto END + } + } +END: + return b, nil +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/debug_vm.go b/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/debug_vm.go new file mode 100644 index 000000000..99395388c --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/debug_vm.go @@ -0,0 +1,35 @@ +package vm_indent + +import ( + "fmt" + + "github.com/goccy/go-json/internal/encoder" +) + +func DebugRun(ctx *encoder.RuntimeContext, b []byte, codeSet *encoder.OpcodeSet) ([]byte, error) { + var code *encoder.Opcode + if (ctx.Option.Flag & encoder.HTMLEscapeOption) != 0 { + code = codeSet.EscapeKeyCode + } else { + code = codeSet.NoescapeKeyCode + } + + defer func() { + if err := recover(); err != nil { + w := ctx.Option.DebugOut + fmt.Fprintln(w, "=============[DEBUG]===============") + fmt.Fprintln(w, "* [TYPE]") + fmt.Fprintln(w, codeSet.Type) + fmt.Fprintf(w, "\n") + fmt.Fprintln(w, "* [ALL OPCODE]") + fmt.Fprintln(w, code.Dump()) + fmt.Fprintf(w, "\n") + fmt.Fprintln(w, "* [CONTEXT]") + fmt.Fprintf(w, "%+v\n", ctx) + fmt.Fprintln(w, "===================================") + panic(err) + } + }() + + return Run(ctx, b, codeSet) +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/hack.go b/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/hack.go new file mode 100644 index 000000000..9e245bfe5 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/hack.go @@ -0,0 +1,9 @@ +package vm_indent + +import ( + // HACK: compile order + // `vm`, `vm_indent`, `vm_color`, `vm_color_indent` packages uses a lot of memory to compile, + // so forcibly make dependencies and avoid compiling in concurrent. + // dependency order: vm => vm_indent => vm_color => vm_color_indent + _ "github.com/goccy/go-json/internal/encoder/vm_color" +) diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/util.go b/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/util.go new file mode 100644 index 000000000..fca8f1855 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/util.go @@ -0,0 +1,229 @@ +package vm_indent + +import ( + "encoding/json" + "fmt" + "unsafe" + + "github.com/goccy/go-json/internal/encoder" + "github.com/goccy/go-json/internal/runtime" +) + +const uintptrSize = 4 << (^uintptr(0) >> 63) + +var ( + appendInt = encoder.AppendInt + appendUint = encoder.AppendUint + appendFloat32 = encoder.AppendFloat32 + appendFloat64 = encoder.AppendFloat64 + appendString = encoder.AppendString + appendByteSlice = encoder.AppendByteSlice + appendNumber = encoder.AppendNumber + appendStructEnd = encoder.AppendStructEndIndent + appendIndent = encoder.AppendIndent + errUnsupportedValue = encoder.ErrUnsupportedValue + errUnsupportedFloat = encoder.ErrUnsupportedFloat + mapiterinit = encoder.MapIterInit + mapiterkey = encoder.MapIterKey + mapitervalue = encoder.MapIterValue + mapiternext = encoder.MapIterNext + maplen = encoder.MapLen +) + +type emptyInterface struct { + typ *runtime.Type + ptr unsafe.Pointer +} + +type nonEmptyInterface struct { + itab *struct { + ityp *runtime.Type // static interface type + typ *runtime.Type // dynamic concrete type + // unused fields... + } + ptr unsafe.Pointer +} + +func errUnimplementedOp(op encoder.OpType) error { + return fmt.Errorf("encoder (indent): opcode %s has not been implemented", op) +} + +func load(base uintptr, idx uint32) uintptr { + addr := base + uintptr(idx) + return **(**uintptr)(unsafe.Pointer(&addr)) +} + +func store(base uintptr, idx uint32, p uintptr) { + addr := base + uintptr(idx) + **(**uintptr)(unsafe.Pointer(&addr)) = p +} + +func loadNPtr(base uintptr, idx uint32, ptrNum uint8) uintptr { + addr := base + uintptr(idx) + p := **(**uintptr)(unsafe.Pointer(&addr)) + for i := uint8(0); i < ptrNum; i++ { + if p == 0 { + return 0 + } + p = ptrToPtr(p) + } + return p +} + +func ptrToUint64(p uintptr, bitSize uint8) uint64 { + switch bitSize { + case 8: + return (uint64)(**(**uint8)(unsafe.Pointer(&p))) + case 16: + return (uint64)(**(**uint16)(unsafe.Pointer(&p))) + case 32: + return (uint64)(**(**uint32)(unsafe.Pointer(&p))) + case 64: + return **(**uint64)(unsafe.Pointer(&p)) + } + return 0 +} +func ptrToFloat32(p uintptr) float32 { return **(**float32)(unsafe.Pointer(&p)) } +func ptrToFloat64(p uintptr) float64 { return **(**float64)(unsafe.Pointer(&p)) } +func ptrToBool(p uintptr) bool { return **(**bool)(unsafe.Pointer(&p)) } +func ptrToBytes(p uintptr) []byte { return **(**[]byte)(unsafe.Pointer(&p)) } +func ptrToNumber(p uintptr) json.Number { return **(**json.Number)(unsafe.Pointer(&p)) } +func ptrToString(p uintptr) string { return **(**string)(unsafe.Pointer(&p)) } +func ptrToSlice(p uintptr) *runtime.SliceHeader { return *(**runtime.SliceHeader)(unsafe.Pointer(&p)) } +func ptrToPtr(p uintptr) uintptr { + return uintptr(**(**unsafe.Pointer)(unsafe.Pointer(&p))) +} +func ptrToNPtr(p uintptr, ptrNum uint8) uintptr { + for i := uint8(0); i < ptrNum; i++ { + if p == 0 { + return 0 + } + p = ptrToPtr(p) + } + return p +} + +func ptrToUnsafePtr(p uintptr) unsafe.Pointer { + return *(*unsafe.Pointer)(unsafe.Pointer(&p)) +} +func ptrToInterface(code *encoder.Opcode, p uintptr) interface{} { + return *(*interface{})(unsafe.Pointer(&emptyInterface{ + typ: code.Type, + ptr: *(*unsafe.Pointer)(unsafe.Pointer(&p)), + })) +} + +func appendBool(_ *encoder.RuntimeContext, b []byte, v bool) []byte { + if v { + return append(b, "true"...) + } + return append(b, "false"...) +} + +func appendNull(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, "null"...) +} + +func appendComma(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, ',', '\n') +} + +func appendNullComma(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, "null,\n"...) +} + +func appendColon(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, ':', ' ') +} + +func appendMapKeyValue(ctx *encoder.RuntimeContext, code *encoder.Opcode, b, key, value []byte) []byte { + b = appendIndent(ctx, b, code.Indent+1) + b = append(b, key...) + b[len(b)-2] = ':' + b[len(b)-1] = ' ' + return append(b, value...) +} + +func appendMapEnd(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + b = b[:len(b)-2] + b = append(b, '\n') + b = appendIndent(ctx, b, code.Indent) + return append(b, '}', ',', '\n') +} + +func appendArrayHead(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + b = append(b, '[', '\n') + return appendIndent(ctx, b, code.Indent+1) +} + +func appendArrayEnd(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + b = b[:len(b)-2] + b = append(b, '\n') + b = appendIndent(ctx, b, code.Indent) + return append(b, ']', ',', '\n') +} + +func appendEmptyArray(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, '[', ']', ',', '\n') +} + +func appendEmptyObject(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, '{', '}', ',', '\n') +} + +func appendObjectEnd(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + last := len(b) - 1 + b[last] = '\n' + b = appendIndent(ctx, b, code.Indent-1) + return append(b, '}', ',', '\n') +} + +func appendMarshalJSON(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte, v interface{}) ([]byte, error) { + return encoder.AppendMarshalJSONIndent(ctx, code, b, v) +} + +func appendMarshalText(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte, v interface{}) ([]byte, error) { + return encoder.AppendMarshalTextIndent(ctx, code, b, v) +} + +func appendStructHead(_ *encoder.RuntimeContext, b []byte) []byte { + return append(b, '{', '\n') +} + +func appendStructKey(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + b = appendIndent(ctx, b, code.Indent) + b = append(b, code.Key...) + return append(b, ' ') +} + +func appendStructEndSkipLast(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + last := len(b) - 1 + if b[last-1] == '{' { + b[last] = '}' + } else { + if b[last] == '\n' { + // to remove ',' and '\n' characters + b = b[:len(b)-2] + } + b = append(b, '\n') + b = appendIndent(ctx, b, code.Indent-1) + b = append(b, '}') + } + return appendComma(ctx, b) +} + +func restoreIndent(ctx *encoder.RuntimeContext, code *encoder.Opcode, ctxptr uintptr) { + ctx.BaseIndent = uint32(load(ctxptr, code.Length)) +} + +func storeIndent(ctxptr uintptr, code *encoder.Opcode, indent uintptr) { + store(ctxptr, code.Length, indent) +} + +func appendArrayElemIndent(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + return appendIndent(ctx, b, code.Indent+1) +} + +func appendMapKeyIndent(ctx *encoder.RuntimeContext, code *encoder.Opcode, b []byte) []byte { + return appendIndent(ctx, b, code.Indent) +} diff --git a/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/vm.go b/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/vm.go new file mode 100644 index 000000000..836c5c8a8 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/encoder/vm_indent/vm.go @@ -0,0 +1,4859 @@ +// Code generated by internal/cmd/generator. DO NOT EDIT! +package vm_indent + +import ( + "math" + "reflect" + "sort" + "unsafe" + + "github.com/goccy/go-json/internal/encoder" + "github.com/goccy/go-json/internal/runtime" +) + +func Run(ctx *encoder.RuntimeContext, b []byte, codeSet *encoder.OpcodeSet) ([]byte, error) { + recursiveLevel := 0 + ptrOffset := uintptr(0) + ctxptr := ctx.Ptr() + var code *encoder.Opcode + if (ctx.Option.Flag & encoder.HTMLEscapeOption) != 0 { + code = codeSet.EscapeKeyCode + } else { + code = codeSet.NoescapeKeyCode + } + + for { + switch code.Op { + default: + return nil, errUnimplementedOp(code.Op) + case encoder.OpPtr: + p := load(ctxptr, code.Idx) + code = code.Next + store(ctxptr, code.Idx, ptrToPtr(p)) + case encoder.OpIntPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpInt: + b = appendInt(ctx, b, load(ctxptr, code.Idx), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpUintPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpUint: + b = appendUint(ctx, b, load(ctxptr, code.Idx), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpIntString: + b = append(b, '"') + b = appendInt(ctx, b, load(ctxptr, code.Idx), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpUintString: + b = append(b, '"') + b = appendUint(ctx, b, load(ctxptr, code.Idx), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpFloat32Ptr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + b = appendComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpFloat32: + b = appendFloat32(ctx, b, ptrToFloat32(load(ctxptr, code.Idx))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpFloat64Ptr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpFloat64: + v := ptrToFloat64(load(ctxptr, code.Idx)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStringPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpString: + b = appendString(ctx, b, ptrToString(load(ctxptr, code.Idx))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpBoolPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpBool: + b = appendBool(ctx, b, ptrToBool(load(ctxptr, code.Idx))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpBytesPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpBytes: + b = appendByteSlice(ctx, b, ptrToBytes(load(ctxptr, code.Idx))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpNumberPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpNumber: + bb, err := appendNumber(ctx, b, ptrToNumber(load(ctxptr, code.Idx))) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpInterfacePtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpInterface: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + if recursiveLevel > encoder.StartDetectingCyclesAfter { + for _, seen := range ctx.SeenPtr { + if p == seen { + return nil, errUnsupportedValue(code, p) + } + } + } + ctx.SeenPtr = append(ctx.SeenPtr, p) + var ( + typ *runtime.Type + ifacePtr unsafe.Pointer + ) + up := ptrToUnsafePtr(p) + if code.Flags&encoder.NonEmptyInterfaceFlags != 0 { + iface := (*nonEmptyInterface)(up) + ifacePtr = iface.ptr + if iface.itab != nil { + typ = iface.itab.typ + } + } else { + iface := (*emptyInterface)(up) + ifacePtr = iface.ptr + typ = iface.typ + } + if ifacePtr == nil { + isDirectedNil := typ != nil && typ.Kind() == reflect.Struct && !runtime.IfaceIndir(typ) + if !isDirectedNil { + b = appendNullComma(ctx, b) + code = code.Next + break + } + } + ctx.KeepRefs = append(ctx.KeepRefs, up) + ifaceCodeSet, err := encoder.CompileToGetCodeSet(ctx, uintptr(unsafe.Pointer(typ))) + if err != nil { + return nil, err + } + + totalLength := uintptr(code.Length) + 3 + nextTotalLength := uintptr(ifaceCodeSet.CodeLength) + 3 + + var c *encoder.Opcode + if (ctx.Option.Flag & encoder.HTMLEscapeOption) != 0 { + c = ifaceCodeSet.InterfaceEscapeKeyCode + } else { + c = ifaceCodeSet.InterfaceNoescapeKeyCode + } + curlen := uintptr(len(ctx.Ptrs)) + offsetNum := ptrOffset / uintptrSize + oldOffset := ptrOffset + ptrOffset += totalLength * uintptrSize + oldBaseIndent := ctx.BaseIndent + ctx.BaseIndent += code.Indent + + newLen := offsetNum + totalLength + nextTotalLength + if curlen < newLen { + ctx.Ptrs = append(ctx.Ptrs, make([]uintptr, newLen-curlen)...) + } + ctxptr = ctx.Ptr() + ptrOffset // assign new ctxptr + + end := ifaceCodeSet.EndCode + store(ctxptr, c.Idx, uintptr(ifacePtr)) + store(ctxptr, end.Idx, oldOffset) + store(ctxptr, end.ElemIdx, uintptr(unsafe.Pointer(code.Next))) + storeIndent(ctxptr, end, uintptr(oldBaseIndent)) + code = c + recursiveLevel++ + case encoder.OpInterfaceEnd: + recursiveLevel-- + + // restore ctxptr + offset := load(ctxptr, code.Idx) + restoreIndent(ctx, code, ctxptr) + ctx.SeenPtr = ctx.SeenPtr[:len(ctx.SeenPtr)-1] + + codePtr := load(ctxptr, code.ElemIdx) + code = (*encoder.Opcode)(ptrToUnsafePtr(codePtr)) + ctxptr = ctx.Ptr() + offset + ptrOffset = offset + case encoder.OpMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, ptrToPtr(p)) + fallthrough + case encoder.OpMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + if (code.Flags&encoder.IsNilableTypeFlags) != 0 && (code.Flags&encoder.IndirectFlags) != 0 { + p = ptrToPtr(p) + } + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + store(ctxptr, code.Idx, ptrToPtr(p)) + fallthrough + case encoder.OpMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 { + b = append(b, `""`...) + b = appendComma(ctx, b) + code = code.Next + break + } + if (code.Flags&encoder.IsNilableTypeFlags) != 0 && (code.Flags&encoder.IndirectFlags) != 0 { + p = ptrToPtr(p) + } + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpSlicePtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpSlice: + p := load(ctxptr, code.Idx) + slice := ptrToSlice(p) + if p == 0 || slice.Data == nil { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + store(ctxptr, code.ElemIdx, 0) + store(ctxptr, code.Length, uintptr(slice.Len)) + store(ctxptr, code.Idx, uintptr(slice.Data)) + if slice.Len > 0 { + b = appendArrayHead(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, uintptr(slice.Data)) + } else { + b = appendEmptyArray(ctx, b) + code = code.End.Next + } + case encoder.OpSliceElem: + idx := load(ctxptr, code.ElemIdx) + length := load(ctxptr, code.Length) + idx++ + if idx < length { + b = appendArrayElemIndent(ctx, code, b) + store(ctxptr, code.ElemIdx, idx) + data := load(ctxptr, code.Idx) + size := uintptr(code.Size) + code = code.Next + store(ctxptr, code.Idx, data+idx*size) + } else { + b = appendArrayEnd(ctx, code, b) + code = code.End.Next + } + case encoder.OpArrayPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpArray: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + if code.Length > 0 { + b = appendArrayHead(ctx, code, b) + store(ctxptr, code.ElemIdx, 0) + code = code.Next + store(ctxptr, code.Idx, p) + } else { + b = appendEmptyArray(ctx, b) + code = code.End.Next + } + case encoder.OpArrayElem: + idx := load(ctxptr, code.ElemIdx) + idx++ + if idx < uintptr(code.Length) { + b = appendArrayElemIndent(ctx, code, b) + store(ctxptr, code.ElemIdx, idx) + p := load(ctxptr, code.Idx) + size := uintptr(code.Size) + code = code.Next + store(ctxptr, code.Idx, p+idx*size) + } else { + b = appendArrayEnd(ctx, code, b) + code = code.End.Next + } + case encoder.OpMapPtr: + p := loadNPtr(ctxptr, code.Idx, code.PtrNum) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + store(ctxptr, code.Idx, p) + fallthrough + case encoder.OpMap: + p := load(ctxptr, code.Idx) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.End.Next + break + } + uptr := ptrToUnsafePtr(p) + mlen := maplen(uptr) + if mlen <= 0 { + b = appendEmptyObject(ctx, b) + code = code.End.Next + break + } + b = appendStructHead(ctx, b) + unorderedMap := (ctx.Option.Flag & encoder.UnorderedMapOption) != 0 + mapCtx := encoder.NewMapContext(mlen, unorderedMap) + mapiterinit(code.Type, uptr, &mapCtx.Iter) + store(ctxptr, code.Idx, uintptr(unsafe.Pointer(mapCtx))) + ctx.KeepRefs = append(ctx.KeepRefs, unsafe.Pointer(mapCtx)) + if unorderedMap { + b = appendMapKeyIndent(ctx, code.Next, b) + } else { + mapCtx.Start = len(b) + mapCtx.First = len(b) + } + key := mapiterkey(&mapCtx.Iter) + store(ctxptr, code.Next.Idx, uintptr(key)) + code = code.Next + case encoder.OpMapKey: + mapCtx := (*encoder.MapContext)(ptrToUnsafePtr(load(ctxptr, code.Idx))) + idx := mapCtx.Idx + idx++ + if (ctx.Option.Flag & encoder.UnorderedMapOption) != 0 { + if idx < mapCtx.Len { + b = appendMapKeyIndent(ctx, code, b) + mapCtx.Idx = int(idx) + key := mapiterkey(&mapCtx.Iter) + store(ctxptr, code.Next.Idx, uintptr(key)) + code = code.Next + } else { + b = appendObjectEnd(ctx, code, b) + encoder.ReleaseMapContext(mapCtx) + code = code.End.Next + } + } else { + mapCtx.Slice.Items[mapCtx.Idx].Value = b[mapCtx.Start:len(b)] + if idx < mapCtx.Len { + mapCtx.Idx = int(idx) + mapCtx.Start = len(b) + key := mapiterkey(&mapCtx.Iter) + store(ctxptr, code.Next.Idx, uintptr(key)) + code = code.Next + } else { + code = code.End + } + } + case encoder.OpMapValue: + mapCtx := (*encoder.MapContext)(ptrToUnsafePtr(load(ctxptr, code.Idx))) + if (ctx.Option.Flag & encoder.UnorderedMapOption) != 0 { + b = appendColon(ctx, b) + } else { + mapCtx.Slice.Items[mapCtx.Idx].Key = b[mapCtx.Start:len(b)] + mapCtx.Start = len(b) + } + value := mapitervalue(&mapCtx.Iter) + store(ctxptr, code.Next.Idx, uintptr(value)) + mapiternext(&mapCtx.Iter) + code = code.Next + case encoder.OpMapEnd: + // this operation only used by sorted map. + mapCtx := (*encoder.MapContext)(ptrToUnsafePtr(load(ctxptr, code.Idx))) + sort.Sort(mapCtx.Slice) + buf := mapCtx.Buf + for _, item := range mapCtx.Slice.Items { + buf = appendMapKeyValue(ctx, code, buf, item.Key, item.Value) + } + buf = appendMapEnd(ctx, code, buf) + b = b[:mapCtx.First] + b = append(b, buf...) + mapCtx.Buf = buf + encoder.ReleaseMapContext(mapCtx) + code = code.Next + case encoder.OpRecursivePtr: + p := load(ctxptr, code.Idx) + if p == 0 { + code = code.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpRecursive: + ptr := load(ctxptr, code.Idx) + if ptr != 0 { + if recursiveLevel > encoder.StartDetectingCyclesAfter { + for _, seen := range ctx.SeenPtr { + if ptr == seen { + return nil, errUnsupportedValue(code, ptr) + } + } + } + } + ctx.SeenPtr = append(ctx.SeenPtr, ptr) + c := code.Jmp.Code + curlen := uintptr(len(ctx.Ptrs)) + offsetNum := ptrOffset / uintptrSize + oldOffset := ptrOffset + ptrOffset += code.Jmp.CurLen * uintptrSize + oldBaseIndent := ctx.BaseIndent + indentDiffFromTop := c.Indent - 1 + ctx.BaseIndent += code.Indent - indentDiffFromTop + + newLen := offsetNum + code.Jmp.CurLen + code.Jmp.NextLen + if curlen < newLen { + ctx.Ptrs = append(ctx.Ptrs, make([]uintptr, newLen-curlen)...) + } + ctxptr = ctx.Ptr() + ptrOffset // assign new ctxptr + + store(ctxptr, c.Idx, ptr) + store(ctxptr, c.End.Next.Idx, oldOffset) + store(ctxptr, c.End.Next.ElemIdx, uintptr(unsafe.Pointer(code.Next))) + storeIndent(ctxptr, c.End.Next, uintptr(oldBaseIndent)) + code = c + recursiveLevel++ + case encoder.OpRecursiveEnd: + recursiveLevel-- + + // restore ctxptr + restoreIndent(ctx, code, ctxptr) + offset := load(ctxptr, code.Idx) + ctx.SeenPtr = ctx.SeenPtr[:len(ctx.SeenPtr)-1] + + codePtr := load(ctxptr, code.ElemIdx) + code = (*encoder.Opcode)(ptrToUnsafePtr(codePtr)) + ctxptr = ctx.Ptr() + offset + ptrOffset = offset + case encoder.OpStructPtrHead: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHead: + p := load(ctxptr, code.Idx) + if p == 0 && ((code.Flags&encoder.IndirectFlags) != 0 || code.Next.Op == encoder.OpStructEnd) { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if len(code.Key) > 0 { + if (code.Flags&encoder.IsTaggedKeyFlags) != 0 || code.Flags&encoder.AnonymousKeyFlags == 0 { + b = appendStructKey(ctx, code, b) + } + } + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructPtrHeadOmitEmpty: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmpty: + p := load(ctxptr, code.Idx) + if p == 0 && ((code.Flags&encoder.IndirectFlags) != 0 || code.Next.Op == encoder.OpStructEnd) { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + if p == 0 || (ptrToPtr(p) == 0 && (code.Flags&encoder.IsNextOpPtrTypeFlags) != 0) { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadInt: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadInt: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyInt: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyInt: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadIntString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadIntString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyIntString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyIntString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + u64 := ptrToUint64(p, code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadIntPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadIntPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendInt(ctx, b, p, code) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyIntPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyIntPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p, code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadIntPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadIntPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyIntPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyIntPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadUint: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadUint: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyUint: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyUint: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadUintString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadUintString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyUintString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyUintString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadUintPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadUintPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendUint(ctx, b, p, code) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyUintPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyUintPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p, code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadUintPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadUintPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyUintPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyUintPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadFloat32: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadFloat32: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat32: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyFloat32: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat32(p + uintptr(code.Offset)) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadFloat32String: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadFloat32String: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat32String: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyFloat32String: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat32(p + uintptr(code.Offset)) + if v == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadFloat32Ptr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadFloat32Ptr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendFloat32(ctx, b, ptrToFloat32(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat32Ptr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyFloat32Ptr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadFloat32PtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadFloat32PtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat32PtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyFloat32PtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadFloat64: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadFloat64: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat64: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyFloat64: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat64(p + uintptr(code.Offset)) + if v == 0 { + code = code.NextField + } else { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadFloat64String: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadFloat64String: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat64String: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyFloat64String: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToFloat64(p + uintptr(code.Offset)) + if v == 0 { + code = code.NextField + } else { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadFloat64Ptr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadFloat64Ptr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat64Ptr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyFloat64Ptr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadFloat64PtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadFloat64PtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyFloat64PtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyFloat64PtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNull(ctx, b) + b = appendComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToString(p + uintptr(code.Offset)) + if v == "" { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadStringString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadStringString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p+uintptr(code.Offset))))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyStringString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyStringString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToString(p + uintptr(code.Offset)) + if v == "" { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, v))) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadStringPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadStringPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, ptrToString(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyStringPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyStringPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadStringPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadStringPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyStringPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyStringPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadBool: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadBool: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBool: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyBool: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } else { + code = code.NextField + } + case encoder.OpStructPtrHeadBoolString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadBoolString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBoolString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyBoolString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + } else { + code = code.NextField + } + case encoder.OpStructPtrHeadBoolPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadBoolPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendBool(ctx, b, ptrToBool(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBoolPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyBoolPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadBoolPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadBoolPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBoolPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyBoolPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadBytes: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadBytes: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBytes: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyBytes: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToBytes(p + uintptr(code.Offset)) + if len(v) == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadBytesPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadBytesPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendByteSlice(ctx, b, ptrToBytes(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyBytesPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyBytesPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadNumber: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadNumber: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyNumber: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyNumber: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToNumber(p + uintptr(code.Offset)) + if v == "" { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + } + case encoder.OpStructPtrHeadNumberString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadNumberString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyNumberString: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyNumberString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + v := ptrToNumber(p + uintptr(code.Offset)) + if v == "" { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadNumberPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadNumberPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyNumberPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyNumberPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructPtrHeadNumberPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadNumberPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyNumberPtrString: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyNumberPtrString: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructPtrHeadArray, encoder.OpStructPtrHeadSlice: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadArray, encoder.OpStructHeadSlice: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructPtrHeadOmitEmptyArray: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyArray: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructPtrHeadOmitEmptySlice: + if (code.Flags & encoder.IndirectFlags) != 0 { + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptySlice: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + slice := ptrToSlice(p) + if slice.Len == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadArrayPtr, encoder.OpStructPtrHeadSlicePtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadArrayPtr, encoder.OpStructHeadSlicePtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNullComma(ctx, b) + code = code.NextField + } else { + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadOmitEmptyArrayPtr, encoder.OpStructPtrHeadOmitEmptySlicePtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyArrayPtr, encoder.OpStructHeadOmitEmptySlicePtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadMap: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadMap: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if p != 0 && (code.Flags&encoder.IndirectFlags) != 0 { + p = ptrToPtr(p + uintptr(code.Offset)) + } + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructPtrHeadOmitEmptyMap: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyMap: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if p != 0 && (code.Flags&encoder.IndirectFlags) != 0 { + p = ptrToPtr(p + uintptr(code.Offset)) + } + if maplen(ptrToUnsafePtr(p)) == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadMapPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadMapPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.NextField + break + } + p = ptrToPtr(p + uintptr(code.Offset)) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.NextField + } else { + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p, code.PtrNum) + } + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadOmitEmptyMapPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyMapPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if p == 0 { + code = code.NextField + break + } + p = ptrToPtr(p + uintptr(code.Offset)) + if p == 0 { + code = code.NextField + } else { + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p, code.PtrNum) + } + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructPtrHeadMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + if (code.Flags&encoder.IndirectFlags) != 0 || code.Op == encoder.OpStructPtrHeadMarshalJSON { + p = ptrToPtr(p) + } + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyMarshalJSON: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + if (code.Flags&encoder.IndirectFlags) != 0 || code.Op == encoder.OpStructPtrHeadOmitEmptyMarshalJSON { + p = ptrToPtr(p) + } + } + iface := ptrToInterface(code, p) + if (code.Flags&encoder.NilCheckFlags) != 0 && encoder.IsNilForMarshaler(iface) { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalJSON(ctx, code, b, iface) + if err != nil { + return nil, err + } + b = bb + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyMarshalJSONPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if p == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + if (code.Flags&encoder.IndirectFlags) != 0 || code.Op == encoder.OpStructPtrHeadMarshalText { + p = ptrToPtr(p) + } + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + } + fallthrough + case encoder.OpStructHeadOmitEmptyMarshalText: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + if (code.Flags&encoder.IndirectFlags) != 0 || code.Op == encoder.OpStructPtrHeadOmitEmptyMarshalText { + p = ptrToPtr(p) + } + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructPtrHeadMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + b = appendStructKey(ctx, code, b) + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructPtrHeadOmitEmptyMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + store(ctxptr, code.Idx, ptrToNPtr(p, code.PtrNum)) + fallthrough + case encoder.OpStructHeadOmitEmptyMarshalTextPtr: + p := load(ctxptr, code.Idx) + if p == 0 && (code.Flags&encoder.IndirectFlags) != 0 { + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendNullComma(ctx, b) + } + code = code.End.Next + break + } + if (code.Flags & encoder.IndirectFlags) != 0 { + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + } + if code.Flags&encoder.AnonymousHeadFlags == 0 { + b = appendStructHead(ctx, b) + } + if p == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + b = appendComma(ctx, b) + code = code.Next + } + case encoder.OpStructField: + if code.Flags&encoder.IsTaggedKeyFlags != 0 || code.Flags&encoder.AnonymousKeyFlags == 0 { + b = appendStructKey(ctx, code, b) + } + p := load(ctxptr, code.Idx) + uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmpty: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + if ptrToPtr(p) == 0 && (code.Flags&encoder.IsNextOpPtrTypeFlags) != 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructFieldInt: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyInt: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldIntString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyIntString: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldIntPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendInt(ctx, b, p, code) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyIntPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p, code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldIntPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyIntPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldUint: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyUint: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldUintString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyUintString: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldUintPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendUint(ctx, b, p, code) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyUintPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p, code) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldUintPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyUintPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat32: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat32: + p := load(ctxptr, code.Idx) + v := ptrToFloat32(p + uintptr(code.Offset)) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat32String: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat32String: + p := load(ctxptr, code.Idx) + v := ptrToFloat32(p + uintptr(code.Offset)) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat32Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendFloat32(ctx, b, ptrToFloat32(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat32Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat32PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat32PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat64: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat64: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if v != 0 { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat64String: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat64String: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if v != 0 { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat64Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNullComma(ctx, b) + code = code.Next + break + } + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat64Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldFloat64PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyFloat64PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyString: + p := load(ctxptr, code.Idx) + v := ptrToString(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldStringString: + p := load(ctxptr, code.Idx) + s := ptrToString(p + uintptr(code.Offset)) + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, s))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyStringString: + p := load(ctxptr, code.Idx) + v := ptrToString(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, v))) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldStringPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, ptrToString(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyStringPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldStringPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyStringPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBool: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBool: + p := load(ctxptr, code.Idx) + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBoolString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBoolString: + p := load(ctxptr, code.Idx) + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, v) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBoolPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendBool(ctx, b, ptrToBool(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBoolPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBoolPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBoolPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBytes: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p+uintptr(code.Offset))) + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBytes: + p := load(ctxptr, code.Idx) + v := ptrToBytes(p + uintptr(code.Offset)) + if len(v) > 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, v) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldBytesPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendByteSlice(ctx, b, ptrToBytes(p)) + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyBytesPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p)) + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldNumber: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpStructFieldOmitEmptyNumber: + p := load(ctxptr, code.Idx) + v := ptrToNumber(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructFieldNumberString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyNumberString: + p := load(ctxptr, code.Idx) + v := ptrToNumber(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldNumberPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyNumberPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructFieldNumberPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + b = appendStructKey(ctx, code, b) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyNumberPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendComma(ctx, b) + } + code = code.Next + case encoder.OpStructFieldMarshalJSON: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + p = ptrToPtr(p) + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyMarshalJSON: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + p = ptrToPtr(p) + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + code = code.NextField + break + } + iface := ptrToInterface(code, p) + if (code.Flags&encoder.NilCheckFlags) != 0 && encoder.IsNilForMarshaler(iface) { + code = code.NextField + break + } + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalJSON(ctx, code, b, iface) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpStructFieldMarshalJSONPtr: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyMarshalJSONPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalJSON(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructFieldMarshalText: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + p = ptrToPtr(p) + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyMarshalText: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + if (code.Flags & encoder.IsNilableTypeFlags) != 0 { + p = ptrToPtr(p) + } + if p == 0 && (code.Flags&encoder.NilCheckFlags) != 0 { + code = code.NextField + break + } + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + code = code.Next + case encoder.OpStructFieldMarshalTextPtr: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendComma(ctx, b) + code = code.Next + case encoder.OpStructFieldOmitEmptyMarshalTextPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendMarshalText(ctx, code, b, ptrToInterface(code, p)) + if err != nil { + return nil, err + } + b = appendComma(ctx, bb) + } + code = code.Next + case encoder.OpStructFieldArray: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyArray: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldArrayPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyArrayPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } else { + code = code.NextField + } + case encoder.OpStructFieldSlice: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptySlice: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + slice := ptrToSlice(p) + if slice.Len == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructFieldSlicePtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptySlicePtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } else { + code = code.NextField + } + case encoder.OpStructFieldMap: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToPtr(p + uintptr(code.Offset)) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyMap: + p := load(ctxptr, code.Idx) + p = ptrToPtr(p + uintptr(code.Offset)) + if p == 0 || maplen(ptrToUnsafePtr(p)) == 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructFieldMapPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToPtr(p + uintptr(code.Offset)) + if p != 0 { + p = ptrToNPtr(p, code.PtrNum) + } + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyMapPtr: + p := load(ctxptr, code.Idx) + p = ptrToPtr(p + uintptr(code.Offset)) + if p != 0 { + p = ptrToNPtr(p, code.PtrNum) + } + if p != 0 { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } else { + code = code.NextField + } + case encoder.OpStructFieldStruct: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + code = code.Next + store(ctxptr, code.Idx, p) + case encoder.OpStructFieldOmitEmptyStruct: + p := load(ctxptr, code.Idx) + p += uintptr(code.Offset) + if ptrToPtr(p) == 0 && (code.Flags&encoder.IsNextOpPtrTypeFlags) != 0 { + code = code.NextField + } else { + b = appendStructKey(ctx, code, b) + code = code.Next + store(ctxptr, code.Idx, p) + } + case encoder.OpStructEnd: + b = appendStructEndSkipLast(ctx, code, b) + code = code.Next + case encoder.OpStructEndInt: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyInt: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndIntString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyIntString: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndIntPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendInt(ctx, b, p, code) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyIntPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendInt(ctx, b, p, code) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndIntPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyIntPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendInt(ctx, b, p, code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndUint: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyUint: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndUintString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyUintString: + p := load(ctxptr, code.Idx) + u64 := ptrToUint64(p+uintptr(code.Offset), code.NumBitSize) + v := u64 & ((1 << code.NumBitSize) - 1) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p+uintptr(code.Offset), code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndUintPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendUint(ctx, b, p, code) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyUintPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendUint(ctx, b, p, code) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndUintPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyUintPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendUint(ctx, b, p, code) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat32: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat32: + p := load(ctxptr, code.Idx) + v := ptrToFloat32(p + uintptr(code.Offset)) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat32String: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat32String: + p := load(ctxptr, code.Idx) + v := ptrToFloat32(p + uintptr(code.Offset)) + if v != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat32Ptr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendFloat32(ctx, b, ptrToFloat32(p)) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat32Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat32PtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat32PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat32(ctx, b, ptrToFloat32(p)) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat64: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat64: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if v != 0 { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = appendFloat64(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat64String: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat64String: + p := load(ctxptr, code.Idx) + v := ptrToFloat64(p + uintptr(code.Offset)) + if v != 0 { + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat64Ptr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + b = appendStructEnd(ctx, code, b) + code = code.Next + break + } + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat64Ptr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndFloat64PtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = appendFloat64(ctx, b, v) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyFloat64PtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + v := ptrToFloat64(p) + if math.IsInf(v, 0) || math.IsNaN(v) { + return nil, errUnsupportedFloat(v) + } + b = append(b, '"') + b = appendFloat64(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p+uintptr(code.Offset))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyString: + p := load(ctxptr, code.Idx) + v := ptrToString(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndStringString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + s := ptrToString(p + uintptr(code.Offset)) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, s))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyStringString: + p := load(ctxptr, code.Idx) + v := ptrToString(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, v))) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndStringPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, ptrToString(p)) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyStringPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, ptrToString(p)) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndStringPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyStringPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendString(ctx, b, string(appendString(ctx, []byte{}, ptrToString(p)))) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBool: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBool: + p := load(ctxptr, code.Idx) + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBoolString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p+uintptr(code.Offset))) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBoolString: + p := load(ctxptr, code.Idx) + v := ptrToBool(p + uintptr(code.Offset)) + if v { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, v) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBoolPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendBool(ctx, b, ptrToBool(p)) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBoolPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendBool(ctx, b, ptrToBool(p)) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBoolPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBoolPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + b = appendBool(ctx, b, ptrToBool(p)) + b = append(b, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBytes: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p+uintptr(code.Offset))) + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBytes: + p := load(ctxptr, code.Idx) + v := ptrToBytes(p + uintptr(code.Offset)) + if len(v) > 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, v) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndBytesPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = appendByteSlice(ctx, b, ptrToBytes(p)) + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyBytesPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = appendByteSlice(ctx, b, ptrToBytes(p)) + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndNumber: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = appendStructEnd(ctx, code, bb) + code = code.Next + case encoder.OpStructEndOmitEmptyNumber: + p := load(ctxptr, code.Idx) + v := ptrToNumber(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = appendStructEnd(ctx, code, bb) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndNumberString: + p := load(ctxptr, code.Idx) + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p+uintptr(code.Offset))) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyNumberString: + p := load(ctxptr, code.Idx) + v := ptrToNumber(p + uintptr(code.Offset)) + if v != "" { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, v) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndNumberPtr: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = bb + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyNumberPtr: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = appendStructEnd(ctx, code, bb) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpStructEndNumberPtrString: + b = appendStructKey(ctx, code, b) + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p == 0 { + b = appendNull(ctx, b) + } else { + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + } + b = appendStructEnd(ctx, code, b) + code = code.Next + case encoder.OpStructEndOmitEmptyNumberPtrString: + p := load(ctxptr, code.Idx) + p = ptrToNPtr(p+uintptr(code.Offset), code.PtrNum) + if p != 0 { + b = appendStructKey(ctx, code, b) + b = append(b, '"') + bb, err := appendNumber(ctx, b, ptrToNumber(p)) + if err != nil { + return nil, err + } + b = append(bb, '"') + b = appendStructEnd(ctx, code, b) + } else { + b = appendStructEndSkipLast(ctx, code, b) + } + code = code.Next + case encoder.OpEnd: + goto END + } + } +END: + return b, nil +} diff --git a/vendor/github.com/goccy/go-json/internal/errors/error.go b/vendor/github.com/goccy/go-json/internal/errors/error.go new file mode 100644 index 000000000..d58e39f4e --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/errors/error.go @@ -0,0 +1,164 @@ +package errors + +import ( + "fmt" + "reflect" + "strconv" +) + +type InvalidUTF8Error struct { + S string // the whole string value that caused the error +} + +func (e *InvalidUTF8Error) Error() string { + return fmt.Sprintf("json: invalid UTF-8 in string: %s", strconv.Quote(e.S)) +} + +type InvalidUnmarshalError struct { + Type reflect.Type +} + +func (e *InvalidUnmarshalError) Error() string { + if e.Type == nil { + return "json: Unmarshal(nil)" + } + + if e.Type.Kind() != reflect.Ptr { + return fmt.Sprintf("json: Unmarshal(non-pointer %s)", e.Type) + } + return fmt.Sprintf("json: Unmarshal(nil %s)", e.Type) +} + +// A MarshalerError represents an error from calling a MarshalJSON or MarshalText method. +type MarshalerError struct { + Type reflect.Type + Err error + sourceFunc string +} + +func (e *MarshalerError) Error() string { + srcFunc := e.sourceFunc + if srcFunc == "" { + srcFunc = "MarshalJSON" + } + return fmt.Sprintf("json: error calling %s for type %s: %s", srcFunc, e.Type, e.Err.Error()) +} + +// Unwrap returns the underlying error. +func (e *MarshalerError) Unwrap() error { return e.Err } + +// A SyntaxError is a description of a JSON syntax error. +type SyntaxError struct { + msg string // description of error + Offset int64 // error occurred after reading Offset bytes +} + +func (e *SyntaxError) Error() string { return e.msg } + +// An UnmarshalFieldError describes a JSON object key that +// led to an unexported (and therefore unwritable) struct field. +// +// Deprecated: No longer used; kept for compatibility. +type UnmarshalFieldError struct { + Key string + Type reflect.Type + Field reflect.StructField +} + +func (e *UnmarshalFieldError) Error() string { + return fmt.Sprintf("json: cannot unmarshal object key %s into unexported field %s of type %s", + strconv.Quote(e.Key), e.Field.Name, e.Type.String(), + ) +} + +// An UnmarshalTypeError describes a JSON value that was +// not appropriate for a value of a specific Go type. +type UnmarshalTypeError struct { + Value string // description of JSON value - "bool", "array", "number -5" + Type reflect.Type // type of Go value it could not be assigned to + Offset int64 // error occurred after reading Offset bytes + Struct string // name of the struct type containing the field + Field string // the full path from root node to the field +} + +func (e *UnmarshalTypeError) Error() string { + if e.Struct != "" || e.Field != "" { + return fmt.Sprintf("json: cannot unmarshal %s into Go struct field %s.%s of type %s", + e.Value, e.Struct, e.Field, e.Type, + ) + } + return fmt.Sprintf("json: cannot unmarshal %s into Go value of type %s", e.Value, e.Type) +} + +// An UnsupportedTypeError is returned by Marshal when attempting +// to encode an unsupported value type. +type UnsupportedTypeError struct { + Type reflect.Type +} + +func (e *UnsupportedTypeError) Error() string { + return fmt.Sprintf("json: unsupported type: %s", e.Type) +} + +type UnsupportedValueError struct { + Value reflect.Value + Str string +} + +func (e *UnsupportedValueError) Error() string { + return fmt.Sprintf("json: unsupported value: %s", e.Str) +} + +func ErrSyntax(msg string, offset int64) *SyntaxError { + return &SyntaxError{msg: msg, Offset: offset} +} + +func ErrMarshaler(typ reflect.Type, err error, msg string) *MarshalerError { + return &MarshalerError{ + Type: typ, + Err: err, + sourceFunc: msg, + } +} + +func ErrExceededMaxDepth(c byte, cursor int64) *SyntaxError { + return &SyntaxError{ + msg: fmt.Sprintf(`invalid character "%c" exceeded max depth`, c), + Offset: cursor, + } +} + +func ErrNotAtBeginningOfValue(cursor int64) *SyntaxError { + return &SyntaxError{msg: "not at beginning of value", Offset: cursor} +} + +func ErrUnexpectedEndOfJSON(msg string, cursor int64) *SyntaxError { + return &SyntaxError{ + msg: fmt.Sprintf("json: %s unexpected end of JSON input", msg), + Offset: cursor, + } +} + +func ErrExpected(msg string, cursor int64) *SyntaxError { + return &SyntaxError{msg: fmt.Sprintf("expected %s", msg), Offset: cursor} +} + +func ErrInvalidCharacter(c byte, context string, cursor int64) *SyntaxError { + if c == 0 { + return &SyntaxError{ + msg: fmt.Sprintf("json: invalid character as %s", context), + Offset: cursor, + } + } + return &SyntaxError{ + msg: fmt.Sprintf("json: invalid character %c as %s", c, context), + Offset: cursor, + } +} + +func ErrInvalidBeginningOfValue(c byte, cursor int64) *SyntaxError { + return &SyntaxError{ + msg: fmt.Sprintf("invalid character '%c' looking for beginning of value", c), + Offset: cursor, + } +} diff --git a/vendor/github.com/goccy/go-json/internal/runtime/rtype.go b/vendor/github.com/goccy/go-json/internal/runtime/rtype.go new file mode 100644 index 000000000..4db10debe --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/runtime/rtype.go @@ -0,0 +1,263 @@ +package runtime + +import ( + "reflect" + "unsafe" +) + +// Type representing reflect.rtype for noescape trick +type Type struct{} + +//go:linkname rtype_Align reflect.(*rtype).Align +//go:noescape +func rtype_Align(*Type) int + +func (t *Type) Align() int { + return rtype_Align(t) +} + +//go:linkname rtype_FieldAlign reflect.(*rtype).FieldAlign +//go:noescape +func rtype_FieldAlign(*Type) int + +func (t *Type) FieldAlign() int { + return rtype_FieldAlign(t) +} + +//go:linkname rtype_Method reflect.(*rtype).Method +//go:noescape +func rtype_Method(*Type, int) reflect.Method + +func (t *Type) Method(a0 int) reflect.Method { + return rtype_Method(t, a0) +} + +//go:linkname rtype_MethodByName reflect.(*rtype).MethodByName +//go:noescape +func rtype_MethodByName(*Type, string) (reflect.Method, bool) + +func (t *Type) MethodByName(a0 string) (reflect.Method, bool) { + return rtype_MethodByName(t, a0) +} + +//go:linkname rtype_NumMethod reflect.(*rtype).NumMethod +//go:noescape +func rtype_NumMethod(*Type) int + +func (t *Type) NumMethod() int { + return rtype_NumMethod(t) +} + +//go:linkname rtype_Name reflect.(*rtype).Name +//go:noescape +func rtype_Name(*Type) string + +func (t *Type) Name() string { + return rtype_Name(t) +} + +//go:linkname rtype_PkgPath reflect.(*rtype).PkgPath +//go:noescape +func rtype_PkgPath(*Type) string + +func (t *Type) PkgPath() string { + return rtype_PkgPath(t) +} + +//go:linkname rtype_Size reflect.(*rtype).Size +//go:noescape +func rtype_Size(*Type) uintptr + +func (t *Type) Size() uintptr { + return rtype_Size(t) +} + +//go:linkname rtype_String reflect.(*rtype).String +//go:noescape +func rtype_String(*Type) string + +func (t *Type) String() string { + return rtype_String(t) +} + +//go:linkname rtype_Kind reflect.(*rtype).Kind +//go:noescape +func rtype_Kind(*Type) reflect.Kind + +func (t *Type) Kind() reflect.Kind { + return rtype_Kind(t) +} + +//go:linkname rtype_Implements reflect.(*rtype).Implements +//go:noescape +func rtype_Implements(*Type, reflect.Type) bool + +func (t *Type) Implements(u reflect.Type) bool { + return rtype_Implements(t, u) +} + +//go:linkname rtype_AssignableTo reflect.(*rtype).AssignableTo +//go:noescape +func rtype_AssignableTo(*Type, reflect.Type) bool + +func (t *Type) AssignableTo(u reflect.Type) bool { + return rtype_AssignableTo(t, u) +} + +//go:linkname rtype_ConvertibleTo reflect.(*rtype).ConvertibleTo +//go:noescape +func rtype_ConvertibleTo(*Type, reflect.Type) bool + +func (t *Type) ConvertibleTo(u reflect.Type) bool { + return rtype_ConvertibleTo(t, u) +} + +//go:linkname rtype_Comparable reflect.(*rtype).Comparable +//go:noescape +func rtype_Comparable(*Type) bool + +func (t *Type) Comparable() bool { + return rtype_Comparable(t) +} + +//go:linkname rtype_Bits reflect.(*rtype).Bits +//go:noescape +func rtype_Bits(*Type) int + +func (t *Type) Bits() int { + return rtype_Bits(t) +} + +//go:linkname rtype_ChanDir reflect.(*rtype).ChanDir +//go:noescape +func rtype_ChanDir(*Type) reflect.ChanDir + +func (t *Type) ChanDir() reflect.ChanDir { + return rtype_ChanDir(t) +} + +//go:linkname rtype_IsVariadic reflect.(*rtype).IsVariadic +//go:noescape +func rtype_IsVariadic(*Type) bool + +func (t *Type) IsVariadic() bool { + return rtype_IsVariadic(t) +} + +//go:linkname rtype_Elem reflect.(*rtype).Elem +//go:noescape +func rtype_Elem(*Type) reflect.Type + +func (t *Type) Elem() *Type { + return Type2RType(rtype_Elem(t)) +} + +//go:linkname rtype_Field reflect.(*rtype).Field +//go:noescape +func rtype_Field(*Type, int) reflect.StructField + +func (t *Type) Field(i int) reflect.StructField { + return rtype_Field(t, i) +} + +//go:linkname rtype_FieldByIndex reflect.(*rtype).FieldByIndex +//go:noescape +func rtype_FieldByIndex(*Type, []int) reflect.StructField + +func (t *Type) FieldByIndex(index []int) reflect.StructField { + return rtype_FieldByIndex(t, index) +} + +//go:linkname rtype_FieldByName reflect.(*rtype).FieldByName +//go:noescape +func rtype_FieldByName(*Type, string) (reflect.StructField, bool) + +func (t *Type) FieldByName(name string) (reflect.StructField, bool) { + return rtype_FieldByName(t, name) +} + +//go:linkname rtype_FieldByNameFunc reflect.(*rtype).FieldByNameFunc +//go:noescape +func rtype_FieldByNameFunc(*Type, func(string) bool) (reflect.StructField, bool) + +func (t *Type) FieldByNameFunc(match func(string) bool) (reflect.StructField, bool) { + return rtype_FieldByNameFunc(t, match) +} + +//go:linkname rtype_In reflect.(*rtype).In +//go:noescape +func rtype_In(*Type, int) reflect.Type + +func (t *Type) In(i int) reflect.Type { + return rtype_In(t, i) +} + +//go:linkname rtype_Key reflect.(*rtype).Key +//go:noescape +func rtype_Key(*Type) reflect.Type + +func (t *Type) Key() *Type { + return Type2RType(rtype_Key(t)) +} + +//go:linkname rtype_Len reflect.(*rtype).Len +//go:noescape +func rtype_Len(*Type) int + +func (t *Type) Len() int { + return rtype_Len(t) +} + +//go:linkname rtype_NumField reflect.(*rtype).NumField +//go:noescape +func rtype_NumField(*Type) int + +func (t *Type) NumField() int { + return rtype_NumField(t) +} + +//go:linkname rtype_NumIn reflect.(*rtype).NumIn +//go:noescape +func rtype_NumIn(*Type) int + +func (t *Type) NumIn() int { + return rtype_NumIn(t) +} + +//go:linkname rtype_NumOut reflect.(*rtype).NumOut +//go:noescape +func rtype_NumOut(*Type) int + +func (t *Type) NumOut() int { + return rtype_NumOut(t) +} + +//go:linkname rtype_Out reflect.(*rtype).Out +//go:noescape +func rtype_Out(*Type, int) reflect.Type + +//go:linkname PtrTo reflect.(*rtype).ptrTo +//go:noescape +func PtrTo(*Type) *Type + +func (t *Type) Out(i int) reflect.Type { + return rtype_Out(t, i) +} + +//go:linkname IfaceIndir reflect.ifaceIndir +//go:noescape +func IfaceIndir(*Type) bool + +//go:linkname RType2Type reflect.toType +//go:noescape +func RType2Type(t *Type) reflect.Type + +//go:nolint structcheck +type emptyInterface struct { + _ *Type + ptr unsafe.Pointer +} + +func Type2RType(t reflect.Type) *Type { + return (*Type)(((*emptyInterface)(unsafe.Pointer(&t))).ptr) +} diff --git a/vendor/github.com/goccy/go-json/internal/runtime/struct_field.go b/vendor/github.com/goccy/go-json/internal/runtime/struct_field.go new file mode 100644 index 000000000..baab0c597 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/runtime/struct_field.go @@ -0,0 +1,91 @@ +package runtime + +import ( + "reflect" + "strings" + "unicode" +) + +func getTag(field reflect.StructField) string { + return field.Tag.Get("json") +} + +func IsIgnoredStructField(field reflect.StructField) bool { + if field.PkgPath != "" { + if field.Anonymous { + t := field.Type + if t.Kind() == reflect.Ptr { + t = t.Elem() + } + if t.Kind() != reflect.Struct { + return true + } + } else { + // private field + return true + } + } + tag := getTag(field) + return tag == "-" +} + +type StructTag struct { + Key string + IsTaggedKey bool + IsOmitEmpty bool + IsString bool + Field reflect.StructField +} + +type StructTags []*StructTag + +func (t StructTags) ExistsKey(key string) bool { + for _, tt := range t { + if tt.Key == key { + return true + } + } + return false +} + +func isValidTag(s string) bool { + if s == "" { + return false + } + for _, c := range s { + switch { + case strings.ContainsRune("!#$%&()*+-./:<=>?@[]^_{|}~ ", c): + // Backslash and quote chars are reserved, but + // otherwise any punctuation chars are allowed + // in a tag name. + case !unicode.IsLetter(c) && !unicode.IsDigit(c): + return false + } + } + return true +} + +func StructTagFromField(field reflect.StructField) *StructTag { + keyName := field.Name + tag := getTag(field) + st := &StructTag{Field: field} + opts := strings.Split(tag, ",") + if len(opts) > 0 { + if opts[0] != "" && isValidTag(opts[0]) { + keyName = opts[0] + st.IsTaggedKey = true + } + } + st.Key = keyName + if len(opts) > 1 { + for _, opt := range opts[1:] { + switch opt { + case "omitempty": + st.IsOmitEmpty = true + case "string": + st.IsString = true + } + } + } + return st +} diff --git a/vendor/github.com/goccy/go-json/internal/runtime/type.go b/vendor/github.com/goccy/go-json/internal/runtime/type.go new file mode 100644 index 000000000..0167cd2c0 --- /dev/null +++ b/vendor/github.com/goccy/go-json/internal/runtime/type.go @@ -0,0 +1,100 @@ +package runtime + +import ( + "reflect" + "unsafe" +) + +type SliceHeader struct { + Data unsafe.Pointer + Len int + Cap int +} + +const ( + maxAcceptableTypeAddrRange = 1024 * 1024 * 2 // 2 Mib +) + +type TypeAddr struct { + BaseTypeAddr uintptr + MaxTypeAddr uintptr + AddrRange uintptr + AddrShift uintptr +} + +var ( + typeAddr *TypeAddr + alreadyAnalyzed bool +) + +//go:linkname typelinks reflect.typelinks +func typelinks() ([]unsafe.Pointer, [][]int32) + +//go:linkname rtypeOff reflect.rtypeOff +func rtypeOff(unsafe.Pointer, int32) unsafe.Pointer + +func AnalyzeTypeAddr() *TypeAddr { + defer func() { + alreadyAnalyzed = true + }() + if alreadyAnalyzed { + return typeAddr + } + sections, offsets := typelinks() + if len(sections) != 1 { + return nil + } + if len(offsets) != 1 { + return nil + } + section := sections[0] + offset := offsets[0] + var ( + min uintptr = uintptr(^uint(0)) + max uintptr = 0 + isAligned64 = true + isAligned32 = true + ) + for i := 0; i < len(offset); i++ { + typ := (*Type)(rtypeOff(section, offset[i])) + addr := uintptr(unsafe.Pointer(typ)) + if min > addr { + min = addr + } + if max < addr { + max = addr + } + if typ.Kind() == reflect.Ptr { + addr = uintptr(unsafe.Pointer(typ.Elem())) + if min > addr { + min = addr + } + if max < addr { + max = addr + } + } + isAligned64 = isAligned64 && (addr-min)&63 == 0 + isAligned32 = isAligned32 && (addr-min)&31 == 0 + } + addrRange := max - min + if addrRange == 0 { + return nil + } + var addrShift uintptr + if isAligned64 { + addrShift = 6 + } else if isAligned32 { + addrShift = 5 + } + cacheSize := addrRange >> addrShift + if cacheSize > maxAcceptableTypeAddrRange { + return nil + } + typeAddr = &TypeAddr{ + BaseTypeAddr: min, + MaxTypeAddr: max, + AddrRange: addrRange, + AddrShift: addrShift, + } + return typeAddr +} diff --git a/vendor/github.com/goccy/go-json/json.go b/vendor/github.com/goccy/go-json/json.go new file mode 100644 index 000000000..413cb20bf --- /dev/null +++ b/vendor/github.com/goccy/go-json/json.go @@ -0,0 +1,371 @@ +package json + +import ( + "bytes" + "context" + "encoding/json" + + "github.com/goccy/go-json/internal/encoder" +) + +// Marshaler is the interface implemented by types that +// can marshal themselves into valid JSON. +type Marshaler interface { + MarshalJSON() ([]byte, error) +} + +// MarshalerContext is the interface implemented by types that +// can marshal themselves into valid JSON with context.Context. +type MarshalerContext interface { + MarshalJSON(context.Context) ([]byte, error) +} + +// Unmarshaler is the interface implemented by types +// that can unmarshal a JSON description of themselves. +// The input can be assumed to be a valid encoding of +// a JSON value. UnmarshalJSON must copy the JSON data +// if it wishes to retain the data after returning. +// +// By convention, to approximate the behavior of Unmarshal itself, +// Unmarshalers implement UnmarshalJSON([]byte("null")) as a no-op. +type Unmarshaler interface { + UnmarshalJSON([]byte) error +} + +// UnmarshalerContext is the interface implemented by types +// that can unmarshal with context.Context a JSON description of themselves. +type UnmarshalerContext interface { + UnmarshalJSON(context.Context, []byte) error +} + +// Marshal returns the JSON encoding of v. +// +// Marshal traverses the value v recursively. +// If an encountered value implements the Marshaler interface +// and is not a nil pointer, Marshal calls its MarshalJSON method +// to produce JSON. If no MarshalJSON method is present but the +// value implements encoding.TextMarshaler instead, Marshal calls +// its MarshalText method and encodes the result as a JSON string. +// The nil pointer exception is not strictly necessary +// but mimics a similar, necessary exception in the behavior of +// UnmarshalJSON. +// +// Otherwise, Marshal uses the following type-dependent default encodings: +// +// Boolean values encode as JSON booleans. +// +// Floating point, integer, and Number values encode as JSON numbers. +// +// String values encode as JSON strings coerced to valid UTF-8, +// replacing invalid bytes with the Unicode replacement rune. +// The angle brackets "<" and ">" are escaped to "\u003c" and "\u003e" +// to keep some browsers from misinterpreting JSON output as HTML. +// Ampersand "&" is also escaped to "\u0026" for the same reason. +// This escaping can be disabled using an Encoder that had SetEscapeHTML(false) +// called on it. +// +// Array and slice values encode as JSON arrays, except that +// []byte encodes as a base64-encoded string, and a nil slice +// encodes as the null JSON value. +// +// Struct values encode as JSON objects. +// Each exported struct field becomes a member of the object, using the +// field name as the object key, unless the field is omitted for one of the +// reasons given below. +// +// The encoding of each struct field can be customized by the format string +// stored under the "json" key in the struct field's tag. +// The format string gives the name of the field, possibly followed by a +// comma-separated list of options. The name may be empty in order to +// specify options without overriding the default field name. +// +// The "omitempty" option specifies that the field should be omitted +// from the encoding if the field has an empty value, defined as +// false, 0, a nil pointer, a nil interface value, and any empty array, +// slice, map, or string. +// +// As a special case, if the field tag is "-", the field is always omitted. +// Note that a field with name "-" can still be generated using the tag "-,". +// +// Examples of struct field tags and their meanings: +// +// // Field appears in JSON as key "myName". +// Field int `json:"myName"` +// +// // Field appears in JSON as key "myName" and +// // the field is omitted from the object if its value is empty, +// // as defined above. +// Field int `json:"myName,omitempty"` +// +// // Field appears in JSON as key "Field" (the default), but +// // the field is skipped if empty. +// // Note the leading comma. +// Field int `json:",omitempty"` +// +// // Field is ignored by this package. +// Field int `json:"-"` +// +// // Field appears in JSON as key "-". +// Field int `json:"-,"` +// +// The "string" option signals that a field is stored as JSON inside a +// JSON-encoded string. It applies only to fields of string, floating point, +// integer, or boolean types. This extra level of encoding is sometimes used +// when communicating with JavaScript programs: +// +// Int64String int64 `json:",string"` +// +// The key name will be used if it's a non-empty string consisting of +// only Unicode letters, digits, and ASCII punctuation except quotation +// marks, backslash, and comma. +// +// Anonymous struct fields are usually marshaled as if their inner exported fields +// were fields in the outer struct, subject to the usual Go visibility rules amended +// as described in the next paragraph. +// An anonymous struct field with a name given in its JSON tag is treated as +// having that name, rather than being anonymous. +// An anonymous struct field of interface type is treated the same as having +// that type as its name, rather than being anonymous. +// +// The Go visibility rules for struct fields are amended for JSON when +// deciding which field to marshal or unmarshal. If there are +// multiple fields at the same level, and that level is the least +// nested (and would therefore be the nesting level selected by the +// usual Go rules), the following extra rules apply: +// +// 1) Of those fields, if any are JSON-tagged, only tagged fields are considered, +// even if there are multiple untagged fields that would otherwise conflict. +// +// 2) If there is exactly one field (tagged or not according to the first rule), that is selected. +// +// 3) Otherwise there are multiple fields, and all are ignored; no error occurs. +// +// Handling of anonymous struct fields is new in Go 1.1. +// Prior to Go 1.1, anonymous struct fields were ignored. To force ignoring of +// an anonymous struct field in both current and earlier versions, give the field +// a JSON tag of "-". +// +// Map values encode as JSON objects. The map's key type must either be a +// string, an integer type, or implement encoding.TextMarshaler. The map keys +// are sorted and used as JSON object keys by applying the following rules, +// subject to the UTF-8 coercion described for string values above: +// - string keys are used directly +// - encoding.TextMarshalers are marshaled +// - integer keys are converted to strings +// +// Pointer values encode as the value pointed to. +// A nil pointer encodes as the null JSON value. +// +// Interface values encode as the value contained in the interface. +// A nil interface value encodes as the null JSON value. +// +// Channel, complex, and function values cannot be encoded in JSON. +// Attempting to encode such a value causes Marshal to return +// an UnsupportedTypeError. +// +// JSON cannot represent cyclic data structures and Marshal does not +// handle them. Passing cyclic structures to Marshal will result in +// an infinite recursion. +// +func Marshal(v interface{}) ([]byte, error) { + return MarshalWithOption(v) +} + +// MarshalNoEscape returns the JSON encoding of v and doesn't escape v. +func MarshalNoEscape(v interface{}) ([]byte, error) { + return marshalNoEscape(v) +} + +// MarshalContext returns the JSON encoding of v with context.Context and EncodeOption. +func MarshalContext(ctx context.Context, v interface{}, optFuncs ...EncodeOptionFunc) ([]byte, error) { + return marshalContext(ctx, v, optFuncs...) +} + +// MarshalWithOption returns the JSON encoding of v with EncodeOption. +func MarshalWithOption(v interface{}, optFuncs ...EncodeOptionFunc) ([]byte, error) { + return marshal(v, optFuncs...) +} + +// MarshalIndent is like Marshal but applies Indent to format the output. +// Each JSON element in the output will begin on a new line beginning with prefix +// followed by one or more copies of indent according to the indentation nesting. +func MarshalIndent(v interface{}, prefix, indent string) ([]byte, error) { + return MarshalIndentWithOption(v, prefix, indent) +} + +// MarshalIndentWithOption is like Marshal but applies Indent to format the output with EncodeOption. +func MarshalIndentWithOption(v interface{}, prefix, indent string, optFuncs ...EncodeOptionFunc) ([]byte, error) { + return marshalIndent(v, prefix, indent, optFuncs...) +} + +// Unmarshal parses the JSON-encoded data and stores the result +// in the value pointed to by v. If v is nil or not a pointer, +// Unmarshal returns an InvalidUnmarshalError. +// +// Unmarshal uses the inverse of the encodings that +// Marshal uses, allocating maps, slices, and pointers as necessary, +// with the following additional rules: +// +// To unmarshal JSON into a pointer, Unmarshal first handles the case of +// the JSON being the JSON literal null. In that case, Unmarshal sets +// the pointer to nil. Otherwise, Unmarshal unmarshals the JSON into +// the value pointed at by the pointer. If the pointer is nil, Unmarshal +// allocates a new value for it to point to. +// +// To unmarshal JSON into a value implementing the Unmarshaler interface, +// Unmarshal calls that value's UnmarshalJSON method, including +// when the input is a JSON null. +// Otherwise, if the value implements encoding.TextUnmarshaler +// and the input is a JSON quoted string, Unmarshal calls that value's +// UnmarshalText method with the unquoted form of the string. +// +// To unmarshal JSON into a struct, Unmarshal matches incoming object +// keys to the keys used by Marshal (either the struct field name or its tag), +// preferring an exact match but also accepting a case-insensitive match. By +// default, object keys which don't have a corresponding struct field are +// ignored (see Decoder.DisallowUnknownFields for an alternative). +// +// To unmarshal JSON into an interface value, +// Unmarshal stores one of these in the interface value: +// +// bool, for JSON booleans +// float64, for JSON numbers +// string, for JSON strings +// []interface{}, for JSON arrays +// map[string]interface{}, for JSON objects +// nil for JSON null +// +// To unmarshal a JSON array into a slice, Unmarshal resets the slice length +// to zero and then appends each element to the slice. +// As a special case, to unmarshal an empty JSON array into a slice, +// Unmarshal replaces the slice with a new empty slice. +// +// To unmarshal a JSON array into a Go array, Unmarshal decodes +// JSON array elements into corresponding Go array elements. +// If the Go array is smaller than the JSON array, +// the additional JSON array elements are discarded. +// If the JSON array is smaller than the Go array, +// the additional Go array elements are set to zero values. +// +// To unmarshal a JSON object into a map, Unmarshal first establishes a map to +// use. If the map is nil, Unmarshal allocates a new map. Otherwise Unmarshal +// reuses the existing map, keeping existing entries. Unmarshal then stores +// key-value pairs from the JSON object into the map. The map's key type must +// either be any string type, an integer, implement json.Unmarshaler, or +// implement encoding.TextUnmarshaler. +// +// If a JSON value is not appropriate for a given target type, +// or if a JSON number overflows the target type, Unmarshal +// skips that field and completes the unmarshaling as best it can. +// If no more serious errors are encountered, Unmarshal returns +// an UnmarshalTypeError describing the earliest such error. In any +// case, it's not guaranteed that all the remaining fields following +// the problematic one will be unmarshaled into the target object. +// +// The JSON null value unmarshals into an interface, map, pointer, or slice +// by setting that Go value to nil. Because null is often used in JSON to mean +// ``not present,'' unmarshaling a JSON null into any other Go type has no effect +// on the value and produces no error. +// +// When unmarshaling quoted strings, invalid UTF-8 or +// invalid UTF-16 surrogate pairs are not treated as an error. +// Instead, they are replaced by the Unicode replacement +// character U+FFFD. +// +func Unmarshal(data []byte, v interface{}) error { + return unmarshal(data, v) +} + +// UnmarshalContext parses the JSON-encoded data and stores the result +// in the value pointed to by v. If you implement the UnmarshalerContext interface, +// call it with ctx as an argument. +func UnmarshalContext(ctx context.Context, data []byte, v interface{}, optFuncs ...DecodeOptionFunc) error { + return unmarshalContext(ctx, data, v) +} + +func UnmarshalWithOption(data []byte, v interface{}, optFuncs ...DecodeOptionFunc) error { + return unmarshal(data, v, optFuncs...) +} + +func UnmarshalNoEscape(data []byte, v interface{}, optFuncs ...DecodeOptionFunc) error { + return unmarshalNoEscape(data, v, optFuncs...) +} + +// A Token holds a value of one of these types: +// +// Delim, for the four JSON delimiters [ ] { } +// bool, for JSON booleans +// float64, for JSON numbers +// Number, for JSON numbers +// string, for JSON string literals +// nil, for JSON null +// +type Token = json.Token + +// A Number represents a JSON number literal. +type Number = json.Number + +// RawMessage is a raw encoded JSON value. +// It implements Marshaler and Unmarshaler and can +// be used to delay JSON decoding or precompute a JSON encoding. +type RawMessage = json.RawMessage + +// A Delim is a JSON array or object delimiter, one of [ ] { or }. +type Delim = json.Delim + +// Compact appends to dst the JSON-encoded src with +// insignificant space characters elided. +func Compact(dst *bytes.Buffer, src []byte) error { + return encoder.Compact(dst, src, false) +} + +// Indent appends to dst an indented form of the JSON-encoded src. +// Each element in a JSON object or array begins on a new, +// indented line beginning with prefix followed by one or more +// copies of indent according to the indentation nesting. +// The data appended to dst does not begin with the prefix nor +// any indentation, to make it easier to embed inside other formatted JSON data. +// Although leading space characters (space, tab, carriage return, newline) +// at the beginning of src are dropped, trailing space characters +// at the end of src are preserved and copied to dst. +// For example, if src has no trailing spaces, neither will dst; +// if src ends in a trailing newline, so will dst. +func Indent(dst *bytes.Buffer, src []byte, prefix, indent string) error { + return encoder.Indent(dst, src, prefix, indent) +} + +// HTMLEscape appends to dst the JSON-encoded src with <, >, &, U+2028 and U+2029 +// characters inside string literals changed to \u003c, \u003e, \u0026, \u2028, \u2029 +// so that the JSON will be safe to embed inside HTML <script> tags. +// For historical reasons, web browsers don't honor standard HTML +// escaping within <script> tags, so an alternative JSON encoding must +// be used. +func HTMLEscape(dst *bytes.Buffer, src []byte) { + var v interface{} + dec := NewDecoder(bytes.NewBuffer(src)) + dec.UseNumber() + if err := dec.Decode(&v); err != nil { + return + } + buf, _ := marshal(v) + dst.Write(buf) +} + +// Valid reports whether data is a valid JSON encoding. +func Valid(data []byte) bool { + var v interface{} + decoder := NewDecoder(bytes.NewReader(data)) + err := decoder.Decode(&v) + if err != nil { + return false + } + if !decoder.More() { + return true + } + return decoder.InputOffset() >= int64(len(data)) +} + +func init() { + encoder.Marshal = Marshal + encoder.Unmarshal = Unmarshal +} diff --git a/vendor/github.com/goccy/go-json/option.go b/vendor/github.com/goccy/go-json/option.go new file mode 100644 index 000000000..af400a452 --- /dev/null +++ b/vendor/github.com/goccy/go-json/option.go @@ -0,0 +1,72 @@ +package json + +import ( + "io" + + "github.com/goccy/go-json/internal/decoder" + "github.com/goccy/go-json/internal/encoder" +) + +type EncodeOption = encoder.Option +type EncodeOptionFunc func(*EncodeOption) + +// UnorderedMap doesn't sort when encoding map type. +func UnorderedMap() EncodeOptionFunc { + return func(opt *EncodeOption) { + opt.Flag |= encoder.UnorderedMapOption + } +} + +// DisableHTMLEscape disables escaping of HTML characters ( '&', '<', '>' ) when encoding string. +func DisableHTMLEscape() EncodeOptionFunc { + return func(opt *EncodeOption) { + opt.Flag &= ^encoder.HTMLEscapeOption + } +} + +// DisableNormalizeUTF8 +// By default, when encoding string, UTF8 characters in the range of 0x80 - 0xFF are processed by applying \ufffd for invalid code and escaping for \u2028 and \u2029. +// This option disables this behaviour. You can expect faster speeds by applying this option, but be careful. +// encoding/json implements here: https://github.com/golang/go/blob/6178d25fc0b28724b1b5aec2b1b74fc06d9294c7/src/encoding/json/encode.go#L1067-L1093. +func DisableNormalizeUTF8() EncodeOptionFunc { + return func(opt *EncodeOption) { + opt.Flag &= ^encoder.NormalizeUTF8Option + } +} + +// Debug outputs debug information when panic occurs during encoding. +func Debug() EncodeOptionFunc { + return func(opt *EncodeOption) { + opt.Flag |= encoder.DebugOption + } +} + +// DebugWith sets the destination to write debug messages. +func DebugWith(w io.Writer) EncodeOptionFunc { + return func(opt *EncodeOption) { + opt.DebugOut = w + } +} + +// Colorize add an identifier for coloring to the string of the encoded result. +func Colorize(scheme *ColorScheme) EncodeOptionFunc { + return func(opt *EncodeOption) { + opt.Flag |= encoder.ColorizeOption + opt.ColorScheme = scheme + } +} + +type DecodeOption = decoder.Option +type DecodeOptionFunc func(*DecodeOption) + +// DecodeFieldPriorityFirstWin +// in the default behavior, go-json, like encoding/json, +// will reflect the result of the last evaluation when a field with the same name exists. +// This option allow you to change this behavior. +// this option reflects the result of the first evaluation if a field with the same name exists. +// This behavior has a performance advantage as it allows the subsequent strings to be skipped if all fields have been evaluated. +func DecodeFieldPriorityFirstWin() DecodeOptionFunc { + return func(opt *DecodeOption) { + opt.Flags |= decoder.FirstWinOption + } +} diff --git a/vendor/github.com/goccy/go-json/query.go b/vendor/github.com/goccy/go-json/query.go new file mode 100644 index 000000000..4b11cf20d --- /dev/null +++ b/vendor/github.com/goccy/go-json/query.go @@ -0,0 +1,47 @@ +package json + +import ( + "github.com/goccy/go-json/internal/encoder" +) + +type ( + // FieldQuery you can dynamically filter the fields in the structure by creating a FieldQuery, + // adding it to context.Context using SetFieldQueryToContext and then passing it to MarshalContext. + // This is a type-safe operation, so it is faster than filtering using map[string]interface{}. + FieldQuery = encoder.FieldQuery + FieldQueryString = encoder.FieldQueryString +) + +var ( + // FieldQueryFromContext get current FieldQuery from context.Context. + FieldQueryFromContext = encoder.FieldQueryFromContext + // SetFieldQueryToContext set current FieldQuery to context.Context. + SetFieldQueryToContext = encoder.SetFieldQueryToContext +) + +// BuildFieldQuery builds FieldQuery by fieldName or sub field query. +// First, specify the field name that you want to keep in structure type. +// If the field you want to keep is a structure type, by creating a sub field query using BuildSubFieldQuery, +// you can select the fields you want to keep in the structure. +// This description can be written recursively. +func BuildFieldQuery(fields ...FieldQueryString) (*FieldQuery, error) { + query, err := Marshal(fields) + if err != nil { + return nil, err + } + return FieldQueryString(query).Build() +} + +// BuildSubFieldQuery builds sub field query. +func BuildSubFieldQuery(name string) *SubFieldQuery { + return &SubFieldQuery{name: name} +} + +type SubFieldQuery struct { + name string +} + +func (q *SubFieldQuery) Fields(fields ...FieldQueryString) FieldQueryString { + query, _ := Marshal(map[string][]FieldQueryString{q.name: fields}) + return FieldQueryString(query) +} diff --git a/vendor/github.com/inconshreveable/mousetrap/LICENSE b/vendor/github.com/inconshreveable/mousetrap/LICENSE index 5f0d1fb6a..5f920e973 100644 --- a/vendor/github.com/inconshreveable/mousetrap/LICENSE +++ b/vendor/github.com/inconshreveable/mousetrap/LICENSE @@ -1,13 +1,201 @@ -Copyright 2014 Alan Shreve + Apache License + Version 2.0, January 2004 + http://www.apache.org/licenses/ -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at + TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION - http://www.apache.org/licenses/LICENSE-2.0 + 1. Definitions. -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. + "License" shall mean the terms and conditions for use, reproduction, + and distribution as defined by Sections 1 through 9 of this document. + + "Licensor" shall mean the copyright owner or entity authorized by + the copyright owner that is granting the License. + + "Legal Entity" shall mean the union of the acting entity and all + other entities that control, are controlled by, or are under common + control with that entity. For the purposes of this definition, + "control" means (i) the power, direct or indirect, to cause the + direction or management of such entity, whether by contract or + otherwise, or (ii) ownership of fifty percent (50%) or more of the + outstanding shares, or (iii) beneficial ownership of such entity. + + "You" (or "Your") shall mean an individual or Legal Entity + exercising permissions granted by this License. + + "Source" form shall mean the preferred form for making modifications, + including but not limited to software source code, documentation + source, and configuration files. + + "Object" form shall mean any form resulting from mechanical + transformation or translation of a Source form, including but + not limited to compiled object code, generated documentation, + and conversions to other media types. + + "Work" shall mean the work of authorship, whether in Source or + Object form, made available under the License, as indicated by a + copyright notice that is included in or attached to the work + (an example is provided in the Appendix below). + + "Derivative Works" shall mean any work, whether in Source or Object + form, that is based on (or derived from) the Work and for which the + editorial revisions, annotations, elaborations, or other modifications + represent, as a whole, an original work of authorship. For the purposes + of this License, Derivative Works shall not include works that remain + separable from, or merely link (or bind by name) to the interfaces of, + the Work and Derivative Works thereof. + + "Contribution" shall mean any work of authorship, including + the original version of the Work and any modifications or additions + to that Work or Derivative Works thereof, that is intentionally + submitted to Licensor for inclusion in the Work by the copyright owner + or by an individual or Legal Entity authorized to submit on behalf of + the copyright owner. For the purposes of this definition, "submitted" + means any form of electronic, verbal, or written communication sent + to the Licensor or its representatives, including but not limited to + communication on electronic mailing lists, source code control systems, + and issue tracking systems that are managed by, or on behalf of, the + Licensor for the purpose of discussing and improving the Work, but + excluding communication that is conspicuously marked or otherwise + designated in writing by the copyright owner as "Not a Contribution." + + "Contributor" shall mean Licensor and any individual or Legal Entity + on behalf of whom a Contribution has been received by Licensor and + subsequently incorporated within the Work. + + 2. Grant of Copyright License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + copyright license to reproduce, prepare Derivative Works of, + publicly display, publicly perform, sublicense, and distribute the + Work and such Derivative Works in Source or Object form. + + 3. Grant of Patent License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + (except as stated in this section) patent license to make, have made, + use, offer to sell, sell, import, and otherwise transfer the Work, + where such license applies only to those patent claims licensable + by such Contributor that are necessarily infringed by their + Contribution(s) alone or by combination of their Contribution(s) + with the Work to which such Contribution(s) was submitted. If You + institute patent litigation against any entity (including a + cross-claim or counterclaim in a lawsuit) alleging that the Work + or a Contribution incorporated within the Work constitutes direct + or contributory patent infringement, then any patent licenses + granted to You under this License for that Work shall terminate + as of the date such litigation is filed. + + 4. Redistribution. You may reproduce and distribute copies of the + Work or Derivative Works thereof in any medium, with or without + modifications, and in Source or Object form, provided that You + meet the following conditions: + + (a) You must give any other recipients of the Work or + Derivative Works a copy of this License; and + + (b) You must cause any modified files to carry prominent notices + stating that You changed the files; and + + (c) You must retain, in the Source form of any Derivative Works + that You distribute, all copyright, patent, trademark, and + attribution notices from the Source form of the Work, + excluding those notices that do not pertain to any part of + the Derivative Works; and + + (d) If the Work includes a "NOTICE" text file as part of its + distribution, then any Derivative Works that You distribute must + include a readable copy of the attribution notices contained + within such NOTICE file, excluding those notices that do not + pertain to any part of the Derivative Works, in at least one + of the following places: within a NOTICE text file distributed + as part of the Derivative Works; within the Source form or + documentation, if provided along with the Derivative Works; or, + within a display generated by the Derivative Works, if and + wherever such third-party notices normally appear. The contents + of the NOTICE file are for informational purposes only and + do not modify the License. You may add Your own attribution + notices within Derivative Works that You distribute, alongside + or as an addendum to the NOTICE text from the Work, provided + that such additional attribution notices cannot be construed + as modifying the License. + + You may add Your own copyright statement to Your modifications and + may provide additional or different license terms and conditions + for use, reproduction, or distribution of Your modifications, or + for any such Derivative Works as a whole, provided Your use, + reproduction, and distribution of the Work otherwise complies with + the conditions stated in this License. + + 5. Submission of Contributions. Unless You explicitly state otherwise, + any Contribution intentionally submitted for inclusion in the Work + by You to the Licensor shall be under the terms and conditions of + this License, without any additional terms or conditions. + Notwithstanding the above, nothing herein shall supersede or modify + the terms of any separate license agreement you may have executed + with Licensor regarding such Contributions. + + 6. Trademarks. This License does not grant permission to use the trade + names, trademarks, service marks, or product names of the Licensor, + except as required for reasonable and customary use in describing the + origin of the Work and reproducing the content of the NOTICE file. + + 7. Disclaimer of Warranty. Unless required by applicable law or + agreed to in writing, Licensor provides the Work (and each + Contributor provides its Contributions) on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or + implied, including, without limitation, any warranties or conditions + of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A + PARTICULAR PURPOSE. You are solely responsible for determining the + appropriateness of using or redistributing the Work and assume any + risks associated with Your exercise of permissions under this License. + + 8. Limitation of Liability. In no event and under no legal theory, + whether in tort (including negligence), contract, or otherwise, + unless required by applicable law (such as deliberate and grossly + negligent acts) or agreed to in writing, shall any Contributor be + liable to You for damages, including any direct, indirect, special, + incidental, or consequential damages of any character arising as a + result of this License or out of the use or inability to use the + Work (including but not limited to damages for loss of goodwill, + work stoppage, computer failure or malfunction, or any and all + other commercial damages or losses), even if such Contributor + has been advised of the possibility of such damages. + + 9. Accepting Warranty or Additional Liability. While redistributing + the Work or Derivative Works thereof, You may choose to offer, + and charge a fee for, acceptance of support, warranty, indemnity, + or other liability obligations and/or rights consistent with this + License. However, in accepting such obligations, You may act only + on Your own behalf and on Your sole responsibility, not on behalf + of any other Contributor, and only if You agree to indemnify, + defend, and hold each Contributor harmless for any liability + incurred by, or claims asserted against, such Contributor by reason + of your accepting any such warranty or additional liability. + + END OF TERMS AND CONDITIONS + + APPENDIX: How to apply the Apache License to your work. + + To apply the Apache License to your work, attach the following + boilerplate notice, with the fields enclosed by brackets "[]" + replaced with your own identifying information. (Don't include + the brackets!) The text should be enclosed in the appropriate + comment syntax for the file format. We also recommend that a + file or class name and description of purpose be included on the + same "printed page" as the copyright notice for easier + identification within third-party archives. + + Copyright 2022 Alan Shreve (@inconshreveable) + + Licensed under the Apache License, Version 2.0 (the "License"); + you may not use this file except in compliance with the License. + You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + + Unless required by applicable law or agreed to in writing, software + distributed under the License is distributed on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + See the License for the specific language governing permissions and + limitations under the License. diff --git a/vendor/github.com/jackc/pgconn/CHANGELOG.md b/vendor/github.com/jackc/pgconn/CHANGELOG.md index a37eecfe1..f6a6807f0 100644 --- a/vendor/github.com/jackc/pgconn/CHANGELOG.md +++ b/vendor/github.com/jackc/pgconn/CHANGELOG.md @@ -1,3 +1,21 @@ +# 1.13.0 (August 6, 2022) + +* Add sslpassword support (Eric McCormack and yun.xu) +* Add prefer-standby target_session_attrs support (sergey.bashilov) +* Fix GSS ErrorResponse handling (Oliver Tan) + +# 1.12.1 (May 7, 2022) + +* Fix: setting krbspn and krbsrvname in connection string (sireax) +* Add support for Unix sockets on Windows (Eno Compton) +* Stop ignoring ErrorResponse during SCRAM auth (Rafi Shamim) + +# 1.12.0 (April 21, 2022) + +* Add pluggable GSSAPI support (Oliver Tan) +* Fix: Consider any "0A000" error a possible cached plan changed error due to locale +* Better match psql fallback behavior with multiple hosts + # 1.11.0 (February 7, 2022) * Support port in ip from LookupFunc to override config (James Hartig) diff --git a/vendor/github.com/jackc/pgconn/auth_scram.go b/vendor/github.com/jackc/pgconn/auth_scram.go index 6a143fcdc..d8d711163 100644 --- a/vendor/github.com/jackc/pgconn/auth_scram.go +++ b/vendor/github.com/jackc/pgconn/auth_scram.go @@ -78,12 +78,14 @@ func (c *PgConn) rxSASLContinue() (*pgproto3.AuthenticationSASLContinue, error) if err != nil { return nil, err } - saslContinue, ok := msg.(*pgproto3.AuthenticationSASLContinue) - if ok { - return saslContinue, nil + switch m := msg.(type) { + case *pgproto3.AuthenticationSASLContinue: + return m, nil + case *pgproto3.ErrorResponse: + return nil, ErrorResponseToPgError(m) } - return nil, errors.New("expected AuthenticationSASLContinue message but received unexpected message") + return nil, fmt.Errorf("expected AuthenticationSASLContinue message but received unexpected message %T", msg) } func (c *PgConn) rxSASLFinal() (*pgproto3.AuthenticationSASLFinal, error) { @@ -91,12 +93,14 @@ func (c *PgConn) rxSASLFinal() (*pgproto3.AuthenticationSASLFinal, error) { if err != nil { return nil, err } - saslFinal, ok := msg.(*pgproto3.AuthenticationSASLFinal) - if ok { - return saslFinal, nil + switch m := msg.(type) { + case *pgproto3.AuthenticationSASLFinal: + return m, nil + case *pgproto3.ErrorResponse: + return nil, ErrorResponseToPgError(m) } - return nil, errors.New("expected AuthenticationSASLFinal message but received unexpected message") + return nil, fmt.Errorf("expected AuthenticationSASLFinal message but received unexpected message %T", msg) } type scramClient struct { diff --git a/vendor/github.com/jackc/pgconn/config.go b/vendor/github.com/jackc/pgconn/config.go index 0eab23af9..2277dc1de 100644 --- a/vendor/github.com/jackc/pgconn/config.go +++ b/vendor/github.com/jackc/pgconn/config.go @@ -4,6 +4,7 @@ import ( "context" "crypto/tls" "crypto/x509" + "encoding/pem" "errors" "fmt" "io" @@ -25,6 +26,7 @@ import ( type AfterConnectFunc func(ctx context.Context, pgconn *PgConn) error type ValidateConnectFunc func(ctx context.Context, pgconn *PgConn) error +type GetSSLPasswordFunc func(ctx context.Context) string // Config is the settings used to establish a connection to a PostgreSQL server. It must be created by ParseConfig. A // manually initialized Config will cause ConnectConfig to panic. @@ -41,7 +43,9 @@ type Config struct { BuildFrontend BuildFrontendFunc RuntimeParams map[string]string // Run-time parameters to set on connection as session default values (e.g. search_path or application_name) - Fallbacks []*FallbackConfig + KerberosSrvName string + KerberosSpn string + Fallbacks []*FallbackConfig // ValidateConnect is called during a connection attempt after a successful authentication with the PostgreSQL server. // It can be used to validate that the server is acceptable. If this returns an error the connection is closed and the next @@ -61,6 +65,13 @@ type Config struct { createdByParseConfig bool // Used to enforce created by ParseConfig rule. } +// ParseConfigOptions contains options that control how a config is built such as getsslpassword. +type ParseConfigOptions struct { + // GetSSLPassword gets the password to decrypt a SSL client certificate. This is analogous to the the libpq function + // PQsetSSLKeyPassHook_OpenSSL. + GetSSLPassword GetSSLPasswordFunc +} + // Copy returns a deep copy of the config that is safe to use and modify. // The only exception is the TLSConfig field: // according to the tls.Config docs it must not be modified after creation. @@ -98,10 +109,29 @@ type FallbackConfig struct { TLSConfig *tls.Config // nil disables TLS } +// isAbsolutePath checks if the provided value is an absolute path either +// beginning with a forward slash (as on Linux-based systems) or with a capital +// letter A-Z followed by a colon and a backslash, e.g., "C:\", (as on Windows). +func isAbsolutePath(path string) bool { + isWindowsPath := func(p string) bool { + if len(p) < 3 { + return false + } + drive := p[0] + colon := p[1] + backslash := p[2] + if drive >= 'A' && drive <= 'Z' && colon == ':' && backslash == '\\' { + return true + } + return false + } + return strings.HasPrefix(path, "/") || isWindowsPath(path) +} + // NetworkAddress converts a PostgreSQL host and port into network and address suitable for use with // net.Dial. func NetworkAddress(host string, port uint16) (network, address string) { - if strings.HasPrefix(host, "/") { + if isAbsolutePath(host) { network = "unix" address = filepath.Join(host, ".s.PGSQL.") + strconv.FormatInt(int64(port), 10) } else { @@ -111,10 +141,10 @@ func NetworkAddress(host string, port uint16) (network, address string) { return network, address } -// ParseConfig builds a *Config with similar behavior to the PostgreSQL standard C library libpq. It uses the same -// defaults as libpq (e.g. port=5432) and understands most PG* environment variables. ParseConfig closely matches -// the parsing behavior of libpq. connString may either be in URL format or keyword = value format (DSN style). See -// https://www.postgresql.org/docs/current/libpq-connect.html#LIBPQ-CONNSTRING for details. connString also may be +// ParseConfig builds a *Config from connString with similar behavior to the PostgreSQL standard C library libpq. It +// uses the same defaults as libpq (e.g. port=5432) and understands most PG* environment variables. ParseConfig closely +// matches the parsing behavior of libpq. connString may either be in URL format or keyword = value format (DSN style). +// See https://www.postgresql.org/docs/current/libpq-connect.html#LIBPQ-CONNSTRING for details. connString also may be // empty to only read from the environment. If a password is not supplied it will attempt to read the .pgpass file. // // # Example DSN @@ -138,21 +168,22 @@ func NetworkAddress(host string, port uint16) (network, address string) { // ParseConfig currently recognizes the following environment variable and their parameter key word equivalents passed // via database URL or DSN: // -// PGHOST -// PGPORT -// PGDATABASE -// PGUSER -// PGPASSWORD -// PGPASSFILE -// PGSERVICE -// PGSERVICEFILE -// PGSSLMODE -// PGSSLCERT -// PGSSLKEY -// PGSSLROOTCERT -// PGAPPNAME -// PGCONNECT_TIMEOUT -// PGTARGETSESSIONATTRS +// PGHOST +// PGPORT +// PGDATABASE +// PGUSER +// PGPASSWORD +// PGPASSFILE +// PGSERVICE +// PGSERVICEFILE +// PGSSLMODE +// PGSSLCERT +// PGSSLKEY +// PGSSLROOTCERT +// PGSSLPASSWORD +// PGAPPNAME +// PGCONNECT_TIMEOUT +// PGTARGETSESSIONATTRS // // See http://www.postgresql.org/docs/11/static/libpq-envars.html for details on the meaning of environment variables. // @@ -172,23 +203,29 @@ func NetworkAddress(host string, port uint16) (network, address string) { // sslmode "prefer" this means it will first try the main Config settings which use TLS, then it will try the fallback // which does not use TLS. This can lead to an unexpected unencrypted connection if the main TLS config is manually // changed later but the unencrypted fallback is present. Ensure there are no stale fallbacks when manually setting -// TLCConfig. +// TLSConfig. // // Other known differences with libpq: // -// If a host name resolves into multiple addresses, libpq will try all addresses. pgconn will only try the first. -// // When multiple hosts are specified, libpq allows them to have different passwords set via the .pgpass file. pgconn // does not. // // In addition, ParseConfig accepts the following options: // -// min_read_buffer_size -// The minimum size of the internal read buffer. Default 8192. -// servicefile -// libpq only reads servicefile from the PGSERVICEFILE environment variable. ParseConfig accepts servicefile as a -// part of the connection string. +// min_read_buffer_size +// The minimum size of the internal read buffer. Default 8192. +// servicefile +// libpq only reads servicefile from the PGSERVICEFILE environment variable. ParseConfig accepts servicefile as a +// part of the connection string. func ParseConfig(connString string) (*Config, error) { + var parseConfigOptions ParseConfigOptions + return ParseConfigWithOptions(connString, parseConfigOptions) +} + +// ParseConfigWithOptions builds a *Config from connString and options with similar behavior to the PostgreSQL standard +// C library libpq. options contains settings that cannot be specified in a connString such as providing a function to +// get the SSL password. +func ParseConfigWithOptions(connString string, options ParseConfigOptions) (*Config, error) { defaultSettings := defaultSettings() envSettings := parseEnvSettings() @@ -259,12 +296,23 @@ func ParseConfig(connString string) (*Config, error) { "sslkey": {}, "sslcert": {}, "sslrootcert": {}, + "sslpassword": {}, + "krbspn": {}, + "krbsrvname": {}, "target_session_attrs": {}, "min_read_buffer_size": {}, "service": {}, "servicefile": {}, } + // Adding kerberos configuration + if _, present := settings["krbsrvname"]; present { + config.KerberosSrvName = settings["krbsrvname"] + } + if _, present := settings["krbspn"]; present { + config.KerberosSpn = settings["krbspn"] + } + for k, v := range settings { if _, present := notRuntimeParams[k]; present { continue @@ -297,7 +345,7 @@ func ParseConfig(connString string) (*Config, error) { tlsConfigs = append(tlsConfigs, nil) } else { var err error - tlsConfigs, err = configTLS(settings, host) + tlsConfigs, err = configTLS(settings, host, options) if err != nil { return nil, &parseConfigError{connString: connString, msg: "failed to configure TLS", err: err} } @@ -338,7 +386,9 @@ func ParseConfig(connString string) (*Config, error) { config.ValidateConnect = ValidateConnectTargetSessionAttrsPrimary case "standby": config.ValidateConnect = ValidateConnectTargetSessionAttrsStandby - case "any", "prefer-standby": + case "prefer-standby": + config.ValidateConnect = ValidateConnectTargetSessionAttrsPreferStandby + case "any": // do nothing default: return nil, &parseConfigError{connString: connString, msg: fmt.Sprintf("unknown target_session_attrs value: %v", tsa)} @@ -375,6 +425,7 @@ func parseEnvSettings() map[string]string { "PGSSLKEY": "sslkey", "PGSSLCERT": "sslcert", "PGSSLROOTCERT": "sslrootcert", + "PGSSLPASSWORD": "sslpassword", "PGTARGETSESSIONATTRS": "target_session_attrs", "PGSERVICE": "service", "PGSERVICEFILE": "servicefile", @@ -561,12 +612,13 @@ func parseServiceSettings(servicefilePath, serviceName string) (map[string]strin // configTLS uses libpq's TLS parameters to construct []*tls.Config. It is // necessary to allow returning multiple TLS configs as sslmode "allow" and // "prefer" allow fallback. -func configTLS(settings map[string]string, thisHost string) ([]*tls.Config, error) { +func configTLS(settings map[string]string, thisHost string, parseConfigOptions ParseConfigOptions) ([]*tls.Config, error) { host := thisHost sslmode := settings["sslmode"] sslrootcert := settings["sslrootcert"] sslcert := settings["sslcert"] sslkey := settings["sslkey"] + sslpassword := settings["sslpassword"] // Match libpq default behavior if sslmode == "" { @@ -654,11 +706,53 @@ func configTLS(settings map[string]string, thisHost string) ([]*tls.Config, erro } if sslcert != "" && sslkey != "" { - cert, err := tls.LoadX509KeyPair(sslcert, sslkey) + buf, err := ioutil.ReadFile(sslkey) if err != nil { - return nil, fmt.Errorf("unable to read cert: %w", err) + return nil, fmt.Errorf("unable to read sslkey: %w", err) } + block, _ := pem.Decode(buf) + var pemKey []byte + var decryptedKey []byte + var decryptedError error + // If PEM is encrypted, attempt to decrypt using pass phrase + if x509.IsEncryptedPEMBlock(block) { + // Attempt decryption with pass phrase + // NOTE: only supports RSA (PKCS#1) + if sslpassword != "" { + decryptedKey, decryptedError = x509.DecryptPEMBlock(block, []byte(sslpassword)) + } + //if sslpassword not provided or has decryption error when use it + //try to find sslpassword with callback function + if sslpassword == "" || decryptedError != nil { + if parseConfigOptions.GetSSLPassword != nil { + sslpassword = parseConfigOptions.GetSSLPassword(context.Background()) + } + if sslpassword == "" { + return nil, fmt.Errorf("unable to find sslpassword") + } + } + decryptedKey, decryptedError = x509.DecryptPEMBlock(block, []byte(sslpassword)) + // Should we also provide warning for PKCS#1 needed? + if decryptedError != nil { + return nil, fmt.Errorf("unable to decrypt key: %w", err) + } + pemBytes := pem.Block{ + Type: "RSA PRIVATE KEY", + Bytes: decryptedKey, + } + pemKey = pem.EncodeToMemory(&pemBytes) + } else { + pemKey = pem.EncodeToMemory(block) + } + certfile, err := ioutil.ReadFile(sslcert) + if err != nil { + return nil, fmt.Errorf("unable to read cert: %w", err) + } + cert, err := tls.X509KeyPair(certfile, pemKey) + if err != nil { + return nil, fmt.Errorf("unable to load cert: %w", err) + } tlsConfig.Certificates = []tls.Certificate{cert} } @@ -781,3 +875,18 @@ func ValidateConnectTargetSessionAttrsPrimary(ctx context.Context, pgConn *PgCon return nil } + +// ValidateConnectTargetSessionAttrsPreferStandby is an ValidateConnectFunc that implements libpq compatible +// target_session_attrs=prefer-standby. +func ValidateConnectTargetSessionAttrsPreferStandby(ctx context.Context, pgConn *PgConn) error { + result := pgConn.ExecParams(ctx, "select pg_is_in_recovery()", nil, nil, nil, nil).Read() + if result.Err != nil { + return result.Err + } + + if string(result.Rows[0][0]) != "t" { + return &NotPreferredError{err: errors.New("server is not in hot standby mode")} + } + + return nil +} diff --git a/vendor/github.com/jackc/pgconn/defaults.go b/vendor/github.com/jackc/pgconn/defaults.go index f69cad317..c7209fdd3 100644 --- a/vendor/github.com/jackc/pgconn/defaults.go +++ b/vendor/github.com/jackc/pgconn/defaults.go @@ -1,3 +1,4 @@ +//go:build !windows // +build !windows package pgconn diff --git a/vendor/github.com/jackc/pgconn/errors.go b/vendor/github.com/jackc/pgconn/errors.go index a32b29c92..66d35584a 100644 --- a/vendor/github.com/jackc/pgconn/errors.go +++ b/vendor/github.com/jackc/pgconn/errors.go @@ -219,3 +219,20 @@ func redactURL(u *url.URL) string { } return u.String() } + +type NotPreferredError struct { + err error + safeToRetry bool +} + +func (e *NotPreferredError) Error() string { + return fmt.Sprintf("standby server not found: %s", e.err.Error()) +} + +func (e *NotPreferredError) SafeToRetry() bool { + return e.safeToRetry +} + +func (e *NotPreferredError) Unwrap() error { + return e.err +} diff --git a/vendor/github.com/jackc/pgconn/krb5.go b/vendor/github.com/jackc/pgconn/krb5.go new file mode 100644 index 000000000..08427b8e6 --- /dev/null +++ b/vendor/github.com/jackc/pgconn/krb5.go @@ -0,0 +1,99 @@ +package pgconn + +import ( + "errors" + "fmt" + + "github.com/jackc/pgproto3/v2" +) + +// NewGSSFunc creates a GSS authentication provider, for use with +// RegisterGSSProvider. +type NewGSSFunc func() (GSS, error) + +var newGSS NewGSSFunc + +// RegisterGSSProvider registers a GSS authentication provider. For example, if +// you need to use Kerberos to authenticate with your server, add this to your +// main package: +// +// import "github.com/otan/gopgkrb5" +// +// func init() { +// pgconn.RegisterGSSProvider(func() (pgconn.GSS, error) { return gopgkrb5.NewGSS() }) +// } +func RegisterGSSProvider(newGSSArg NewGSSFunc) { + newGSS = newGSSArg +} + +// GSS provides GSSAPI authentication (e.g., Kerberos). +type GSS interface { + GetInitToken(host string, service string) ([]byte, error) + GetInitTokenFromSPN(spn string) ([]byte, error) + Continue(inToken []byte) (done bool, outToken []byte, err error) +} + +func (c *PgConn) gssAuth() error { + if newGSS == nil { + return errors.New("kerberos error: no GSSAPI provider registered, see https://github.com/otan/gopgkrb5") + } + cli, err := newGSS() + if err != nil { + return err + } + + var nextData []byte + if c.config.KerberosSpn != "" { + // Use the supplied SPN if provided. + nextData, err = cli.GetInitTokenFromSPN(c.config.KerberosSpn) + } else { + // Allow the kerberos service name to be overridden + service := "postgres" + if c.config.KerberosSrvName != "" { + service = c.config.KerberosSrvName + } + nextData, err = cli.GetInitToken(c.config.Host, service) + } + if err != nil { + return err + } + + for { + gssResponse := &pgproto3.GSSResponse{ + Data: nextData, + } + _, err = c.conn.Write(gssResponse.Encode(nil)) + if err != nil { + return err + } + resp, err := c.rxGSSContinue() + if err != nil { + return err + } + var done bool + done, nextData, err = cli.Continue(resp.Data) + if err != nil { + return err + } + if done { + break + } + } + return nil +} + +func (c *PgConn) rxGSSContinue() (*pgproto3.AuthenticationGSSContinue, error) { + msg, err := c.receiveMessage() + if err != nil { + return nil, err + } + + switch m := msg.(type) { + case *pgproto3.AuthenticationGSSContinue: + return m, nil + case *pgproto3.ErrorResponse: + return nil, ErrorResponseToPgError(m) + } + + return nil, fmt.Errorf("expected AuthenticationGSSContinue message but received unexpected message %T", msg) +} diff --git a/vendor/github.com/jackc/pgconn/pgconn.go b/vendor/github.com/jackc/pgconn/pgconn.go index 7bf2f20ef..17f19e955 100644 --- a/vendor/github.com/jackc/pgconn/pgconn.go +++ b/vendor/github.com/jackc/pgconn/pgconn.go @@ -99,7 +99,7 @@ type PgConn struct { } // Connect establishes a connection to a PostgreSQL server using the environment and connString (in URL or DSN format) -// to provide configuration. See documention for ParseConfig for details. ctx can be used to cancel a connect attempt. +// to provide configuration. See documentation for ParseConfig for details. ctx can be used to cancel a connect attempt. func Connect(ctx context.Context, connString string) (*PgConn, error) { config, err := ParseConfig(connString) if err != nil { @@ -109,6 +109,18 @@ func Connect(ctx context.Context, connString string) (*PgConn, error) { return ConnectConfig(ctx, config) } +// Connect establishes a connection to a PostgreSQL server using the environment and connString (in URL or DSN format) +// and ParseConfigOptions to provide additional configuration. See documentation for ParseConfig for details. ctx can be +// used to cancel a connect attempt. +func ConnectWithOptions(ctx context.Context, connString string, parseConfigOptions ParseConfigOptions) (*PgConn, error) { + config, err := ParseConfigWithOptions(connString, parseConfigOptions) + if err != nil { + return nil, err + } + + return ConnectConfig(ctx, config) +} + // Connect establishes a connection to a PostgreSQL server using config. config must have been constructed with // ParseConfig. ctx can be used to cancel a connect attempt. // @@ -148,17 +160,36 @@ func ConnectConfig(ctx context.Context, config *Config) (pgConn *PgConn, err err return nil, &connectError{config: config, msg: "hostname resolving error", err: errors.New("ip addr wasn't found")} } + foundBestServer := false + var fallbackConfig *FallbackConfig for _, fc := range fallbackConfigs { - pgConn, err = connect(ctx, config, fc) + pgConn, err = connect(ctx, config, fc, false) if err == nil { + foundBestServer = true break } else if pgerr, ok := err.(*PgError); ok { err = &connectError{config: config, msg: "server error", err: pgerr} - ERRCODE_INVALID_PASSWORD := "28P01" // worng password - ERRCODE_INVALID_AUTHORIZATION_SPECIFICATION := "28000" // db does not exist - if pgerr.Code == ERRCODE_INVALID_PASSWORD || pgerr.Code == ERRCODE_INVALID_AUTHORIZATION_SPECIFICATION { + const ERRCODE_INVALID_PASSWORD = "28P01" // wrong password + const ERRCODE_INVALID_AUTHORIZATION_SPECIFICATION = "28000" // wrong password or bad pg_hba.conf settings + const ERRCODE_INVALID_CATALOG_NAME = "3D000" // db does not exist + const ERRCODE_INSUFFICIENT_PRIVILEGE = "42501" // missing connect privilege + if pgerr.Code == ERRCODE_INVALID_PASSWORD || + pgerr.Code == ERRCODE_INVALID_AUTHORIZATION_SPECIFICATION || + pgerr.Code == ERRCODE_INVALID_CATALOG_NAME || + pgerr.Code == ERRCODE_INSUFFICIENT_PRIVILEGE { break } + } else if cerr, ok := err.(*connectError); ok { + if _, ok := cerr.err.(*NotPreferredError); ok { + fallbackConfig = fc + } + } + } + + if !foundBestServer && fallbackConfig != nil { + pgConn, err = connect(ctx, config, fallbackConfig, true) + if pgerr, ok := err.(*PgError); ok { + err = &connectError{config: config, msg: "server error", err: pgerr} } } @@ -182,7 +213,7 @@ func expandWithIPs(ctx context.Context, lookupFn LookupFunc, fallbacks []*Fallba for _, fb := range fallbacks { // skip resolve for unix sockets - if strings.HasPrefix(fb.Host, "/") { + if isAbsolutePath(fb.Host) { configs = append(configs, &FallbackConfig{ Host: fb.Host, Port: fb.Port, @@ -222,7 +253,8 @@ func expandWithIPs(ctx context.Context, lookupFn LookupFunc, fallbacks []*Fallba return configs, nil } -func connect(ctx context.Context, config *Config, fallbackConfig *FallbackConfig) (*PgConn, error) { +func connect(ctx context.Context, config *Config, fallbackConfig *FallbackConfig, + ignoreNotPreferredErr bool) (*PgConn, error) { pgConn := new(PgConn) pgConn.config = config pgConn.wbuf = make([]byte, 0, wbufLen) @@ -317,7 +349,12 @@ func connect(ctx context.Context, config *Config, fallbackConfig *FallbackConfig pgConn.conn.Close() return nil, &connectError{config: config, msg: "failed SASL auth", err: err} } - + case *pgproto3.AuthenticationGSS: + err = pgConn.gssAuth() + if err != nil { + pgConn.conn.Close() + return nil, &connectError{config: config, msg: "failed GSS auth", err: err} + } case *pgproto3.ReadyForQuery: pgConn.status = connStatusIdle if config.ValidateConnect != nil { @@ -330,6 +367,9 @@ func connect(ctx context.Context, config *Config, fallbackConfig *FallbackConfig err := config.ValidateConnect(ctx, pgConn) if err != nil { + if _, ok := err.(*NotPreferredError); ignoreNotPreferredErr && ok { + return pgConn, nil + } pgConn.conn.Close() return nil, &connectError{config: config, msg: "ValidateConnect failed", err: err} } diff --git a/vendor/github.com/jackc/pgconn/stmtcache/lru.go b/vendor/github.com/jackc/pgconn/stmtcache/lru.go index 90fb76c2f..f0fb53b9c 100644 --- a/vendor/github.com/jackc/pgconn/stmtcache/lru.go +++ b/vendor/github.com/jackc/pgconn/stmtcache/lru.go @@ -102,10 +102,14 @@ func (c *LRU) StatementErrored(sql string, err error) { return } - isInvalidCachedPlanError := pgErr.Severity == "ERROR" && - pgErr.Code == "0A000" && - pgErr.Message == "cached plan must not change result type" - if isInvalidCachedPlanError { + // https://github.com/jackc/pgx/issues/1162 + // + // We used to look for the message "cached plan must not change result type". However, that message can be localized. + // Unfortunately, error code "0A000" - "FEATURE NOT SUPPORTED" is used for many different errors and the only way to + // tell the difference is by the message. But all that happens is we clear a statement that we otherwise wouldn't + // have so it should be safe. + possibleInvalidCachedPlanError := pgErr.Code == "0A000" + if possibleInvalidCachedPlanError { c.stmtsToClear = append(c.stmtsToClear, sql) } } diff --git a/vendor/github.com/jackc/pgproto3/v2/authentication_gss.go b/vendor/github.com/jackc/pgproto3/v2/authentication_gss.go new file mode 100644 index 000000000..5a3f3b1d5 --- /dev/null +++ b/vendor/github.com/jackc/pgproto3/v2/authentication_gss.go @@ -0,0 +1,58 @@ +package pgproto3 + +import ( + "encoding/binary" + "encoding/json" + "errors" + "github.com/jackc/pgio" +) + +type AuthenticationGSS struct{} + +func (a *AuthenticationGSS) Backend() {} + +func (a *AuthenticationGSS) AuthenticationResponse() {} + +func (a *AuthenticationGSS) Decode(src []byte) error { + if len(src) < 4 { + return errors.New("authentication message too short") + } + + authType := binary.BigEndian.Uint32(src) + + if authType != AuthTypeGSS { + return errors.New("bad auth type") + } + return nil +} + +func (a *AuthenticationGSS) Encode(dst []byte) []byte { + dst = append(dst, 'R') + dst = pgio.AppendInt32(dst, 4) + dst = pgio.AppendUint32(dst, AuthTypeGSS) + return dst +} + +func (a *AuthenticationGSS) MarshalJSON() ([]byte, error) { + return json.Marshal(struct { + Type string + Data []byte + }{ + Type: "AuthenticationGSS", + }) +} + +func (a *AuthenticationGSS) UnmarshalJSON(data []byte) error { + // Ignore null, like in the main JSON package. + if string(data) == "null" { + return nil + } + + var msg struct { + Type string + } + if err := json.Unmarshal(data, &msg); err != nil { + return err + } + return nil +} diff --git a/vendor/github.com/jackc/pgproto3/v2/authentication_gss_continue.go b/vendor/github.com/jackc/pgproto3/v2/authentication_gss_continue.go new file mode 100644 index 000000000..cf8b18345 --- /dev/null +++ b/vendor/github.com/jackc/pgproto3/v2/authentication_gss_continue.go @@ -0,0 +1,67 @@ +package pgproto3 + +import ( + "encoding/binary" + "encoding/json" + "errors" + "github.com/jackc/pgio" +) + +type AuthenticationGSSContinue struct { + Data []byte +} + +func (a *AuthenticationGSSContinue) Backend() {} + +func (a *AuthenticationGSSContinue) AuthenticationResponse() {} + +func (a *AuthenticationGSSContinue) Decode(src []byte) error { + if len(src) < 4 { + return errors.New("authentication message too short") + } + + authType := binary.BigEndian.Uint32(src) + + if authType != AuthTypeGSSCont { + return errors.New("bad auth type") + } + + a.Data = src[4:] + return nil +} + +func (a *AuthenticationGSSContinue) Encode(dst []byte) []byte { + dst = append(dst, 'R') + dst = pgio.AppendInt32(dst, int32(len(a.Data))+8) + dst = pgio.AppendUint32(dst, AuthTypeGSSCont) + dst = append(dst, a.Data...) + return dst +} + +func (a *AuthenticationGSSContinue) MarshalJSON() ([]byte, error) { + return json.Marshal(struct { + Type string + Data []byte + }{ + Type: "AuthenticationGSSContinue", + Data: a.Data, + }) +} + +func (a *AuthenticationGSSContinue) UnmarshalJSON(data []byte) error { + // Ignore null, like in the main JSON package. + if string(data) == "null" { + return nil + } + + var msg struct { + Type string + Data []byte + } + if err := json.Unmarshal(data, &msg); err != nil { + return err + } + + a.Data = msg.Data + return nil +} diff --git a/vendor/github.com/jackc/pgproto3/v2/backend.go b/vendor/github.com/jackc/pgproto3/v2/backend.go index 9c42ad02e..1f1436529 100644 --- a/vendor/github.com/jackc/pgproto3/v2/backend.go +++ b/vendor/github.com/jackc/pgproto3/v2/backend.go @@ -2,6 +2,7 @@ package pgproto3 import ( "encoding/binary" + "errors" "fmt" "io" ) @@ -30,11 +31,10 @@ type Backend struct { sync Sync terminate Terminate - bodyLen int - msgType byte - partialMsg bool - authType uint32 - + bodyLen int + msgType byte + partialMsg bool + authType uint32 } const ( @@ -115,6 +115,9 @@ func (b *Backend) Receive() (FrontendMessage, error) { b.msgType = header[0] b.bodyLen = int(binary.BigEndian.Uint32(header[1:])) - 4 b.partialMsg = true + if b.bodyLen < 0 { + return nil, errors.New("invalid message with negative body length received") + } } var msg FrontendMessage @@ -147,6 +150,8 @@ func (b *Backend) Receive() (FrontendMessage, error) { msg = &SASLResponse{} case AuthTypeSASLFinal: msg = &SASLResponse{} + case AuthTypeGSS, AuthTypeGSSCont: + msg = &GSSResponse{} case AuthTypeCleartextPassword, AuthTypeMD5Password: fallthrough default: diff --git a/vendor/github.com/jackc/pgproto3/v2/copy_both_response.go b/vendor/github.com/jackc/pgproto3/v2/copy_both_response.go index fbd985d86..4a1c3a07b 100644 --- a/vendor/github.com/jackc/pgproto3/v2/copy_both_response.go +++ b/vendor/github.com/jackc/pgproto3/v2/copy_both_response.go @@ -48,7 +48,7 @@ func (src *CopyBothResponse) Encode(dst []byte) []byte { dst = append(dst, 'W') sp := len(dst) dst = pgio.AppendInt32(dst, -1) - + dst = append(dst, src.OverallFormat) dst = pgio.AppendUint16(dst, uint16(len(src.ColumnFormatCodes))) for _, fc := range src.ColumnFormatCodes { dst = pgio.AppendUint16(dst, fc) diff --git a/vendor/github.com/jackc/pgproto3/v2/frontend.go b/vendor/github.com/jackc/pgproto3/v2/frontend.go index c33dfb084..5be8de808 100644 --- a/vendor/github.com/jackc/pgproto3/v2/frontend.go +++ b/vendor/github.com/jackc/pgproto3/v2/frontend.go @@ -16,6 +16,8 @@ type Frontend struct { authenticationOk AuthenticationOk authenticationCleartextPassword AuthenticationCleartextPassword authenticationMD5Password AuthenticationMD5Password + authenticationGSS AuthenticationGSS + authenticationGSSContinue AuthenticationGSSContinue authenticationSASL AuthenticationSASL authenticationSASLContinue AuthenticationSASLContinue authenticationSASLFinal AuthenticationSASLFinal @@ -77,6 +79,9 @@ func (f *Frontend) Receive() (BackendMessage, error) { f.msgType = header[0] f.bodyLen = int(binary.BigEndian.Uint32(header[1:])) - 4 f.partialMsg = true + if f.bodyLen < 0 { + return nil, errors.New("invalid message with negative body length received") + } } msgBody, err := f.cr.Next(f.bodyLen) @@ -178,9 +183,9 @@ func (f *Frontend) findAuthenticationMessageType(src []byte) (BackendMessage, er case AuthTypeSCMCreds: return nil, errors.New("AuthTypeSCMCreds is unimplemented") case AuthTypeGSS: - return nil, errors.New("AuthTypeGSS is unimplemented") + return &f.authenticationGSS, nil case AuthTypeGSSCont: - return nil, errors.New("AuthTypeGSSCont is unimplemented") + return &f.authenticationGSSContinue, nil case AuthTypeSSPI: return nil, errors.New("AuthTypeSSPI is unimplemented") case AuthTypeSASL: diff --git a/vendor/github.com/jackc/pgproto3/v2/gss_response.go b/vendor/github.com/jackc/pgproto3/v2/gss_response.go new file mode 100644 index 000000000..62da99c79 --- /dev/null +++ b/vendor/github.com/jackc/pgproto3/v2/gss_response.go @@ -0,0 +1,48 @@ +package pgproto3 + +import ( + "encoding/json" + "github.com/jackc/pgio" +) + +type GSSResponse struct { + Data []byte +} + +// Frontend identifies this message as sendable by a PostgreSQL frontend. +func (g *GSSResponse) Frontend() {} + +func (g *GSSResponse) Decode(data []byte) error { + g.Data = data + return nil +} + +func (g *GSSResponse) Encode(dst []byte) []byte { + dst = append(dst, 'p') + dst = pgio.AppendInt32(dst, int32(4+len(g.Data))) + dst = append(dst, g.Data...) + return dst +} + +// MarshalJSON implements encoding/json.Marshaler. +func (g *GSSResponse) MarshalJSON() ([]byte, error) { + return json.Marshal(struct { + Type string + Data []byte + }{ + Type: "GSSResponse", + Data: g.Data, + }) +} + +// UnmarshalJSON implements encoding/json.Unmarshaler. +func (g *GSSResponse) UnmarshalJSON(data []byte) error { + var msg struct { + Data []byte + } + if err := json.Unmarshal(data, &msg); err != nil { + return err + } + g.Data = msg.Data + return nil +} diff --git a/vendor/github.com/jackc/pgtype/CHANGELOG.md b/vendor/github.com/jackc/pgtype/CHANGELOG.md index 73126cf36..f0c037eff 100644 --- a/vendor/github.com/jackc/pgtype/CHANGELOG.md +++ b/vendor/github.com/jackc/pgtype/CHANGELOG.md @@ -1,3 +1,24 @@ +# 1.12.0 (August 6, 2022) + +* Add JSONArray (Jakob Ackermann) +* Support Inet from fmt.Stringer and encoding.TextMarshaler (Ville Skyttä) +* Support UUID from fmt.Stringer interface (Lasse Hyldahl Jensen) +* Fix: shopspring-numeric extension does not panic on NaN +* Numeric can be assigned to string +* Fix: Do not send IPv4 networks as IPv4-mapped IPv6 (William Storey) +* Fix: PlanScan for interface{}(nil) (James Hartig) +* Fix: *sql.Scanner for NULL handling (James Hartig) +* Timestamp[tz].Set() supports string (Harmen) +* Fix: Hstore AssignTo with map of *string (Diego Becciolini) + +# 1.11.0 (April 21, 2022) + +* Add multirange for numeric, int4, and int8 (Vu) +* JSONBArray now supports json.RawMessage (Jens Emil Schulz Østergaard) +* Add RecordArray (WGH) +* Add UnmarshalJSON to pgtype.Int2 +* Hstore.Set accepts map[string]Text + # 1.10.0 (February 7, 2022) * Normalize UTC timestamps to comply with stdlib (Torkel Rogstad) diff --git a/vendor/github.com/jackc/pgtype/array_type.go b/vendor/github.com/jackc/pgtype/array_type.go index 1bd0244b7..714665544 100644 --- a/vendor/github.com/jackc/pgtype/array_type.go +++ b/vendor/github.com/jackc/pgtype/array_type.go @@ -11,7 +11,7 @@ import ( // ArrayType represents an array type. While it implements Value, this is only in service of its type conversion duties // when registered as a data type in a ConnType. It should not be used directly as a Value. ArrayType is a convenience -// type for types that do not have an concrete array type. +// type for types that do not have a concrete array type. type ArrayType struct { elements []ValueTranscoder dimensions []ArrayDimension diff --git a/vendor/github.com/jackc/pgtype/date.go b/vendor/github.com/jackc/pgtype/date.go index e8d21a78c..ca84970ec 100644 --- a/vendor/github.com/jackc/pgtype/date.go +++ b/vendor/github.com/jackc/pgtype/date.go @@ -37,14 +37,14 @@ func (dst *Date) Set(src interface{}) error { switch value := src.(type) { case time.Time: *dst = Date{Time: value, Status: Present} - case string: - return dst.DecodeText(nil, []byte(value)) case *time.Time: if value == nil { *dst = Date{Status: Null} } else { return dst.Set(*value) } + case string: + return dst.DecodeText(nil, []byte(value)) case *string: if value == nil { *dst = Date{Status: Null} diff --git a/vendor/github.com/jackc/pgtype/enum_type.go b/vendor/github.com/jackc/pgtype/enum_type.go index d340320fa..526578226 100644 --- a/vendor/github.com/jackc/pgtype/enum_type.go +++ b/vendor/github.com/jackc/pgtype/enum_type.go @@ -2,7 +2,7 @@ package pgtype import "fmt" -// EnumType represents a enum type. While it implements Value, this is only in service of its type conversion duties +// EnumType represents an enum type. While it implements Value, this is only in service of its type conversion duties // when registered as a data type in a ConnType. It should not be used directly as a Value. type EnumType struct { value string diff --git a/vendor/github.com/jackc/pgtype/hstore.go b/vendor/github.com/jackc/pgtype/hstore.go index f46eeaf62..e42b75512 100644 --- a/vendor/github.com/jackc/pgtype/hstore.go +++ b/vendor/github.com/jackc/pgtype/hstore.go @@ -50,6 +50,8 @@ func (dst *Hstore) Set(src interface{}) error { } } *dst = Hstore{Map: m, Status: Present} + case map[string]Text: + *dst = Hstore{Map: value, Status: Present} default: return fmt.Errorf("cannot convert %v to Hstore", src) } @@ -88,7 +90,8 @@ func (src *Hstore) AssignTo(dst interface{}) error { case Null: (*v)[k] = nil case Present: - (*v)[k] = &val.String + str := val.String + (*v)[k] = &str default: return fmt.Errorf("cannot decode %#v into %T", src, dst) } @@ -411,7 +414,7 @@ func parseHstore(s string) (k []string, v []Text, err error) { r, end = p.Consume() switch { case end: - err = errors.New("Found EOS after ',', expcting space") + err = errors.New("Found EOS after ',', expecting space") case (unicode.IsSpace(r)): r, end = p.Consume() state = hsKey diff --git a/vendor/github.com/jackc/pgtype/inet.go b/vendor/github.com/jackc/pgtype/inet.go index f35f88bad..976f0d7b9 100644 --- a/vendor/github.com/jackc/pgtype/inet.go +++ b/vendor/github.com/jackc/pgtype/inet.go @@ -2,8 +2,10 @@ package pgtype import ( "database/sql/driver" + "encoding" "fmt" "net" + "strings" ) // Network address family is dependent on server socket.h value for AF_INET. @@ -47,17 +49,26 @@ func (dst *Inet) Set(src interface{}) error { case string: ip, ipnet, err := net.ParseCIDR(value) if err != nil { - ip = net.ParseIP(value) + ip := net.ParseIP(value) if ip == nil { return fmt.Errorf("unable to parse inet address: %s", value) } - ipnet = &net.IPNet{IP: ip, Mask: net.CIDRMask(128, 128)} - if ipv4 := ip.To4(); ipv4 != nil { - ip = ipv4 - ipnet.Mask = net.CIDRMask(32, 32) + + if ipv4 := maybeGetIPv4(value, ip); ipv4 != nil { + ipnet = &net.IPNet{IP: ipv4, Mask: net.CIDRMask(32, 32)} + } else { + ipnet = &net.IPNet{IP: ip, Mask: net.CIDRMask(128, 128)} + } + } else { + ipnet.IP = ip + if ipv4 := maybeGetIPv4(value, ipnet.IP); ipv4 != nil { + ipnet.IP = ipv4 + if len(ipnet.Mask) == 16 { + ipnet.Mask = ipnet.Mask[12:] // Not sure this is ever needed. + } } } - ipnet.IP = ip + *dst = Inet{IPNet: ipnet, Status: Present} case *net.IPNet: if value == nil { @@ -78,6 +89,16 @@ func (dst *Inet) Set(src interface{}) error { return dst.Set(*value) } default: + if tv, ok := src.(encoding.TextMarshaler); ok { + text, err := tv.MarshalText() + if err != nil { + return fmt.Errorf("cannot marshal %v: %w", value, err) + } + return dst.Set(string(text)) + } + if sv, ok := src.(fmt.Stringer); ok { + return dst.Set(sv.String()) + } if originalSrc, ok := underlyingPtrType(src); ok { return dst.Set(originalSrc) } @@ -87,6 +108,25 @@ func (dst *Inet) Set(src interface{}) error { return nil } +// Convert the net.IP to IPv4, if appropriate. +// +// When parsing a string to a net.IP using net.ParseIP() and the like, we get a +// 16 byte slice for IPv4 addresses as well as IPv6 addresses. This function +// calls To4() to convert them to a 4 byte slice. This is useful as it allows +// users of the net.IP check for IPv4 addresses based on the length and makes +// it clear we are handling IPv4 as opposed to IPv6 or IPv4-mapped IPv6 +// addresses. +func maybeGetIPv4(input string, ip net.IP) net.IP { + // Do not do this if the provided input looks like IPv6. This is because + // To4() on IPv4-mapped IPv6 addresses converts them to IPv4, which behave + // different in some cases. + if strings.Contains(input, ":") { + return nil + } + + return ip.To4() +} + func (dst Inet) Get() interface{} { switch dst.Status { case Present: @@ -118,6 +158,12 @@ func (src *Inet) AssignTo(dst interface{}) error { copy(*v, src.IPNet.IP) return nil default: + if tv, ok := dst.(encoding.TextUnmarshaler); ok { + if err := tv.UnmarshalText([]byte(src.IPNet.String())); err != nil { + return fmt.Errorf("cannot unmarshal %v to %T: %w", src, dst, err) + } + return nil + } if nextDst, retry := GetAssignToDstType(dst); retry { return src.AssignTo(nextDst) } @@ -169,7 +215,7 @@ func (dst *Inet) DecodeBinary(ci *ConnInfo, src []byte) error { } if len(src) != 8 && len(src) != 20 { - return fmt.Errorf("Received an invalid size for a inet: %d", len(src)) + return fmt.Errorf("Received an invalid size for an inet: %d", len(src)) } // ignore family diff --git a/vendor/github.com/jackc/pgtype/int2.go b/vendor/github.com/jackc/pgtype/int2.go index 3eb5aeb55..0775882ab 100644 --- a/vendor/github.com/jackc/pgtype/int2.go +++ b/vendor/github.com/jackc/pgtype/int2.go @@ -3,6 +3,7 @@ package pgtype import ( "database/sql/driver" "encoding/binary" + "encoding/json" "fmt" "math" "strconv" @@ -302,3 +303,19 @@ func (src Int2) MarshalJSON() ([]byte, error) { return nil, errBadStatus } + +func (dst *Int2) UnmarshalJSON(b []byte) error { + var n *int16 + err := json.Unmarshal(b, &n) + if err != nil { + return err + } + + if n == nil { + *dst = Int2{Status: Null} + } else { + *dst = Int2{Int: *n, Status: Present} + } + + return nil +} diff --git a/vendor/github.com/jackc/pgtype/int4_multirange.go b/vendor/github.com/jackc/pgtype/int4_multirange.go new file mode 100644 index 000000000..c3432ce63 --- /dev/null +++ b/vendor/github.com/jackc/pgtype/int4_multirange.go @@ -0,0 +1,239 @@ +package pgtype + +import ( + "database/sql/driver" + "encoding/binary" + "fmt" + + "github.com/jackc/pgio" +) + +type Int4multirange struct { + Ranges []Int4range + Status Status +} + +func (dst *Int4multirange) Set(src interface{}) error { + //untyped nil and typed nil interfaces are different + if src == nil { + *dst = Int4multirange{Status: Null} + return nil + } + + switch value := src.(type) { + case Int4multirange: + *dst = value + case *Int4multirange: + *dst = *value + case string: + return dst.DecodeText(nil, []byte(value)) + case []Int4range: + if value == nil { + *dst = Int4multirange{Status: Null} + } else if len(value) == 0 { + *dst = Int4multirange{Status: Present} + } else { + elements := make([]Int4range, len(value)) + for i := range value { + if err := elements[i].Set(value[i]); err != nil { + return err + } + } + *dst = Int4multirange{ + Ranges: elements, + Status: Present, + } + } + case []*Int4range: + if value == nil { + *dst = Int4multirange{Status: Null} + } else if len(value) == 0 { + *dst = Int4multirange{Status: Present} + } else { + elements := make([]Int4range, len(value)) + for i := range value { + if err := elements[i].Set(value[i]); err != nil { + return err + } + } + *dst = Int4multirange{ + Ranges: elements, + Status: Present, + } + } + default: + return fmt.Errorf("cannot convert %v to Int4multirange", src) + } + + return nil + +} + +func (dst Int4multirange) Get() interface{} { + switch dst.Status { + case Present: + return dst + case Null: + return nil + default: + return dst.Status + } +} + +func (src *Int4multirange) AssignTo(dst interface{}) error { + return fmt.Errorf("cannot assign %v to %T", src, dst) +} + +func (dst *Int4multirange) DecodeText(ci *ConnInfo, src []byte) error { + if src == nil { + *dst = Int4multirange{Status: Null} + return nil + } + + utmr, err := ParseUntypedTextMultirange(string(src)) + if err != nil { + return err + } + + var elements []Int4range + + if len(utmr.Elements) > 0 { + elements = make([]Int4range, len(utmr.Elements)) + + for i, s := range utmr.Elements { + var elem Int4range + + elemSrc := []byte(s) + + err = elem.DecodeText(ci, elemSrc) + if err != nil { + return err + } + + elements[i] = elem + } + } + + *dst = Int4multirange{Ranges: elements, Status: Present} + + return nil +} + +func (dst *Int4multirange) DecodeBinary(ci *ConnInfo, src []byte) error { + if src == nil { + *dst = Int4multirange{Status: Null} + return nil + } + + rp := 0 + + numElems := int(binary.BigEndian.Uint32(src[rp:])) + rp += 4 + + if numElems == 0 { + *dst = Int4multirange{Status: Present} + return nil + } + + elements := make([]Int4range, numElems) + + for i := range elements { + elemLen := int(int32(binary.BigEndian.Uint32(src[rp:]))) + rp += 4 + var elemSrc []byte + if elemLen >= 0 { + elemSrc = src[rp : rp+elemLen] + rp += elemLen + } + err := elements[i].DecodeBinary(ci, elemSrc) + if err != nil { + return err + } + } + + *dst = Int4multirange{Ranges: elements, Status: Present} + return nil +} + +func (src Int4multirange) EncodeText(ci *ConnInfo, buf []byte) ([]byte, error) { + switch src.Status { + case Null: + return nil, nil + case Undefined: + return nil, errUndefined + } + + buf = append(buf, '{') + + inElemBuf := make([]byte, 0, 32) + for i, elem := range src.Ranges { + if i > 0 { + buf = append(buf, ',') + } + + elemBuf, err := elem.EncodeText(ci, inElemBuf) + if err != nil { + return nil, err + } + if elemBuf == nil { + return nil, fmt.Errorf("multi-range does not allow null range") + } else { + buf = append(buf, string(elemBuf)...) + } + + } + + buf = append(buf, '}') + + return buf, nil +} + +func (src Int4multirange) EncodeBinary(ci *ConnInfo, buf []byte) ([]byte, error) { + switch src.Status { + case Null: + return nil, nil + case Undefined: + return nil, errUndefined + } + + buf = pgio.AppendInt32(buf, int32(len(src.Ranges))) + + for i := range src.Ranges { + sp := len(buf) + buf = pgio.AppendInt32(buf, -1) + + elemBuf, err := src.Ranges[i].EncodeBinary(ci, buf) + if err != nil { + return nil, err + } + if elemBuf != nil { + buf = elemBuf + pgio.SetInt32(buf[sp:], int32(len(buf[sp:])-4)) + } + } + + return buf, nil +} + +// Scan implements the database/sql Scanner interface. +func (dst *Int4multirange) Scan(src interface{}) error { + if src == nil { + return dst.DecodeText(nil, nil) + } + + switch src := src.(type) { + case string: + return dst.DecodeText(nil, []byte(src)) + case []byte: + srcCopy := make([]byte, len(src)) + copy(srcCopy, src) + return dst.DecodeText(nil, srcCopy) + } + + return fmt.Errorf("cannot scan %T", src) +} + +// Value implements the database/sql/driver Valuer interface. +func (src Int4multirange) Value() (driver.Value, error) { + return EncodeValueText(src) +} diff --git a/vendor/github.com/jackc/pgtype/int8_multirange.go b/vendor/github.com/jackc/pgtype/int8_multirange.go new file mode 100644 index 000000000..e0976427a --- /dev/null +++ b/vendor/github.com/jackc/pgtype/int8_multirange.go @@ -0,0 +1,239 @@ +package pgtype + +import ( + "database/sql/driver" + "encoding/binary" + "fmt" + + "github.com/jackc/pgio" +) + +type Int8multirange struct { + Ranges []Int8range + Status Status +} + +func (dst *Int8multirange) Set(src interface{}) error { + //untyped nil and typed nil interfaces are different + if src == nil { + *dst = Int8multirange{Status: Null} + return nil + } + + switch value := src.(type) { + case Int8multirange: + *dst = value + case *Int8multirange: + *dst = *value + case string: + return dst.DecodeText(nil, []byte(value)) + case []Int8range: + if value == nil { + *dst = Int8multirange{Status: Null} + } else if len(value) == 0 { + *dst = Int8multirange{Status: Present} + } else { + elements := make([]Int8range, len(value)) + for i := range value { + if err := elements[i].Set(value[i]); err != nil { + return err + } + } + *dst = Int8multirange{ + Ranges: elements, + Status: Present, + } + } + case []*Int8range: + if value == nil { + *dst = Int8multirange{Status: Null} + } else if len(value) == 0 { + *dst = Int8multirange{Status: Present} + } else { + elements := make([]Int8range, len(value)) + for i := range value { + if err := elements[i].Set(value[i]); err != nil { + return err + } + } + *dst = Int8multirange{ + Ranges: elements, + Status: Present, + } + } + default: + return fmt.Errorf("cannot convert %v to Int8multirange", src) + } + + return nil + +} + +func (dst Int8multirange) Get() interface{} { + switch dst.Status { + case Present: + return dst + case Null: + return nil + default: + return dst.Status + } +} + +func (src *Int8multirange) AssignTo(dst interface{}) error { + return fmt.Errorf("cannot assign %v to %T", src, dst) +} + +func (dst *Int8multirange) DecodeText(ci *ConnInfo, src []byte) error { + if src == nil { + *dst = Int8multirange{Status: Null} + return nil + } + + utmr, err := ParseUntypedTextMultirange(string(src)) + if err != nil { + return err + } + + var elements []Int8range + + if len(utmr.Elements) > 0 { + elements = make([]Int8range, len(utmr.Elements)) + + for i, s := range utmr.Elements { + var elem Int8range + + elemSrc := []byte(s) + + err = elem.DecodeText(ci, elemSrc) + if err != nil { + return err + } + + elements[i] = elem + } + } + + *dst = Int8multirange{Ranges: elements, Status: Present} + + return nil +} + +func (dst *Int8multirange) DecodeBinary(ci *ConnInfo, src []byte) error { + if src == nil { + *dst = Int8multirange{Status: Null} + return nil + } + + rp := 0 + + numElems := int(binary.BigEndian.Uint32(src[rp:])) + rp += 4 + + if numElems == 0 { + *dst = Int8multirange{Status: Present} + return nil + } + + elements := make([]Int8range, numElems) + + for i := range elements { + elemLen := int(int32(binary.BigEndian.Uint32(src[rp:]))) + rp += 4 + var elemSrc []byte + if elemLen >= 0 { + elemSrc = src[rp : rp+elemLen] + rp += elemLen + } + err := elements[i].DecodeBinary(ci, elemSrc) + if err != nil { + return err + } + } + + *dst = Int8multirange{Ranges: elements, Status: Present} + return nil +} + +func (src Int8multirange) EncodeText(ci *ConnInfo, buf []byte) ([]byte, error) { + switch src.Status { + case Null: + return nil, nil + case Undefined: + return nil, errUndefined + } + + buf = append(buf, '{') + + inElemBuf := make([]byte, 0, 32) + for i, elem := range src.Ranges { + if i > 0 { + buf = append(buf, ',') + } + + elemBuf, err := elem.EncodeText(ci, inElemBuf) + if err != nil { + return nil, err + } + if elemBuf == nil { + return nil, fmt.Errorf("multi-range does not allow null range") + } else { + buf = append(buf, string(elemBuf)...) + } + + } + + buf = append(buf, '}') + + return buf, nil +} + +func (src Int8multirange) EncodeBinary(ci *ConnInfo, buf []byte) ([]byte, error) { + switch src.Status { + case Null: + return nil, nil + case Undefined: + return nil, errUndefined + } + + buf = pgio.AppendInt32(buf, int32(len(src.Ranges))) + + for i := range src.Ranges { + sp := len(buf) + buf = pgio.AppendInt32(buf, -1) + + elemBuf, err := src.Ranges[i].EncodeBinary(ci, buf) + if err != nil { + return nil, err + } + if elemBuf != nil { + buf = elemBuf + pgio.SetInt32(buf[sp:], int32(len(buf[sp:])-4)) + } + } + + return buf, nil +} + +// Scan implements the database/sql Scanner interface. +func (dst *Int8multirange) Scan(src interface{}) error { + if src == nil { + return dst.DecodeText(nil, nil) + } + + switch src := src.(type) { + case string: + return dst.DecodeText(nil, []byte(src)) + case []byte: + srcCopy := make([]byte, len(src)) + copy(srcCopy, src) + return dst.DecodeText(nil, srcCopy) + } + + return fmt.Errorf("cannot scan %T", src) +} + +// Value implements the database/sql/driver Valuer interface. +func (src Int8multirange) Value() (driver.Value, error) { + return EncodeValueText(src) +} diff --git a/vendor/github.com/jackc/pgtype/interval.go b/vendor/github.com/jackc/pgtype/interval.go index b01fbb7cb..00ec47c53 100644 --- a/vendor/github.com/jackc/pgtype/interval.go +++ b/vendor/github.com/jackc/pgtype/interval.go @@ -174,7 +174,7 @@ func (dst *Interval) DecodeBinary(ci *ConnInfo, src []byte) error { } if len(src) != 16 { - return fmt.Errorf("Received an invalid size for a interval: %d", len(src)) + return fmt.Errorf("Received an invalid size for an interval: %d", len(src)) } microseconds := int64(binary.BigEndian.Uint64(src)) diff --git a/vendor/github.com/jackc/pgtype/json_array.go b/vendor/github.com/jackc/pgtype/json_array.go new file mode 100644 index 000000000..8d68882f0 --- /dev/null +++ b/vendor/github.com/jackc/pgtype/json_array.go @@ -0,0 +1,546 @@ +// Code generated by erb. DO NOT EDIT. + +package pgtype + +import ( + "database/sql/driver" + "encoding/binary" + "encoding/json" + "fmt" + "reflect" + + "github.com/jackc/pgio" +) + +type JSONArray struct { + Elements []JSON + Dimensions []ArrayDimension + Status Status +} + +func (dst *JSONArray) Set(src interface{}) error { + // untyped nil and typed nil interfaces are different + if src == nil { + *dst = JSONArray{Status: Null} + return nil + } + + if value, ok := src.(interface{ Get() interface{} }); ok { + value2 := value.Get() + if value2 != value { + return dst.Set(value2) + } + } + + // Attempt to match to select common types: + switch value := src.(type) { + + case []string: + if value == nil { + *dst = JSONArray{Status: Null} + } else if len(value) == 0 { + *dst = JSONArray{Status: Present} + } else { + elements := make([]JSON, len(value)) + for i := range value { + if err := elements[i].Set(value[i]); err != nil { + return err + } + } + *dst = JSONArray{ + Elements: elements, + Dimensions: []ArrayDimension{{Length: int32(len(elements)), LowerBound: 1}}, + Status: Present, + } + } + + case [][]byte: + if value == nil { + *dst = JSONArray{Status: Null} + } else if len(value) == 0 { + *dst = JSONArray{Status: Present} + } else { + elements := make([]JSON, len(value)) + for i := range value { + if err := elements[i].Set(value[i]); err != nil { + return err + } + } + *dst = JSONArray{ + Elements: elements, + Dimensions: []ArrayDimension{{Length: int32(len(elements)), LowerBound: 1}}, + Status: Present, + } + } + + case []json.RawMessage: + if value == nil { + *dst = JSONArray{Status: Null} + } else if len(value) == 0 { + *dst = JSONArray{Status: Present} + } else { + elements := make([]JSON, len(value)) + for i := range value { + if err := elements[i].Set(value[i]); err != nil { + return err + } + } + *dst = JSONArray{ + Elements: elements, + Dimensions: []ArrayDimension{{Length: int32(len(elements)), LowerBound: 1}}, + Status: Present, + } + } + + case []JSON: + if value == nil { + *dst = JSONArray{Status: Null} + } else if len(value) == 0 { + *dst = JSONArray{Status: Present} + } else { + *dst = JSONArray{ + Elements: value, + Dimensions: []ArrayDimension{{Length: int32(len(value)), LowerBound: 1}}, + Status: Present, + } + } + default: + // Fallback to reflection if an optimised match was not found. + // The reflection is necessary for arrays and multidimensional slices, + // but it comes with a 20-50% performance penalty for large arrays/slices + reflectedValue := reflect.ValueOf(src) + if !reflectedValue.IsValid() || reflectedValue.IsZero() { + *dst = JSONArray{Status: Null} + return nil + } + + dimensions, elementsLength, ok := findDimensionsFromValue(reflectedValue, nil, 0) + if !ok { + return fmt.Errorf("cannot find dimensions of %v for JSONArray", src) + } + if elementsLength == 0 { + *dst = JSONArray{Status: Present} + return nil + } + if len(dimensions) == 0 { + if originalSrc, ok := underlyingSliceType(src); ok { + return dst.Set(originalSrc) + } + return fmt.Errorf("cannot convert %v to JSONArray", src) + } + + *dst = JSONArray{ + Elements: make([]JSON, elementsLength), + Dimensions: dimensions, + Status: Present, + } + elementCount, err := dst.setRecursive(reflectedValue, 0, 0) + if err != nil { + // Maybe the target was one dimension too far, try again: + if len(dst.Dimensions) > 1 { + dst.Dimensions = dst.Dimensions[:len(dst.Dimensions)-1] + elementsLength = 0 + for _, dim := range dst.Dimensions { + if elementsLength == 0 { + elementsLength = int(dim.Length) + } else { + elementsLength *= int(dim.Length) + } + } + dst.Elements = make([]JSON, elementsLength) + elementCount, err = dst.setRecursive(reflectedValue, 0, 0) + if err != nil { + return err + } + } else { + return err + } + } + if elementCount != len(dst.Elements) { + return fmt.Errorf("cannot convert %v to JSONArray, expected %d dst.Elements, but got %d instead", src, len(dst.Elements), elementCount) + } + } + + return nil +} + +func (dst *JSONArray) setRecursive(value reflect.Value, index, dimension int) (int, error) { + switch value.Kind() { + case reflect.Array: + fallthrough + case reflect.Slice: + if len(dst.Dimensions) == dimension { + break + } + + valueLen := value.Len() + if int32(valueLen) != dst.Dimensions[dimension].Length { + return 0, fmt.Errorf("multidimensional arrays must have array expressions with matching dimensions") + } + for i := 0; i < valueLen; i++ { + var err error + index, err = dst.setRecursive(value.Index(i), index, dimension+1) + if err != nil { + return 0, err + } + } + + return index, nil + } + if !value.CanInterface() { + return 0, fmt.Errorf("cannot convert all values to JSONArray") + } + if err := dst.Elements[index].Set(value.Interface()); err != nil { + return 0, fmt.Errorf("%v in JSONArray", err) + } + index++ + + return index, nil +} + +func (dst JSONArray) Get() interface{} { + switch dst.Status { + case Present: + return dst + case Null: + return nil + default: + return dst.Status + } +} + +func (src *JSONArray) AssignTo(dst interface{}) error { + switch src.Status { + case Present: + if len(src.Dimensions) <= 1 { + // Attempt to match to select common types: + switch v := dst.(type) { + + case *[]string: + *v = make([]string, len(src.Elements)) + for i := range src.Elements { + if err := src.Elements[i].AssignTo(&((*v)[i])); err != nil { + return err + } + } + return nil + + case *[][]byte: + *v = make([][]byte, len(src.Elements)) + for i := range src.Elements { + if err := src.Elements[i].AssignTo(&((*v)[i])); err != nil { + return err + } + } + return nil + + case *[]json.RawMessage: + *v = make([]json.RawMessage, len(src.Elements)) + for i := range src.Elements { + if err := src.Elements[i].AssignTo(&((*v)[i])); err != nil { + return err + } + } + return nil + + } + } + + // Try to convert to something AssignTo can use directly. + if nextDst, retry := GetAssignToDstType(dst); retry { + return src.AssignTo(nextDst) + } + + // Fallback to reflection if an optimised match was not found. + // The reflection is necessary for arrays and multidimensional slices, + // but it comes with a 20-50% performance penalty for large arrays/slices + value := reflect.ValueOf(dst) + if value.Kind() == reflect.Ptr { + value = value.Elem() + } + + switch value.Kind() { + case reflect.Array, reflect.Slice: + default: + return fmt.Errorf("cannot assign %T to %T", src, dst) + } + + if len(src.Elements) == 0 { + if value.Kind() == reflect.Slice { + value.Set(reflect.MakeSlice(value.Type(), 0, 0)) + return nil + } + } + + elementCount, err := src.assignToRecursive(value, 0, 0) + if err != nil { + return err + } + if elementCount != len(src.Elements) { + return fmt.Errorf("cannot assign %v, needed to assign %d elements, but only assigned %d", dst, len(src.Elements), elementCount) + } + + return nil + case Null: + return NullAssignTo(dst) + } + + return fmt.Errorf("cannot decode %#v into %T", src, dst) +} + +func (src *JSONArray) assignToRecursive(value reflect.Value, index, dimension int) (int, error) { + switch kind := value.Kind(); kind { + case reflect.Array: + fallthrough + case reflect.Slice: + if len(src.Dimensions) == dimension { + break + } + + length := int(src.Dimensions[dimension].Length) + if reflect.Array == kind { + typ := value.Type() + if typ.Len() != length { + return 0, fmt.Errorf("expected size %d array, but %s has size %d array", length, typ, typ.Len()) + } + value.Set(reflect.New(typ).Elem()) + } else { + value.Set(reflect.MakeSlice(value.Type(), length, length)) + } + + var err error + for i := 0; i < length; i++ { + index, err = src.assignToRecursive(value.Index(i), index, dimension+1) + if err != nil { + return 0, err + } + } + + return index, nil + } + if len(src.Dimensions) != dimension { + return 0, fmt.Errorf("incorrect dimensions, expected %d, found %d", len(src.Dimensions), dimension) + } + if !value.CanAddr() { + return 0, fmt.Errorf("cannot assign all values from JSONArray") + } + addr := value.Addr() + if !addr.CanInterface() { + return 0, fmt.Errorf("cannot assign all values from JSONArray") + } + if err := src.Elements[index].AssignTo(addr.Interface()); err != nil { + return 0, err + } + index++ + return index, nil +} + +func (dst *JSONArray) DecodeText(ci *ConnInfo, src []byte) error { + if src == nil { + *dst = JSONArray{Status: Null} + return nil + } + + uta, err := ParseUntypedTextArray(string(src)) + if err != nil { + return err + } + + var elements []JSON + + if len(uta.Elements) > 0 { + elements = make([]JSON, len(uta.Elements)) + + for i, s := range uta.Elements { + var elem JSON + var elemSrc []byte + if s != "NULL" || uta.Quoted[i] { + elemSrc = []byte(s) + } + err = elem.DecodeText(ci, elemSrc) + if err != nil { + return err + } + + elements[i] = elem + } + } + + *dst = JSONArray{Elements: elements, Dimensions: uta.Dimensions, Status: Present} + + return nil +} + +func (dst *JSONArray) DecodeBinary(ci *ConnInfo, src []byte) error { + if src == nil { + *dst = JSONArray{Status: Null} + return nil + } + + var arrayHeader ArrayHeader + rp, err := arrayHeader.DecodeBinary(ci, src) + if err != nil { + return err + } + + if len(arrayHeader.Dimensions) == 0 { + *dst = JSONArray{Dimensions: arrayHeader.Dimensions, Status: Present} + return nil + } + + elementCount := arrayHeader.Dimensions[0].Length + for _, d := range arrayHeader.Dimensions[1:] { + elementCount *= d.Length + } + + elements := make([]JSON, elementCount) + + for i := range elements { + elemLen := int(int32(binary.BigEndian.Uint32(src[rp:]))) + rp += 4 + var elemSrc []byte + if elemLen >= 0 { + elemSrc = src[rp : rp+elemLen] + rp += elemLen + } + err = elements[i].DecodeBinary(ci, elemSrc) + if err != nil { + return err + } + } + + *dst = JSONArray{Elements: elements, Dimensions: arrayHeader.Dimensions, Status: Present} + return nil +} + +func (src JSONArray) EncodeText(ci *ConnInfo, buf []byte) ([]byte, error) { + switch src.Status { + case Null: + return nil, nil + case Undefined: + return nil, errUndefined + } + + if len(src.Dimensions) == 0 { + return append(buf, '{', '}'), nil + } + + buf = EncodeTextArrayDimensions(buf, src.Dimensions) + + // dimElemCounts is the multiples of elements that each array lies on. For + // example, a single dimension array of length 4 would have a dimElemCounts of + // [4]. A multi-dimensional array of lengths [3,5,2] would have a + // dimElemCounts of [30,10,2]. This is used to simplify when to render a '{' + // or '}'. + dimElemCounts := make([]int, len(src.Dimensions)) + dimElemCounts[len(src.Dimensions)-1] = int(src.Dimensions[len(src.Dimensions)-1].Length) + for i := len(src.Dimensions) - 2; i > -1; i-- { + dimElemCounts[i] = int(src.Dimensions[i].Length) * dimElemCounts[i+1] + } + + inElemBuf := make([]byte, 0, 32) + for i, elem := range src.Elements { + if i > 0 { + buf = append(buf, ',') + } + + for _, dec := range dimElemCounts { + if i%dec == 0 { + buf = append(buf, '{') + } + } + + elemBuf, err := elem.EncodeText(ci, inElemBuf) + if err != nil { + return nil, err + } + if elemBuf == nil { + buf = append(buf, `NULL`...) + } else { + buf = append(buf, QuoteArrayElementIfNeeded(string(elemBuf))...) + } + + for _, dec := range dimElemCounts { + if (i+1)%dec == 0 { + buf = append(buf, '}') + } + } + } + + return buf, nil +} + +func (src JSONArray) EncodeBinary(ci *ConnInfo, buf []byte) ([]byte, error) { + switch src.Status { + case Null: + return nil, nil + case Undefined: + return nil, errUndefined + } + + arrayHeader := ArrayHeader{ + Dimensions: src.Dimensions, + } + + if dt, ok := ci.DataTypeForName("json"); ok { + arrayHeader.ElementOID = int32(dt.OID) + } else { + return nil, fmt.Errorf("unable to find oid for type name %v", "json") + } + + for i := range src.Elements { + if src.Elements[i].Status == Null { + arrayHeader.ContainsNull = true + break + } + } + + buf = arrayHeader.EncodeBinary(ci, buf) + + for i := range src.Elements { + sp := len(buf) + buf = pgio.AppendInt32(buf, -1) + + elemBuf, err := src.Elements[i].EncodeBinary(ci, buf) + if err != nil { + return nil, err + } + if elemBuf != nil { + buf = elemBuf + pgio.SetInt32(buf[sp:], int32(len(buf[sp:])-4)) + } + } + + return buf, nil +} + +// Scan implements the database/sql Scanner interface. +func (dst *JSONArray) Scan(src interface{}) error { + if src == nil { + return dst.DecodeText(nil, nil) + } + + switch src := src.(type) { + case string: + return dst.DecodeText(nil, []byte(src)) + case []byte: + srcCopy := make([]byte, len(src)) + copy(srcCopy, src) + return dst.DecodeText(nil, srcCopy) + } + + return fmt.Errorf("cannot scan %T", src) +} + +// Value implements the database/sql/driver Valuer interface. +func (src JSONArray) Value() (driver.Value, error) { + buf, err := src.EncodeText(nil, nil) + if err != nil { + return nil, err + } + if buf == nil { + return nil, nil + } + + return string(buf), nil +} diff --git a/vendor/github.com/jackc/pgtype/jsonb_array.go b/vendor/github.com/jackc/pgtype/jsonb_array.go index c4b7cd3d8..e78ad3776 100644 --- a/vendor/github.com/jackc/pgtype/jsonb_array.go +++ b/vendor/github.com/jackc/pgtype/jsonb_array.go @@ -5,6 +5,7 @@ package pgtype import ( "database/sql/driver" "encoding/binary" + "encoding/json" "fmt" "reflect" @@ -72,6 +73,25 @@ func (dst *JSONBArray) Set(src interface{}) error { } } + case []json.RawMessage: + if value == nil { + *dst = JSONBArray{Status: Null} + } else if len(value) == 0 { + *dst = JSONBArray{Status: Present} + } else { + elements := make([]JSONB, len(value)) + for i := range value { + if err := elements[i].Set(value[i]); err != nil { + return err + } + } + *dst = JSONBArray{ + Elements: elements, + Dimensions: []ArrayDimension{{Length: int32(len(elements)), LowerBound: 1}}, + Status: Present, + } + } + case []JSONB: if value == nil { *dst = JSONBArray{Status: Null} @@ -214,6 +234,15 @@ func (src *JSONBArray) AssignTo(dst interface{}) error { } return nil + case *[]json.RawMessage: + *v = make([]json.RawMessage, len(src.Elements)) + for i := range src.Elements { + if err := src.Elements[i].AssignTo(&((*v)[i])); err != nil { + return err + } + } + return nil + } } diff --git a/vendor/github.com/jackc/pgtype/multirange.go b/vendor/github.com/jackc/pgtype/multirange.go new file mode 100644 index 000000000..beb11f702 --- /dev/null +++ b/vendor/github.com/jackc/pgtype/multirange.go @@ -0,0 +1,83 @@ +package pgtype + +import ( + "bytes" + "fmt" +) + +type UntypedTextMultirange struct { + Elements []string +} + +func ParseUntypedTextMultirange(src string) (*UntypedTextMultirange, error) { + utmr := &UntypedTextMultirange{} + utmr.Elements = make([]string, 0) + + buf := bytes.NewBufferString(src) + + skipWhitespace(buf) + + r, _, err := buf.ReadRune() + if err != nil { + return nil, fmt.Errorf("invalid array: %v", err) + } + + if r != '{' { + return nil, fmt.Errorf("invalid multirange, expected '{': %v", err) + } + +parseValueLoop: + for { + r, _, err = buf.ReadRune() + if err != nil { + return nil, fmt.Errorf("invalid multirange: %v", err) + } + + switch r { + case ',': // skip range separator + case '}': + break parseValueLoop + default: + buf.UnreadRune() + value, err := parseRange(buf) + if err != nil { + return nil, fmt.Errorf("invalid multirange value: %v", err) + } + utmr.Elements = append(utmr.Elements, value) + } + } + + skipWhitespace(buf) + + if buf.Len() > 0 { + return nil, fmt.Errorf("unexpected trailing data: %v", buf.String()) + } + + return utmr, nil + +} + +func parseRange(buf *bytes.Buffer) (string, error) { + + s := &bytes.Buffer{} + + boundSepRead := false + for { + r, _, err := buf.ReadRune() + if err != nil { + return "", err + } + + switch r { + case ',', '}': + if r == ',' && !boundSepRead { + boundSepRead = true + break + } + buf.UnreadRune() + return s.String(), nil + } + + s.WriteRune(r) + } +} diff --git a/vendor/github.com/jackc/pgtype/num_multirange.go b/vendor/github.com/jackc/pgtype/num_multirange.go new file mode 100644 index 000000000..cbabc8acb --- /dev/null +++ b/vendor/github.com/jackc/pgtype/num_multirange.go @@ -0,0 +1,239 @@ +package pgtype + +import ( + "database/sql/driver" + "encoding/binary" + "fmt" + + "github.com/jackc/pgio" +) + +type Nummultirange struct { + Ranges []Numrange + Status Status +} + +func (dst *Nummultirange) Set(src interface{}) error { + //untyped nil and typed nil interfaces are different + if src == nil { + *dst = Nummultirange{Status: Null} + return nil + } + + switch value := src.(type) { + case Nummultirange: + *dst = value + case *Nummultirange: + *dst = *value + case string: + return dst.DecodeText(nil, []byte(value)) + case []Numrange: + if value == nil { + *dst = Nummultirange{Status: Null} + } else if len(value) == 0 { + *dst = Nummultirange{Status: Present} + } else { + elements := make([]Numrange, len(value)) + for i := range value { + if err := elements[i].Set(value[i]); err != nil { + return err + } + } + *dst = Nummultirange{ + Ranges: elements, + Status: Present, + } + } + case []*Numrange: + if value == nil { + *dst = Nummultirange{Status: Null} + } else if len(value) == 0 { + *dst = Nummultirange{Status: Present} + } else { + elements := make([]Numrange, len(value)) + for i := range value { + if err := elements[i].Set(value[i]); err != nil { + return err + } + } + *dst = Nummultirange{ + Ranges: elements, + Status: Present, + } + } + default: + return fmt.Errorf("cannot convert %v to Nummultirange", src) + } + + return nil + +} + +func (dst Nummultirange) Get() interface{} { + switch dst.Status { + case Present: + return dst + case Null: + return nil + default: + return dst.Status + } +} + +func (src *Nummultirange) AssignTo(dst interface{}) error { + return fmt.Errorf("cannot assign %v to %T", src, dst) +} + +func (dst *Nummultirange) DecodeText(ci *ConnInfo, src []byte) error { + if src == nil { + *dst = Nummultirange{Status: Null} + return nil + } + + utmr, err := ParseUntypedTextMultirange(string(src)) + if err != nil { + return err + } + + var elements []Numrange + + if len(utmr.Elements) > 0 { + elements = make([]Numrange, len(utmr.Elements)) + + for i, s := range utmr.Elements { + var elem Numrange + + elemSrc := []byte(s) + + err = elem.DecodeText(ci, elemSrc) + if err != nil { + return err + } + + elements[i] = elem + } + } + + *dst = Nummultirange{Ranges: elements, Status: Present} + + return nil +} + +func (dst *Nummultirange) DecodeBinary(ci *ConnInfo, src []byte) error { + if src == nil { + *dst = Nummultirange{Status: Null} + return nil + } + + rp := 0 + + numElems := int(binary.BigEndian.Uint32(src[rp:])) + rp += 4 + + if numElems == 0 { + *dst = Nummultirange{Status: Present} + return nil + } + + elements := make([]Numrange, numElems) + + for i := range elements { + elemLen := int(int32(binary.BigEndian.Uint32(src[rp:]))) + rp += 4 + var elemSrc []byte + if elemLen >= 0 { + elemSrc = src[rp : rp+elemLen] + rp += elemLen + } + err := elements[i].DecodeBinary(ci, elemSrc) + if err != nil { + return err + } + } + + *dst = Nummultirange{Ranges: elements, Status: Present} + return nil +} + +func (src Nummultirange) EncodeText(ci *ConnInfo, buf []byte) ([]byte, error) { + switch src.Status { + case Null: + return nil, nil + case Undefined: + return nil, errUndefined + } + + buf = append(buf, '{') + + inElemBuf := make([]byte, 0, 32) + for i, elem := range src.Ranges { + if i > 0 { + buf = append(buf, ',') + } + + elemBuf, err := elem.EncodeText(ci, inElemBuf) + if err != nil { + return nil, err + } + if elemBuf == nil { + return nil, fmt.Errorf("multi-range does not allow null range") + } else { + buf = append(buf, string(elemBuf)...) + } + + } + + buf = append(buf, '}') + + return buf, nil +} + +func (src Nummultirange) EncodeBinary(ci *ConnInfo, buf []byte) ([]byte, error) { + switch src.Status { + case Null: + return nil, nil + case Undefined: + return nil, errUndefined + } + + buf = pgio.AppendInt32(buf, int32(len(src.Ranges))) + + for i := range src.Ranges { + sp := len(buf) + buf = pgio.AppendInt32(buf, -1) + + elemBuf, err := src.Ranges[i].EncodeBinary(ci, buf) + if err != nil { + return nil, err + } + if elemBuf != nil { + buf = elemBuf + pgio.SetInt32(buf[sp:], int32(len(buf[sp:])-4)) + } + } + + return buf, nil +} + +// Scan implements the database/sql Scanner interface. +func (dst *Nummultirange) Scan(src interface{}) error { + if src == nil { + return dst.DecodeText(nil, nil) + } + + switch src := src.(type) { + case string: + return dst.DecodeText(nil, []byte(src)) + case []byte: + srcCopy := make([]byte, len(src)) + copy(srcCopy, src) + return dst.DecodeText(nil, srcCopy) + } + + return fmt.Errorf("cannot scan %T", src) +} + +// Value implements the database/sql/driver Valuer interface. +func (src Nummultirange) Value() (driver.Value, error) { + return EncodeValueText(src) +} diff --git a/vendor/github.com/jackc/pgtype/numeric.go b/vendor/github.com/jackc/pgtype/numeric.go index cd057749e..1f32b36b4 100644 --- a/vendor/github.com/jackc/pgtype/numeric.go +++ b/vendor/github.com/jackc/pgtype/numeric.go @@ -1,6 +1,7 @@ package pgtype import ( + "bytes" "database/sql/driver" "encoding/binary" "fmt" @@ -375,6 +376,12 @@ func (src *Numeric) AssignTo(dst interface{}) error { return err } v.Set(rat) + case *string: + buf, err := encodeNumericText(*src, nil) + if err != nil { + return err + } + *v = string(buf) default: if nextDst, retry := GetAssignToDstType(dst); retry { return src.AssignTo(nextDst) @@ -792,3 +799,55 @@ func (src Numeric) Value() (driver.Value, error) { return nil, errUndefined } } + +func encodeNumericText(n Numeric, buf []byte) (newBuf []byte, err error) { + // if !n.Valid { + // return nil, nil + // } + + if n.NaN { + buf = append(buf, "NaN"...) + return buf, nil + } else if n.InfinityModifier == Infinity { + buf = append(buf, "Infinity"...) + return buf, nil + } else if n.InfinityModifier == NegativeInfinity { + buf = append(buf, "-Infinity"...) + return buf, nil + } + + buf = append(buf, n.numberTextBytes()...) + + return buf, nil +} + +// numberString returns a string of the number. undefined if NaN, infinite, or NULL +func (n Numeric) numberTextBytes() []byte { + intStr := n.Int.String() + buf := &bytes.Buffer{} + exp := int(n.Exp) + if exp > 0 { + buf.WriteString(intStr) + for i := 0; i < exp; i++ { + buf.WriteByte('0') + } + } else if exp < 0 { + if len(intStr) <= -exp { + buf.WriteString("0.") + leadingZeros := -exp - len(intStr) + for i := 0; i < leadingZeros; i++ { + buf.WriteByte('0') + } + buf.WriteString(intStr) + } else if len(intStr) > -exp { + dpPos := len(intStr) + exp + buf.WriteString(intStr[:dpPos]) + buf.WriteByte('.') + buf.WriteString(intStr[dpPos:]) + } + } else { + buf.WriteString(intStr) + } + + return buf.Bytes() +} diff --git a/vendor/github.com/jackc/pgtype/pgtype.go b/vendor/github.com/jackc/pgtype/pgtype.go index 200fb5626..addfc66fc 100644 --- a/vendor/github.com/jackc/pgtype/pgtype.go +++ b/vendor/github.com/jackc/pgtype/pgtype.go @@ -26,6 +26,7 @@ const ( XIDOID = 28 CIDOID = 29 JSONOID = 114 + JSONArrayOID = 199 PointOID = 600 LsegOID = 601 PathOID = 602 @@ -74,12 +75,15 @@ const ( JSONBArrayOID = 3807 DaterangeOID = 3912 Int4rangeOID = 3904 + Int4multirangeOID = 4451 NumrangeOID = 3906 + NummultirangeOID = 4532 TsrangeOID = 3908 TsrangeArrayOID = 3909 TstzrangeOID = 3910 TstzrangeArrayOID = 3911 Int8rangeOID = 3926 + Int8multirangeOID = 4536 ) type Status byte @@ -288,10 +292,13 @@ func NewConnInfo() *ConnInfo { ci.RegisterDataType(DataType{Value: &Int2{}, Name: "int2", OID: Int2OID}) ci.RegisterDataType(DataType{Value: &Int4{}, Name: "int4", OID: Int4OID}) ci.RegisterDataType(DataType{Value: &Int4range{}, Name: "int4range", OID: Int4rangeOID}) + ci.RegisterDataType(DataType{Value: &Int4multirange{}, Name: "int4multirange", OID: Int4multirangeOID}) ci.RegisterDataType(DataType{Value: &Int8{}, Name: "int8", OID: Int8OID}) ci.RegisterDataType(DataType{Value: &Int8range{}, Name: "int8range", OID: Int8rangeOID}) + ci.RegisterDataType(DataType{Value: &Int8multirange{}, Name: "int8multirange", OID: Int8multirangeOID}) ci.RegisterDataType(DataType{Value: &Interval{}, Name: "interval", OID: IntervalOID}) ci.RegisterDataType(DataType{Value: &JSON{}, Name: "json", OID: JSONOID}) + ci.RegisterDataType(DataType{Value: &JSONArray{}, Name: "_json", OID: JSONArrayOID}) ci.RegisterDataType(DataType{Value: &JSONB{}, Name: "jsonb", OID: JSONBOID}) ci.RegisterDataType(DataType{Value: &JSONBArray{}, Name: "_jsonb", OID: JSONBArrayOID}) ci.RegisterDataType(DataType{Value: &Line{}, Name: "line", OID: LineOID}) @@ -300,6 +307,7 @@ func NewConnInfo() *ConnInfo { ci.RegisterDataType(DataType{Value: &Name{}, Name: "name", OID: NameOID}) ci.RegisterDataType(DataType{Value: &Numeric{}, Name: "numeric", OID: NumericOID}) ci.RegisterDataType(DataType{Value: &Numrange{}, Name: "numrange", OID: NumrangeOID}) + ci.RegisterDataType(DataType{Value: &Nummultirange{}, Name: "nummultirange", OID: NummultirangeOID}) ci.RegisterDataType(DataType{Value: &OIDValue{}, Name: "oid", OID: OIDOID}) ci.RegisterDataType(DataType{Value: &Path{}, Name: "path", OID: PathOID}) ci.RegisterDataType(DataType{Value: &Point{}, Name: "point", OID: PointOID}) @@ -527,8 +535,22 @@ type scanPlanDataTypeSQLScanner DataType func (plan *scanPlanDataTypeSQLScanner) Scan(ci *ConnInfo, oid uint32, formatCode int16, src []byte, dst interface{}) error { scanner, ok := dst.(sql.Scanner) if !ok { - newPlan := ci.PlanScan(oid, formatCode, dst) - return newPlan.Scan(ci, oid, formatCode, src, dst) + dv := reflect.ValueOf(dst) + if dv.Kind() != reflect.Ptr || !dv.Type().Elem().Implements(scannerType) { + newPlan := ci.PlanScan(oid, formatCode, dst) + return newPlan.Scan(ci, oid, formatCode, src, dst) + } + if src == nil { + // Ensure the pointer points to a zero version of the value + dv.Elem().Set(reflect.Zero(dv.Type().Elem())) + return nil + } + dv = dv.Elem() + // If the pointer is to a nil pointer then set that before scanning + if dv.Kind() == reflect.Ptr && dv.IsNil() { + dv.Set(reflect.New(dv.Type().Elem())) + } + scanner = dv.Interface().(sql.Scanner) } dt := (*DataType)(plan) @@ -587,7 +609,25 @@ func (plan *scanPlanDataTypeAssignTo) Scan(ci *ConnInfo, oid uint32, formatCode type scanPlanSQLScanner struct{} func (scanPlanSQLScanner) Scan(ci *ConnInfo, oid uint32, formatCode int16, src []byte, dst interface{}) error { - scanner := dst.(sql.Scanner) + scanner, ok := dst.(sql.Scanner) + if !ok { + dv := reflect.ValueOf(dst) + if dv.Kind() != reflect.Ptr || !dv.Type().Elem().Implements(scannerType) { + newPlan := ci.PlanScan(oid, formatCode, dst) + return newPlan.Scan(ci, oid, formatCode, src, dst) + } + if src == nil { + // Ensure the pointer points to a zero version of the value + dv.Elem().Set(reflect.Zero(dv.Type())) + return nil + } + dv = dv.Elem() + // If the pointer is to a nil pointer then set that before scanning + if dv.Kind() == reflect.Ptr && dv.IsNil() { + dv.Set(reflect.New(dv.Type().Elem())) + } + scanner = dv.Interface().(sql.Scanner) + } if src == nil { // This is necessary because interface value []byte:nil does not equal nil:nil for the binary format path and the // text format path would be converted to empty string. @@ -755,6 +795,18 @@ func (scanPlanString) Scan(ci *ConnInfo, oid uint32, formatCode int16, src []byt return newPlan.Scan(ci, oid, formatCode, src, dst) } +var scannerType = reflect.TypeOf((*sql.Scanner)(nil)).Elem() + +func isScanner(dst interface{}) bool { + if _, ok := dst.(sql.Scanner); ok { + return true + } + if t := reflect.TypeOf(dst); t != nil && t.Kind() == reflect.Ptr && t.Elem().Implements(scannerType) { + return true + } + return false +} + // PlanScan prepares a plan to scan a value into dst. func (ci *ConnInfo) PlanScan(oid uint32, formatCode int16, dst interface{}) ScanPlan { switch formatCode { @@ -819,13 +871,13 @@ func (ci *ConnInfo) PlanScan(oid uint32, formatCode int16, dst interface{}) Scan } if dt != nil { - if _, ok := dst.(sql.Scanner); ok { + if isScanner(dst) { return (*scanPlanDataTypeSQLScanner)(dt) } return (*scanPlanDataTypeAssignTo)(dt) } - if _, ok := dst.(sql.Scanner); ok { + if isScanner(dst) { return scanPlanSQLScanner{} } @@ -873,72 +925,76 @@ var nameValues map[string]Value func init() { nameValues = map[string]Value{ - "_aclitem": &ACLItemArray{}, - "_bool": &BoolArray{}, - "_bpchar": &BPCharArray{}, - "_bytea": &ByteaArray{}, - "_cidr": &CIDRArray{}, - "_date": &DateArray{}, - "_float4": &Float4Array{}, - "_float8": &Float8Array{}, - "_inet": &InetArray{}, - "_int2": &Int2Array{}, - "_int4": &Int4Array{}, - "_int8": &Int8Array{}, - "_numeric": &NumericArray{}, - "_text": &TextArray{}, - "_timestamp": &TimestampArray{}, - "_timestamptz": &TimestamptzArray{}, - "_uuid": &UUIDArray{}, - "_varchar": &VarcharArray{}, - "_jsonb": &JSONBArray{}, - "aclitem": &ACLItem{}, - "bit": &Bit{}, - "bool": &Bool{}, - "box": &Box{}, - "bpchar": &BPChar{}, - "bytea": &Bytea{}, - "char": &QChar{}, - "cid": &CID{}, - "cidr": &CIDR{}, - "circle": &Circle{}, - "date": &Date{}, - "daterange": &Daterange{}, - "float4": &Float4{}, - "float8": &Float8{}, - "hstore": &Hstore{}, - "inet": &Inet{}, - "int2": &Int2{}, - "int4": &Int4{}, - "int4range": &Int4range{}, - "int8": &Int8{}, - "int8range": &Int8range{}, - "interval": &Interval{}, - "json": &JSON{}, - "jsonb": &JSONB{}, - "line": &Line{}, - "lseg": &Lseg{}, - "macaddr": &Macaddr{}, - "name": &Name{}, - "numeric": &Numeric{}, - "numrange": &Numrange{}, - "oid": &OIDValue{}, - "path": &Path{}, - "point": &Point{}, - "polygon": &Polygon{}, - "record": &Record{}, - "text": &Text{}, - "tid": &TID{}, - "timestamp": &Timestamp{}, - "timestamptz": &Timestamptz{}, - "tsrange": &Tsrange{}, - "_tsrange": &TsrangeArray{}, - "tstzrange": &Tstzrange{}, - "_tstzrange": &TstzrangeArray{}, - "unknown": &Unknown{}, - "uuid": &UUID{}, - "varbit": &Varbit{}, - "varchar": &Varchar{}, - "xid": &XID{}, + "_aclitem": &ACLItemArray{}, + "_bool": &BoolArray{}, + "_bpchar": &BPCharArray{}, + "_bytea": &ByteaArray{}, + "_cidr": &CIDRArray{}, + "_date": &DateArray{}, + "_float4": &Float4Array{}, + "_float8": &Float8Array{}, + "_inet": &InetArray{}, + "_int2": &Int2Array{}, + "_int4": &Int4Array{}, + "_int8": &Int8Array{}, + "_numeric": &NumericArray{}, + "_text": &TextArray{}, + "_timestamp": &TimestampArray{}, + "_timestamptz": &TimestamptzArray{}, + "_uuid": &UUIDArray{}, + "_varchar": &VarcharArray{}, + "_json": &JSONArray{}, + "_jsonb": &JSONBArray{}, + "aclitem": &ACLItem{}, + "bit": &Bit{}, + "bool": &Bool{}, + "box": &Box{}, + "bpchar": &BPChar{}, + "bytea": &Bytea{}, + "char": &QChar{}, + "cid": &CID{}, + "cidr": &CIDR{}, + "circle": &Circle{}, + "date": &Date{}, + "daterange": &Daterange{}, + "float4": &Float4{}, + "float8": &Float8{}, + "hstore": &Hstore{}, + "inet": &Inet{}, + "int2": &Int2{}, + "int4": &Int4{}, + "int4range": &Int4range{}, + "int4multirange": &Int4multirange{}, + "int8": &Int8{}, + "int8range": &Int8range{}, + "int8multirange": &Int8multirange{}, + "interval": &Interval{}, + "json": &JSON{}, + "jsonb": &JSONB{}, + "line": &Line{}, + "lseg": &Lseg{}, + "macaddr": &Macaddr{}, + "name": &Name{}, + "numeric": &Numeric{}, + "numrange": &Numrange{}, + "nummultirange": &Nummultirange{}, + "oid": &OIDValue{}, + "path": &Path{}, + "point": &Point{}, + "polygon": &Polygon{}, + "record": &Record{}, + "text": &Text{}, + "tid": &TID{}, + "timestamp": &Timestamp{}, + "timestamptz": &Timestamptz{}, + "tsrange": &Tsrange{}, + "_tsrange": &TsrangeArray{}, + "tstzrange": &Tstzrange{}, + "_tstzrange": &TstzrangeArray{}, + "unknown": &Unknown{}, + "uuid": &UUID{}, + "varbit": &Varbit{}, + "varchar": &Varchar{}, + "xid": &XID{}, } } diff --git a/vendor/github.com/jackc/pgtype/record.go b/vendor/github.com/jackc/pgtype/record.go index 718c35702..5cf2c93ab 100644 --- a/vendor/github.com/jackc/pgtype/record.go +++ b/vendor/github.com/jackc/pgtype/record.go @@ -6,7 +6,7 @@ import ( ) // Record is the generic PostgreSQL record type such as is created with the -// "row" function. Record only implements BinaryEncoder and Value. The text +// "row" function. Record only implements BinaryDecoder and Value. The text // format output format from PostgreSQL does not include type information and is // therefore impossible to decode. No encoders are implemented because // PostgreSQL does not support input of generic records. diff --git a/vendor/github.com/jackc/pgtype/record_array.go b/vendor/github.com/jackc/pgtype/record_array.go new file mode 100644 index 000000000..2271717a5 --- /dev/null +++ b/vendor/github.com/jackc/pgtype/record_array.go @@ -0,0 +1,318 @@ +// Code generated by erb. DO NOT EDIT. + +package pgtype + +import ( + "encoding/binary" + "fmt" + "reflect" +) + +type RecordArray struct { + Elements []Record + Dimensions []ArrayDimension + Status Status +} + +func (dst *RecordArray) Set(src interface{}) error { + // untyped nil and typed nil interfaces are different + if src == nil { + *dst = RecordArray{Status: Null} + return nil + } + + if value, ok := src.(interface{ Get() interface{} }); ok { + value2 := value.Get() + if value2 != value { + return dst.Set(value2) + } + } + + // Attempt to match to select common types: + switch value := src.(type) { + + case [][]Value: + if value == nil { + *dst = RecordArray{Status: Null} + } else if len(value) == 0 { + *dst = RecordArray{Status: Present} + } else { + elements := make([]Record, len(value)) + for i := range value { + if err := elements[i].Set(value[i]); err != nil { + return err + } + } + *dst = RecordArray{ + Elements: elements, + Dimensions: []ArrayDimension{{Length: int32(len(elements)), LowerBound: 1}}, + Status: Present, + } + } + + case []Record: + if value == nil { + *dst = RecordArray{Status: Null} + } else if len(value) == 0 { + *dst = RecordArray{Status: Present} + } else { + *dst = RecordArray{ + Elements: value, + Dimensions: []ArrayDimension{{Length: int32(len(value)), LowerBound: 1}}, + Status: Present, + } + } + default: + // Fallback to reflection if an optimised match was not found. + // The reflection is necessary for arrays and multidimensional slices, + // but it comes with a 20-50% performance penalty for large arrays/slices + reflectedValue := reflect.ValueOf(src) + if !reflectedValue.IsValid() || reflectedValue.IsZero() { + *dst = RecordArray{Status: Null} + return nil + } + + dimensions, elementsLength, ok := findDimensionsFromValue(reflectedValue, nil, 0) + if !ok { + return fmt.Errorf("cannot find dimensions of %v for RecordArray", src) + } + if elementsLength == 0 { + *dst = RecordArray{Status: Present} + return nil + } + if len(dimensions) == 0 { + if originalSrc, ok := underlyingSliceType(src); ok { + return dst.Set(originalSrc) + } + return fmt.Errorf("cannot convert %v to RecordArray", src) + } + + *dst = RecordArray{ + Elements: make([]Record, elementsLength), + Dimensions: dimensions, + Status: Present, + } + elementCount, err := dst.setRecursive(reflectedValue, 0, 0) + if err != nil { + // Maybe the target was one dimension too far, try again: + if len(dst.Dimensions) > 1 { + dst.Dimensions = dst.Dimensions[:len(dst.Dimensions)-1] + elementsLength = 0 + for _, dim := range dst.Dimensions { + if elementsLength == 0 { + elementsLength = int(dim.Length) + } else { + elementsLength *= int(dim.Length) + } + } + dst.Elements = make([]Record, elementsLength) + elementCount, err = dst.setRecursive(reflectedValue, 0, 0) + if err != nil { + return err + } + } else { + return err + } + } + if elementCount != len(dst.Elements) { + return fmt.Errorf("cannot convert %v to RecordArray, expected %d dst.Elements, but got %d instead", src, len(dst.Elements), elementCount) + } + } + + return nil +} + +func (dst *RecordArray) setRecursive(value reflect.Value, index, dimension int) (int, error) { + switch value.Kind() { + case reflect.Array: + fallthrough + case reflect.Slice: + if len(dst.Dimensions) == dimension { + break + } + + valueLen := value.Len() + if int32(valueLen) != dst.Dimensions[dimension].Length { + return 0, fmt.Errorf("multidimensional arrays must have array expressions with matching dimensions") + } + for i := 0; i < valueLen; i++ { + var err error + index, err = dst.setRecursive(value.Index(i), index, dimension+1) + if err != nil { + return 0, err + } + } + + return index, nil + } + if !value.CanInterface() { + return 0, fmt.Errorf("cannot convert all values to RecordArray") + } + if err := dst.Elements[index].Set(value.Interface()); err != nil { + return 0, fmt.Errorf("%v in RecordArray", err) + } + index++ + + return index, nil +} + +func (dst RecordArray) Get() interface{} { + switch dst.Status { + case Present: + return dst + case Null: + return nil + default: + return dst.Status + } +} + +func (src *RecordArray) AssignTo(dst interface{}) error { + switch src.Status { + case Present: + if len(src.Dimensions) <= 1 { + // Attempt to match to select common types: + switch v := dst.(type) { + + case *[][]Value: + *v = make([][]Value, len(src.Elements)) + for i := range src.Elements { + if err := src.Elements[i].AssignTo(&((*v)[i])); err != nil { + return err + } + } + return nil + + } + } + + // Try to convert to something AssignTo can use directly. + if nextDst, retry := GetAssignToDstType(dst); retry { + return src.AssignTo(nextDst) + } + + // Fallback to reflection if an optimised match was not found. + // The reflection is necessary for arrays and multidimensional slices, + // but it comes with a 20-50% performance penalty for large arrays/slices + value := reflect.ValueOf(dst) + if value.Kind() == reflect.Ptr { + value = value.Elem() + } + + switch value.Kind() { + case reflect.Array, reflect.Slice: + default: + return fmt.Errorf("cannot assign %T to %T", src, dst) + } + + if len(src.Elements) == 0 { + if value.Kind() == reflect.Slice { + value.Set(reflect.MakeSlice(value.Type(), 0, 0)) + return nil + } + } + + elementCount, err := src.assignToRecursive(value, 0, 0) + if err != nil { + return err + } + if elementCount != len(src.Elements) { + return fmt.Errorf("cannot assign %v, needed to assign %d elements, but only assigned %d", dst, len(src.Elements), elementCount) + } + + return nil + case Null: + return NullAssignTo(dst) + } + + return fmt.Errorf("cannot decode %#v into %T", src, dst) +} + +func (src *RecordArray) assignToRecursive(value reflect.Value, index, dimension int) (int, error) { + switch kind := value.Kind(); kind { + case reflect.Array: + fallthrough + case reflect.Slice: + if len(src.Dimensions) == dimension { + break + } + + length := int(src.Dimensions[dimension].Length) + if reflect.Array == kind { + typ := value.Type() + if typ.Len() != length { + return 0, fmt.Errorf("expected size %d array, but %s has size %d array", length, typ, typ.Len()) + } + value.Set(reflect.New(typ).Elem()) + } else { + value.Set(reflect.MakeSlice(value.Type(), length, length)) + } + + var err error + for i := 0; i < length; i++ { + index, err = src.assignToRecursive(value.Index(i), index, dimension+1) + if err != nil { + return 0, err + } + } + + return index, nil + } + if len(src.Dimensions) != dimension { + return 0, fmt.Errorf("incorrect dimensions, expected %d, found %d", len(src.Dimensions), dimension) + } + if !value.CanAddr() { + return 0, fmt.Errorf("cannot assign all values from RecordArray") + } + addr := value.Addr() + if !addr.CanInterface() { + return 0, fmt.Errorf("cannot assign all values from RecordArray") + } + if err := src.Elements[index].AssignTo(addr.Interface()); err != nil { + return 0, err + } + index++ + return index, nil +} + +func (dst *RecordArray) DecodeBinary(ci *ConnInfo, src []byte) error { + if src == nil { + *dst = RecordArray{Status: Null} + return nil + } + + var arrayHeader ArrayHeader + rp, err := arrayHeader.DecodeBinary(ci, src) + if err != nil { + return err + } + + if len(arrayHeader.Dimensions) == 0 { + *dst = RecordArray{Dimensions: arrayHeader.Dimensions, Status: Present} + return nil + } + + elementCount := arrayHeader.Dimensions[0].Length + for _, d := range arrayHeader.Dimensions[1:] { + elementCount *= d.Length + } + + elements := make([]Record, elementCount) + + for i := range elements { + elemLen := int(int32(binary.BigEndian.Uint32(src[rp:]))) + rp += 4 + var elemSrc []byte + if elemLen >= 0 { + elemSrc = src[rp : rp+elemLen] + rp += elemLen + } + err = elements[i].DecodeBinary(ci, elemSrc) + if err != nil { + return err + } + } + + *dst = RecordArray{Elements: elements, Dimensions: arrayHeader.Dimensions, Status: Present} + return nil +} diff --git a/vendor/github.com/jackc/pgtype/timestamp.go b/vendor/github.com/jackc/pgtype/timestamp.go index 5517acb19..e043726d7 100644 --- a/vendor/github.com/jackc/pgtype/timestamp.go +++ b/vendor/github.com/jackc/pgtype/timestamp.go @@ -46,6 +46,14 @@ func (dst *Timestamp) Set(src interface{}) error { } else { return dst.Set(*value) } + case string: + return dst.DecodeText(nil, []byte(value)) + case *string: + if value == nil { + *dst = Timestamp{Status: Null} + } else { + return dst.Set(*value) + } case InfinityModifier: *dst = Timestamp{InfinityModifier: value, Status: Present} default: diff --git a/vendor/github.com/jackc/pgtype/timestamptz.go b/vendor/github.com/jackc/pgtype/timestamptz.go index 587019705..72ae4991d 100644 --- a/vendor/github.com/jackc/pgtype/timestamptz.go +++ b/vendor/github.com/jackc/pgtype/timestamptz.go @@ -48,6 +48,14 @@ func (dst *Timestamptz) Set(src interface{}) error { } else { return dst.Set(*value) } + case string: + return dst.DecodeText(nil, []byte(value)) + case *string: + if value == nil { + *dst = Timestamptz{Status: Null} + } else { + return dst.Set(*value) + } case InfinityModifier: *dst = Timestamptz{InfinityModifier: value, Status: Present} default: diff --git a/vendor/github.com/jackc/pgtype/typed_array.go.erb b/vendor/github.com/jackc/pgtype/typed_array.go.erb index 5788626b4..e8433c043 100644 --- a/vendor/github.com/jackc/pgtype/typed_array.go.erb +++ b/vendor/github.com/jackc/pgtype/typed_array.go.erb @@ -1,5 +1,17 @@ // Code generated by erb. DO NOT EDIT. +<% + # defaults when not explicitly set on command line + + binary_format ||= "true" + text_format ||= "true" + + text_null ||= "NULL" + + encode_binary ||= binary_format + decode_binary ||= binary_format +%> + package pgtype import ( @@ -279,6 +291,7 @@ func (src *<%= pgtype_array_type %>) assignToRecursive(value reflect.Value, inde return index, nil } +<% if text_format == "true" %> func (dst *<%= pgtype_array_type %>) DecodeText(ci *ConnInfo, src []byte) error { if src == nil { *dst = <%= pgtype_array_type %>{Status: Null} @@ -314,8 +327,9 @@ func (dst *<%= pgtype_array_type %>) DecodeText(ci *ConnInfo, src []byte) error return nil } +<% end %> -<% if binary_format == "true" %> +<% if decode_binary == "true" %> func (dst *<%= pgtype_array_type %>) DecodeBinary(ci *ConnInfo, src []byte) error { if src == nil { *dst = <%= pgtype_array_type %>{Status: Null} @@ -359,6 +373,7 @@ func (dst *<%= pgtype_array_type %>) DecodeBinary(ci *ConnInfo, src []byte) erro } <% end %> +<% if text_format == "true" %> func (src <%= pgtype_array_type %>) EncodeText(ci *ConnInfo, buf []byte) ([]byte, error) { switch src.Status { case Null: @@ -415,8 +430,9 @@ func (src <%= pgtype_array_type %>) EncodeText(ci *ConnInfo, buf []byte) ([]byte return buf, nil } +<% end %> -<% if binary_format == "true" %> +<% if encode_binary == "true" %> func (src <%= pgtype_array_type %>) EncodeBinary(ci *ConnInfo, buf []byte) ([]byte, error) { switch src.Status { case Null: @@ -462,6 +478,7 @@ func (src <%= pgtype_array_type %>) EncodeText(ci *ConnInfo, buf []byte) ([]byte } <% end %> +<% if text_format == "true" %> // Scan implements the database/sql Scanner interface. func (dst *<%= pgtype_array_type %>) Scan(src interface{}) error { if src == nil { @@ -492,3 +509,4 @@ func (src <%= pgtype_array_type %>) Value() (driver.Value, error) { return string(buf), nil } +<% end %> diff --git a/vendor/github.com/jackc/pgtype/typed_array_gen.sh b/vendor/github.com/jackc/pgtype/typed_array_gen.sh index ea28be077..9ec768bf1 100644 --- a/vendor/github.com/jackc/pgtype/typed_array_gen.sh +++ b/vendor/github.com/jackc/pgtype/typed_array_gen.sh @@ -1,28 +1,31 @@ -erb pgtype_array_type=Int2Array pgtype_element_type=Int2 go_array_types=[]int16,[]*int16,[]uint16,[]*uint16,[]int32,[]*int32,[]uint32,[]*uint32,[]int64,[]*int64,[]uint64,[]*uint64,[]int,[]*int,[]uint,[]*uint element_type_name=int2 text_null=NULL binary_format=true typed_array.go.erb > int2_array.go -erb pgtype_array_type=Int4Array pgtype_element_type=Int4 go_array_types=[]int16,[]*int16,[]uint16,[]*uint16,[]int32,[]*int32,[]uint32,[]*uint32,[]int64,[]*int64,[]uint64,[]*uint64,[]int,[]*int,[]uint,[]*uint element_type_name=int4 text_null=NULL binary_format=true typed_array.go.erb > int4_array.go -erb pgtype_array_type=Int8Array pgtype_element_type=Int8 go_array_types=[]int16,[]*int16,[]uint16,[]*uint16,[]int32,[]*int32,[]uint32,[]*uint32,[]int64,[]*int64,[]uint64,[]*uint64,[]int,[]*int,[]uint,[]*uint element_type_name=int8 text_null=NULL binary_format=true typed_array.go.erb > int8_array.go -erb pgtype_array_type=BoolArray pgtype_element_type=Bool go_array_types=[]bool,[]*bool element_type_name=bool text_null=NULL binary_format=true typed_array.go.erb > bool_array.go -erb pgtype_array_type=DateArray pgtype_element_type=Date go_array_types=[]time.Time,[]*time.Time element_type_name=date text_null=NULL binary_format=true typed_array.go.erb > date_array.go -erb pgtype_array_type=TimestamptzArray pgtype_element_type=Timestamptz go_array_types=[]time.Time,[]*time.Time element_type_name=timestamptz text_null=NULL binary_format=true typed_array.go.erb > timestamptz_array.go -erb pgtype_array_type=TstzrangeArray pgtype_element_type=Tstzrange go_array_types=[]Tstzrange element_type_name=tstzrange text_null=NULL binary_format=true typed_array.go.erb > tstzrange_array.go -erb pgtype_array_type=TsrangeArray pgtype_element_type=Tsrange go_array_types=[]Tsrange element_type_name=tsrange text_null=NULL binary_format=true typed_array.go.erb > tsrange_array.go -erb pgtype_array_type=TimestampArray pgtype_element_type=Timestamp go_array_types=[]time.Time,[]*time.Time element_type_name=timestamp text_null=NULL binary_format=true typed_array.go.erb > timestamp_array.go -erb pgtype_array_type=Float4Array pgtype_element_type=Float4 go_array_types=[]float32,[]*float32 element_type_name=float4 text_null=NULL binary_format=true typed_array.go.erb > float4_array.go -erb pgtype_array_type=Float8Array pgtype_element_type=Float8 go_array_types=[]float64,[]*float64 element_type_name=float8 text_null=NULL binary_format=true typed_array.go.erb > float8_array.go -erb pgtype_array_type=InetArray pgtype_element_type=Inet go_array_types=[]*net.IPNet,[]net.IP,[]*net.IP element_type_name=inet text_null=NULL binary_format=true typed_array.go.erb > inet_array.go -erb pgtype_array_type=MacaddrArray pgtype_element_type=Macaddr go_array_types=[]net.HardwareAddr,[]*net.HardwareAddr element_type_name=macaddr text_null=NULL binary_format=true typed_array.go.erb > macaddr_array.go -erb pgtype_array_type=CIDRArray pgtype_element_type=CIDR go_array_types=[]*net.IPNet,[]net.IP,[]*net.IP element_type_name=cidr text_null=NULL binary_format=true typed_array.go.erb > cidr_array.go -erb pgtype_array_type=TextArray pgtype_element_type=Text go_array_types=[]string,[]*string element_type_name=text text_null=NULL binary_format=true typed_array.go.erb > text_array.go -erb pgtype_array_type=VarcharArray pgtype_element_type=Varchar go_array_types=[]string,[]*string element_type_name=varchar text_null=NULL binary_format=true typed_array.go.erb > varchar_array.go -erb pgtype_array_type=BPCharArray pgtype_element_type=BPChar go_array_types=[]string,[]*string element_type_name=bpchar text_null=NULL binary_format=true typed_array.go.erb > bpchar_array.go -erb pgtype_array_type=ByteaArray pgtype_element_type=Bytea go_array_types=[][]byte element_type_name=bytea text_null=NULL binary_format=true typed_array.go.erb > bytea_array.go -erb pgtype_array_type=ACLItemArray pgtype_element_type=ACLItem go_array_types=[]string,[]*string element_type_name=aclitem text_null=NULL binary_format=false typed_array.go.erb > aclitem_array.go -erb pgtype_array_type=HstoreArray pgtype_element_type=Hstore go_array_types=[]map[string]string element_type_name=hstore text_null=NULL binary_format=true typed_array.go.erb > hstore_array.go -erb pgtype_array_type=NumericArray pgtype_element_type=Numeric go_array_types=[]float32,[]*float32,[]float64,[]*float64,[]int64,[]*int64,[]uint64,[]*uint64 element_type_name=numeric text_null=NULL binary_format=true typed_array.go.erb > numeric_array.go -erb pgtype_array_type=UUIDArray pgtype_element_type=UUID go_array_types=[][16]byte,[][]byte,[]string,[]*string element_type_name=uuid text_null=NULL binary_format=true typed_array.go.erb > uuid_array.go -erb pgtype_array_type=JSONBArray pgtype_element_type=JSONB go_array_types=[]string,[][]byte element_type_name=jsonb text_null=NULL binary_format=true typed_array.go.erb > jsonb_array.go +erb pgtype_array_type=Int2Array pgtype_element_type=Int2 go_array_types=[]int16,[]*int16,[]uint16,[]*uint16,[]int32,[]*int32,[]uint32,[]*uint32,[]int64,[]*int64,[]uint64,[]*uint64,[]int,[]*int,[]uint,[]*uint element_type_name=int2 typed_array.go.erb > int2_array.go +erb pgtype_array_type=Int4Array pgtype_element_type=Int4 go_array_types=[]int16,[]*int16,[]uint16,[]*uint16,[]int32,[]*int32,[]uint32,[]*uint32,[]int64,[]*int64,[]uint64,[]*uint64,[]int,[]*int,[]uint,[]*uint element_type_name=int4 typed_array.go.erb > int4_array.go +erb pgtype_array_type=Int8Array pgtype_element_type=Int8 go_array_types=[]int16,[]*int16,[]uint16,[]*uint16,[]int32,[]*int32,[]uint32,[]*uint32,[]int64,[]*int64,[]uint64,[]*uint64,[]int,[]*int,[]uint,[]*uint element_type_name=int8 typed_array.go.erb > int8_array.go +erb pgtype_array_type=BoolArray pgtype_element_type=Bool go_array_types=[]bool,[]*bool element_type_name=bool typed_array.go.erb > bool_array.go +erb pgtype_array_type=DateArray pgtype_element_type=Date go_array_types=[]time.Time,[]*time.Time element_type_name=date typed_array.go.erb > date_array.go +erb pgtype_array_type=TimestamptzArray pgtype_element_type=Timestamptz go_array_types=[]time.Time,[]*time.Time element_type_name=timestamptz typed_array.go.erb > timestamptz_array.go +erb pgtype_array_type=TstzrangeArray pgtype_element_type=Tstzrange go_array_types=[]Tstzrange element_type_name=tstzrange typed_array.go.erb > tstzrange_array.go +erb pgtype_array_type=TsrangeArray pgtype_element_type=Tsrange go_array_types=[]Tsrange element_type_name=tsrange typed_array.go.erb > tsrange_array.go +erb pgtype_array_type=TimestampArray pgtype_element_type=Timestamp go_array_types=[]time.Time,[]*time.Time element_type_name=timestamp typed_array.go.erb > timestamp_array.go +erb pgtype_array_type=Float4Array pgtype_element_type=Float4 go_array_types=[]float32,[]*float32 element_type_name=float4 typed_array.go.erb > float4_array.go +erb pgtype_array_type=Float8Array pgtype_element_type=Float8 go_array_types=[]float64,[]*float64 element_type_name=float8 typed_array.go.erb > float8_array.go +erb pgtype_array_type=InetArray pgtype_element_type=Inet go_array_types=[]*net.IPNet,[]net.IP,[]*net.IP element_type_name=inet typed_array.go.erb > inet_array.go +erb pgtype_array_type=MacaddrArray pgtype_element_type=Macaddr go_array_types=[]net.HardwareAddr,[]*net.HardwareAddr element_type_name=macaddr typed_array.go.erb > macaddr_array.go +erb pgtype_array_type=CIDRArray pgtype_element_type=CIDR go_array_types=[]*net.IPNet,[]net.IP,[]*net.IP element_type_name=cidr typed_array.go.erb > cidr_array.go +erb pgtype_array_type=TextArray pgtype_element_type=Text go_array_types=[]string,[]*string element_type_name=text typed_array.go.erb > text_array.go +erb pgtype_array_type=VarcharArray pgtype_element_type=Varchar go_array_types=[]string,[]*string element_type_name=varchar typed_array.go.erb > varchar_array.go +erb pgtype_array_type=BPCharArray pgtype_element_type=BPChar go_array_types=[]string,[]*string element_type_name=bpchar typed_array.go.erb > bpchar_array.go +erb pgtype_array_type=ByteaArray pgtype_element_type=Bytea go_array_types=[][]byte element_type_name=bytea typed_array.go.erb > bytea_array.go +erb pgtype_array_type=ACLItemArray pgtype_element_type=ACLItem go_array_types=[]string,[]*string element_type_name=aclitem binary_format=false typed_array.go.erb > aclitem_array.go +erb pgtype_array_type=HstoreArray pgtype_element_type=Hstore go_array_types=[]map[string]string element_type_name=hstore typed_array.go.erb > hstore_array.go +erb pgtype_array_type=NumericArray pgtype_element_type=Numeric go_array_types=[]float32,[]*float32,[]float64,[]*float64,[]int64,[]*int64,[]uint64,[]*uint64 element_type_name=numeric typed_array.go.erb > numeric_array.go +erb pgtype_array_type=UUIDArray pgtype_element_type=UUID go_array_types=[][16]byte,[][]byte,[]string,[]*string element_type_name=uuid typed_array.go.erb > uuid_array.go +erb pgtype_array_type=JSONArray pgtype_element_type=JSON go_array_types=[]string,[][]byte,[]json.RawMessage element_type_name=json typed_array.go.erb > json_array.go +erb pgtype_array_type=JSONBArray pgtype_element_type=JSONB go_array_types=[]string,[][]byte,[]json.RawMessage element_type_name=jsonb typed_array.go.erb > jsonb_array.go # While the binary format is theoretically possible it is only practical to use the text format. -erb pgtype_array_type=EnumArray pgtype_element_type=GenericText go_array_types=[]string,[]*string text_null=NULL binary_format=false typed_array.go.erb > enum_array.go +erb pgtype_array_type=EnumArray pgtype_element_type=GenericText go_array_types=[]string,[]*string binary_format=false typed_array.go.erb > enum_array.go + +erb pgtype_array_type=RecordArray pgtype_element_type=Record go_array_types=[][]Value element_type_name=record text_null=NULL encode_binary=false text_format=false typed_array.go.erb > record_array.go goimports -w *_array.go diff --git a/vendor/github.com/jackc/pgtype/typed_multirange.go.erb b/vendor/github.com/jackc/pgtype/typed_multirange.go.erb new file mode 100644 index 000000000..84c8299fa --- /dev/null +++ b/vendor/github.com/jackc/pgtype/typed_multirange.go.erb @@ -0,0 +1,239 @@ +package pgtype + +import ( + "database/sql/driver" + "encoding/binary" + "fmt" + + "github.com/jackc/pgio" +) + +type <%= multirange_type %> struct { + Ranges []<%= range_type %> + Status Status +} + +func (dst *<%= multirange_type %>) Set(src interface{}) error { + //untyped nil and typed nil interfaces are different + if src == nil { + *dst = <%= multirange_type %>{Status: Null} + return nil + } + + switch value := src.(type) { + case <%= multirange_type %>: + *dst = value + case *<%= multirange_type %>: + *dst = *value + case string: + return dst.DecodeText(nil, []byte(value)) + case []<%= range_type %>: + if value == nil { + *dst = <%= multirange_type %>{Status: Null} + } else if len(value) == 0 { + *dst = <%= multirange_type %>{Status: Present} + } else { + elements := make([]<%= range_type %>, len(value)) + for i := range value { + if err := elements[i].Set(value[i]); err != nil { + return err + } + } + *dst = <%= multirange_type %>{ + Ranges: elements, + Status: Present, + } + } + case []*<%= range_type %>: + if value == nil { + *dst = <%= multirange_type %>{Status: Null} + } else if len(value) == 0 { + *dst = <%= multirange_type %>{Status: Present} + } else { + elements := make([]<%= range_type %>, len(value)) + for i := range value { + if err := elements[i].Set(value[i]); err != nil { + return err + } + } + *dst = <%= multirange_type %>{ + Ranges: elements, + Status: Present, + } + } + default: + return fmt.Errorf("cannot convert %v to <%= multirange_type %>", src) + } + + return nil + +} + +func (dst <%= multirange_type %>) Get() interface{} { + switch dst.Status { + case Present: + return dst + case Null: + return nil + default: + return dst.Status + } +} + +func (src *<%= multirange_type %>) AssignTo(dst interface{}) error { + return fmt.Errorf("cannot assign %v to %T", src, dst) +} + +func (dst *<%= multirange_type %>) DecodeText(ci *ConnInfo, src []byte) error { + if src == nil { + *dst = <%= multirange_type %>{Status: Null} + return nil + } + + utmr, err := ParseUntypedTextMultirange(string(src)) + if err != nil { + return err + } + + var elements []<%= range_type %> + + if len(utmr.Elements) > 0 { + elements = make([]<%= range_type %>, len(utmr.Elements)) + + for i, s := range utmr.Elements { + var elem <%= range_type %> + + elemSrc := []byte(s) + + err = elem.DecodeText(ci, elemSrc) + if err != nil { + return err + } + + elements[i] = elem + } + } + + *dst = <%= multirange_type %>{Ranges: elements, Status: Present} + + return nil +} + +func (dst *<%= multirange_type %>) DecodeBinary(ci *ConnInfo, src []byte) error { + if src == nil { + *dst = <%= multirange_type %>{Status: Null} + return nil + } + + rp := 0 + + numElems := int(binary.BigEndian.Uint32(src[rp:])) + rp += 4 + + if numElems == 0 { + *dst = <%= multirange_type %>{Status: Present} + return nil + } + + elements := make([]<%= range_type %>, numElems) + + for i := range elements { + elemLen := int(int32(binary.BigEndian.Uint32(src[rp:]))) + rp += 4 + var elemSrc []byte + if elemLen >= 0 { + elemSrc = src[rp : rp+elemLen] + rp += elemLen + } + err := elements[i].DecodeBinary(ci, elemSrc) + if err != nil { + return err + } + } + + *dst = <%= multirange_type %>{Ranges: elements, Status: Present} + return nil +} + +func (src <%= multirange_type %>) EncodeText(ci *ConnInfo, buf []byte) ([]byte, error) { + switch src.Status { + case Null: + return nil, nil + case Undefined: + return nil, errUndefined + } + + buf = append(buf, '{') + + inElemBuf := make([]byte, 0, 32) + for i, elem := range src.Ranges { + if i > 0 { + buf = append(buf, ',') + } + + elemBuf, err := elem.EncodeText(ci, inElemBuf) + if err != nil { + return nil, err + } + if elemBuf == nil { + return nil, fmt.Errorf("multi-range does not allow null range") + } else { + buf = append(buf, string(elemBuf)...) + } + + } + + buf = append(buf, '}') + + return buf, nil +} + +func (src <%= multirange_type %>) EncodeBinary(ci *ConnInfo, buf []byte) ([]byte, error) { + switch src.Status { + case Null: + return nil, nil + case Undefined: + return nil, errUndefined + } + + buf = pgio.AppendInt32(buf, int32(len(src.Ranges))) + + for i := range src.Ranges { + sp := len(buf) + buf = pgio.AppendInt32(buf, -1) + + elemBuf, err := src.Ranges[i].EncodeBinary(ci, buf) + if err != nil { + return nil, err + } + if elemBuf != nil { + buf = elemBuf + pgio.SetInt32(buf[sp:], int32(len(buf[sp:])-4)) + } + } + + return buf, nil +} + +// Scan implements the database/sql Scanner interface. +func (dst *<%= multirange_type %>) Scan(src interface{}) error { + if src == nil { + return dst.DecodeText(nil, nil) + } + + switch src := src.(type) { + case string: + return dst.DecodeText(nil, []byte(src)) + case []byte: + srcCopy := make([]byte, len(src)) + copy(srcCopy, src) + return dst.DecodeText(nil, srcCopy) + } + + return fmt.Errorf("cannot scan %T", src) +} + +// Value implements the database/sql/driver Valuer interface. +func (src <%= multirange_type %>) Value() (driver.Value, error) { + return EncodeValueText(src) +} diff --git a/vendor/github.com/jackc/pgtype/typed_multirange_gen.sh b/vendor/github.com/jackc/pgtype/typed_multirange_gen.sh new file mode 100644 index 000000000..610f40a1e --- /dev/null +++ b/vendor/github.com/jackc/pgtype/typed_multirange_gen.sh @@ -0,0 +1,8 @@ +erb range_type=Numrange multirange_type=Nummultirange typed_multirange.go.erb > num_multirange.go +erb range_type=Int4range multirange_type=Int4multirange typed_multirange.go.erb > int4_multirange.go +erb range_type=Int8range multirange_type=Int8multirange typed_multirange.go.erb > int8_multirange.go +# TODO +# erb range_type=Tsrange multirange_type=Tsmultirange typed_multirange.go.erb > ts_multirange.go +# erb range_type=Tstzrange multirange_type=Tstzmultirange typed_multirange.go.erb > tstz_multirange.go +# erb range_type=Daterange multirange_type=Datemultirange typed_multirange.go.erb > date_multirange.go +goimports -w *multirange.go
\ No newline at end of file diff --git a/vendor/github.com/jackc/pgtype/uuid.go b/vendor/github.com/jackc/pgtype/uuid.go index fa0be07fe..6839c052d 100644 --- a/vendor/github.com/jackc/pgtype/uuid.go +++ b/vendor/github.com/jackc/pgtype/uuid.go @@ -18,14 +18,15 @@ func (dst *UUID) Set(src interface{}) error { return nil } - if value, ok := src.(interface{ Get() interface{} }); ok { + switch value := src.(type) { + case interface{ Get() interface{} }: value2 := value.Get() if value2 != value { return dst.Set(value2) } - } - - switch value := src.(type) { + case fmt.Stringer: + value2 := value.String() + return dst.Set(value2) case [16]byte: *dst = UUID{Bytes: value, Status: Present} case []byte: diff --git a/vendor/github.com/jackc/pgx/v4/CHANGELOG.md b/vendor/github.com/jackc/pgx/v4/CHANGELOG.md index 4dd93b30e..e8f201295 100644 --- a/vendor/github.com/jackc/pgx/v4/CHANGELOG.md +++ b/vendor/github.com/jackc/pgx/v4/CHANGELOG.md @@ -1,3 +1,38 @@ +# 4.17.2 (September 3, 2022) + +* Fix panic when logging batch error (Tom Möller) + +# 4.17.1 (August 27, 2022) + +* Upgrade puddle to v1.3.0 - fixes context failing to cancel Acquire when acquire is creating resource which was introduced in v4.17.0 (James Hartig) +* Fix atomic alignment on 32-bit platforms + +# 4.17.0 (August 6, 2022) + +* Upgrade pgconn to v1.13.0 +* Upgrade pgproto3 to v2.3.1 +* Upgrade pgtype to v1.12.0 +* Allow background pool connections to continue even if cause is canceled (James Hartig) +* Add LoggerFunc (Gabor Szabad) +* pgxpool: health check should avoid going below minConns (James Hartig) +* Add pgxpool.Conn.Hijack() +* Logging improvements (Stepan Rabotkin) + +# 4.16.1 (May 7, 2022) + +* Upgrade pgconn to v1.12.1 +* Fix explicitly prepared statements with describe statement cache mode + +# 4.16.0 (April 21, 2022) + +* Upgrade pgconn to v1.12.0 +* Upgrade pgproto3 to v2.3.0 +* Upgrade pgtype to v1.11.0 +* Fix: Do not panic when context cancelled while getting statement from cache. +* Fix: Less memory pinning from old Rows. +* Fix: Support '\r' line ending when sanitizing SQL comment. +* Add pluggable GSSAPI support (Oliver Tan) + # 4.15.0 (February 7, 2022) * Upgrade to pgconn v1.11.0 diff --git a/vendor/github.com/jackc/pgx/v4/README.md b/vendor/github.com/jackc/pgx/v4/README.md index 110d4f02e..16d8f46f7 100644 --- a/vendor/github.com/jackc/pgx/v4/README.md +++ b/vendor/github.com/jackc/pgx/v4/README.md @@ -1,6 +1,11 @@ [](https://pkg.go.dev/github.com/jackc/pgx/v4) [](https://travis-ci.org/jackc/pgx) +--- + +This is the stable `v4` release. `v5` is now in beta testing with final release expected in September. See https://github.com/jackc/pgx/issues/1273 for more information. Please consider testing `v5`. + +--- # pgx - PostgreSQL Driver and Toolkit pgx is a pure Go driver and toolkit for PostgreSQL. @@ -98,26 +103,6 @@ There are three areas in particular where pgx can provide a significant performa perform nearly 3x the number of queries per second. 3. Batched queries - Multiple queries can be batched together to minimize network round trips. -## Comparison with Alternatives - -* [pq](http://godoc.org/github.com/lib/pq) -* [go-pg](https://github.com/go-pg/pg) - -For prepared queries with small sets of simple data types, all drivers will have have similar performance. However, if prepared statements aren't being explicitly used, pgx can have a significant performance advantage due to automatic statement preparation. -pgx also can perform better when using PostgreSQL-specific data types or query batching. See -[go_db_bench](https://github.com/jackc/go_db_bench) for some database driver benchmarks. - -### Compatibility with `database/sql` - -pq is exclusively used with `database/sql`. go-pg does not use `database/sql` at all. pgx supports `database/sql` as well as -its own interface. - -### Level of access, ORM - -go-pg is a PostgreSQL client and ORM. It includes many features that traditionally sit above the database driver, such as ORM, struct mapping, soft deletes, schema migrations, and sharding support. - -pgx is "closer to the metal" and such abstractions are beyond the scope of the pgx project, which first and foremost, aims to be a performant driver and toolkit. - ## Testing pgx tests naturally require a PostgreSQL database. It will connect to the database specified in the `PGX_TEST_DATABASE` environment @@ -201,3 +186,11 @@ pgerrcode contains constants for the PostgreSQL error codes. ### [github.com/georgysavva/scany](https://github.com/georgysavva/scany) Library for scanning data from a database into Go structs and more. + +### [https://github.com/otan/gopgkrb5](https://github.com/otan/gopgkrb5) + +Adds GSSAPI / Kerberos authentication support. + +### [https://github.com/vgarvardt/pgx-google-uuid](https://github.com/vgarvardt/pgx-google-uuid) + +Adds support for [`github.com/google/uuid`](https://github.com/google/uuid). diff --git a/vendor/github.com/jackc/pgx/v4/conn.go b/vendor/github.com/jackc/pgx/v4/conn.go index 102158ab5..854561e02 100644 --- a/vendor/github.com/jackc/pgx/v4/conn.go +++ b/vendor/github.com/jackc/pgx/v4/conn.go @@ -73,9 +73,8 @@ type Conn struct { connInfo *pgtype.ConnInfo - wbuf []byte - preallocatedRows []connRows - eqb extendedQueryBuilder + wbuf []byte + eqb extendedQueryBuilder } // Identifier a PostgreSQL identifier or name. Identifiers can be composed of @@ -117,14 +116,14 @@ func ConnectConfig(ctx context.Context, connConfig *ConnConfig) (*Conn, error) { // ParseConfig creates a ConnConfig from a connection string. ParseConfig handles all options that pgconn.ParseConfig // does. In addition, it accepts the following options: // -// statement_cache_capacity -// The maximum size of the automatic statement cache. Set to 0 to disable automatic statement caching. Default: 512. +// statement_cache_capacity +// The maximum size of the automatic statement cache. Set to 0 to disable automatic statement caching. Default: 512. // -// statement_cache_mode -// Possible values: "prepare" and "describe". "prepare" will create prepared statements on the PostgreSQL server. -// "describe" will use the anonymous prepared statement to describe a statement without creating a statement on the -// server. "describe" is primarily useful when the environment does not allow prepared statements such as when -// running a connection pooler like PgBouncer. Default: "prepare" +// statement_cache_mode +// Possible values: "prepare" and "describe". "prepare" will create prepared statements on the PostgreSQL server. +// "describe" will use the anonymous prepared statement to describe a statement without creating a statement on the +// server. "describe" is primarily useful when the environment does not allow prepared statements such as when +// running a connection pooler like PgBouncer. Default: "prepare" // // prefer_simple_protocol // Possible values: "true" and "false". Use the simple protocol instead of extended protocol. Default: false @@ -366,30 +365,6 @@ func (c *Conn) Ping(ctx context.Context) error { return err } -func connInfoFromRows(rows Rows, err error) (map[string]uint32, error) { - if err != nil { - return nil, err - } - defer rows.Close() - - nameOIDs := make(map[string]uint32, 256) - for rows.Next() { - var oid uint32 - var name pgtype.Text - if err = rows.Scan(&oid, &name); err != nil { - return nil, err - } - - nameOIDs[name.String] = oid - } - - if err = rows.Err(); err != nil { - return nil, err - } - - return nameOIDs, err -} - // PgConn returns the underlying *pgconn.PgConn. This is an escape hatch method that allows lower level access to the // PostgreSQL connection than pgx exposes. // @@ -414,7 +389,8 @@ func (c *Conn) Exec(ctx context.Context, sql string, arguments ...interface{}) ( commandTag, err := c.exec(ctx, sql, arguments...) if err != nil { if c.shouldLog(LogLevelError) { - c.log(ctx, LogLevelError, "Exec", map[string]interface{}{"sql": sql, "args": logQueryArgs(arguments), "err": err}) + endTime := time.Now() + c.log(ctx, LogLevelError, "Exec", map[string]interface{}{"sql": sql, "args": logQueryArgs(arguments), "err": err, "time": endTime.Sub(startTime)}) } return commandTag, err } @@ -537,12 +513,7 @@ func (c *Conn) execPrepared(ctx context.Context, sd *pgconn.StatementDescription } func (c *Conn) getRows(ctx context.Context, sql string, args []interface{}) *connRows { - if len(c.preallocatedRows) == 0 { - c.preallocatedRows = make([]connRows, 64) - } - - r := &c.preallocatedRows[len(c.preallocatedRows)-1] - c.preallocatedRows = c.preallocatedRows[0 : len(c.preallocatedRows)-1] + r := &connRows{} r.ctx = ctx r.logger = c @@ -674,7 +645,7 @@ optionLoop: resultFormats = c.eqb.resultFormats } - if c.stmtcache != nil && c.stmtcache.Mode() == stmtcache.ModeDescribe { + if c.stmtcache != nil && c.stmtcache.Mode() == stmtcache.ModeDescribe && !ok { rows.resultReader = c.pgConn.ExecParams(ctx, sql, c.eqb.paramValues, sd.ParamOIDs, c.eqb.paramFormats, resultFormats) } else { rows.resultReader = c.pgConn.ExecPrepared(ctx, sd.Name, c.eqb.paramValues, c.eqb.paramFormats, resultFormats) @@ -739,6 +710,8 @@ func (c *Conn) QueryFunc(ctx context.Context, sql string, args []interface{}, sc // explicit transaction control statements are executed. The returned BatchResults must be closed before the connection // is used again. func (c *Conn) SendBatch(ctx context.Context, b *Batch) BatchResults { + startTime := time.Now() + simpleProtocol := c.config.PreferSimpleProtocol var sb strings.Builder if simpleProtocol { @@ -797,24 +770,23 @@ func (c *Conn) SendBatch(ctx context.Context, b *Batch) BatchResults { var err error sd, err = stmtCache.Get(ctx, bi.query) if err != nil { - // the stmtCache was prefilled from distinctUnpreparedQueries above so we are guaranteed no errors - panic("BUG: unexpected error from stmtCache") + return c.logBatchResults(ctx, startTime, &batchResults{ctx: ctx, conn: c, err: err}) } } if len(sd.ParamOIDs) != len(bi.arguments) { - return &batchResults{ctx: ctx, conn: c, err: fmt.Errorf("mismatched param and argument count")} + return c.logBatchResults(ctx, startTime, &batchResults{ctx: ctx, conn: c, err: fmt.Errorf("mismatched param and argument count")}) } args, err := convertDriverValuers(bi.arguments) if err != nil { - return &batchResults{ctx: ctx, conn: c, err: err} + return c.logBatchResults(ctx, startTime, &batchResults{ctx: ctx, conn: c, err: err}) } for i := range args { err = c.eqb.AppendParam(c.connInfo, sd.ParamOIDs[i], args[i]) if err != nil { - return &batchResults{ctx: ctx, conn: c, err: err} + return c.logBatchResults(ctx, startTime, &batchResults{ctx: ctx, conn: c, err: err}) } } @@ -833,13 +805,30 @@ func (c *Conn) SendBatch(ctx context.Context, b *Batch) BatchResults { mrr := c.pgConn.ExecBatch(ctx, batch) - return &batchResults{ + return c.logBatchResults(ctx, startTime, &batchResults{ ctx: ctx, conn: c, mrr: mrr, b: b, ix: 0, + }) +} + +func (c *Conn) logBatchResults(ctx context.Context, startTime time.Time, results *batchResults) BatchResults { + if results.err != nil { + if c.shouldLog(LogLevelError) { + endTime := time.Now() + c.log(ctx, LogLevelError, "SendBatch", map[string]interface{}{"err": results.err, "time": endTime.Sub(startTime)}) + } + return results } + + if c.shouldLog(LogLevelInfo) { + endTime := time.Now() + c.log(ctx, LogLevelInfo, "SendBatch", map[string]interface{}{"batchLen": results.b.Len(), "time": endTime.Sub(startTime)}) + } + + return results } func (c *Conn) sanitizeForSimpleQuery(sql string, args ...interface{}) (string, error) { diff --git a/vendor/github.com/jackc/pgx/v4/copy_from.go b/vendor/github.com/jackc/pgx/v4/copy_from.go index 3494e28f9..49139d050 100644 --- a/vendor/github.com/jackc/pgx/v4/copy_from.go +++ b/vendor/github.com/jackc/pgx/v4/copy_from.go @@ -153,13 +153,13 @@ func (ct *copyFrom) run(ctx context.Context) (int64, error) { <-doneChan rowsAffected := commandTag.RowsAffected() + endTime := time.Now() if err == nil { if ct.conn.shouldLog(LogLevelInfo) { - endTime := time.Now() ct.conn.log(ctx, LogLevelInfo, "CopyFrom", map[string]interface{}{"tableName": ct.tableName, "columnNames": ct.columnNames, "time": endTime.Sub(startTime), "rowCount": rowsAffected}) } } else if ct.conn.shouldLog(LogLevelError) { - ct.conn.log(ctx, LogLevelError, "CopyFrom", map[string]interface{}{"err": err, "tableName": ct.tableName, "columnNames": ct.columnNames}) + ct.conn.log(ctx, LogLevelError, "CopyFrom", map[string]interface{}{"err": err, "tableName": ct.tableName, "columnNames": ct.columnNames, "time": endTime.Sub(startTime)}) } return rowsAffected, err diff --git a/vendor/github.com/jackc/pgx/v4/internal/sanitize/sanitize.go b/vendor/github.com/jackc/pgx/v4/internal/sanitize/sanitize.go index 2dba3b810..a7a94e93e 100644 --- a/vendor/github.com/jackc/pgx/v4/internal/sanitize/sanitize.go +++ b/vendor/github.com/jackc/pgx/v4/internal/sanitize/sanitize.go @@ -246,7 +246,7 @@ func oneLineCommentState(l *sqlLexer) stateFn { case '\\': _, width = utf8.DecodeRuneInString(l.src[l.pos:]) l.pos += width - case '\n': + case '\n', '\r': return rawState case utf8.RuneError: if l.pos-l.start > 0 { diff --git a/vendor/github.com/jackc/pgx/v4/large_objects.go b/vendor/github.com/jackc/pgx/v4/large_objects.go index 5255a3b48..c238ab9c2 100644 --- a/vendor/github.com/jackc/pgx/v4/large_objects.go +++ b/vendor/github.com/jackc/pgx/v4/large_objects.go @@ -56,10 +56,10 @@ func (o *LargeObjects) Unlink(ctx context.Context, oid uint32) error { // A LargeObject is a large object stored on the server. It is only valid within the transaction that it was initialized // in. It uses the context it was initialized with for all operations. It implements these interfaces: // -// io.Writer -// io.Reader -// io.Seeker -// io.Closer +// io.Writer +// io.Reader +// io.Seeker +// io.Closer type LargeObject struct { ctx context.Context tx Tx @@ -108,13 +108,13 @@ func (o *LargeObject) Tell() (n int64, err error) { return n, err } -// Trunctes the large object to size. +// Truncate the large object to size. func (o *LargeObject) Truncate(size int64) (err error) { _, err = o.tx.Exec(o.ctx, "select lo_truncate64($1, $2)", o.fd, size) return err } -// Close closees the large object descriptor. +// Close the large object descriptor. func (o *LargeObject) Close() error { _, err := o.tx.Exec(o.ctx, "select lo_close($1)", o.fd) return err diff --git a/vendor/github.com/jackc/pgx/v4/logger.go b/vendor/github.com/jackc/pgx/v4/logger.go index 89fd5af51..41f8b7e87 100644 --- a/vendor/github.com/jackc/pgx/v4/logger.go +++ b/vendor/github.com/jackc/pgx/v4/logger.go @@ -47,9 +47,18 @@ type Logger interface { Log(ctx context.Context, level LogLevel, msg string, data map[string]interface{}) } +// LoggerFunc is a wrapper around a function to satisfy the pgx.Logger interface +type LoggerFunc func(ctx context.Context, level LogLevel, msg string, data map[string]interface{}) + +// Log delegates the logging request to the wrapped function +func (f LoggerFunc) Log(ctx context.Context, level LogLevel, msg string, data map[string]interface{}) { + f(ctx, level, msg, data) +} + // LogLevelFromString converts log level string to constant // // Valid levels: +// // trace // debug // info diff --git a/vendor/github.com/jackc/pgx/v4/rows.go b/vendor/github.com/jackc/pgx/v4/rows.go index 271c6e527..4749ead99 100644 --- a/vendor/github.com/jackc/pgx/v4/rows.go +++ b/vendor/github.com/jackc/pgx/v4/rows.go @@ -143,14 +143,15 @@ func (rows *connRows) Close() { } if rows.logger != nil { + endTime := time.Now() + if rows.err == nil { if rows.logger.shouldLog(LogLevelInfo) { - endTime := time.Now() rows.logger.log(rows.ctx, LogLevelInfo, "Query", map[string]interface{}{"sql": rows.sql, "args": logQueryArgs(rows.args), "time": endTime.Sub(rows.startTime), "rowCount": rows.rowCount}) } } else { if rows.logger.shouldLog(LogLevelError) { - rows.logger.log(rows.ctx, LogLevelError, "Query", map[string]interface{}{"err": rows.err, "sql": rows.sql, "args": logQueryArgs(rows.args)}) + rows.logger.log(rows.ctx, LogLevelError, "Query", map[string]interface{}{"err": rows.err, "sql": rows.sql, "time": endTime.Sub(rows.startTime), "args": logQueryArgs(rows.args)}) } if rows.err != nil && rows.conn.stmtcache != nil { rows.conn.stmtcache.StatementErrored(rows.sql, rows.err) diff --git a/vendor/github.com/jackc/pgx/v4/stdlib/sql.go b/vendor/github.com/jackc/pgx/v4/stdlib/sql.go index fa81e73d5..da377ecee 100644 --- a/vendor/github.com/jackc/pgx/v4/stdlib/sql.go +++ b/vendor/github.com/jackc/pgx/v4/stdlib/sql.go @@ -163,7 +163,7 @@ func RandomizeHostOrderFunc(ctx context.Context, connConfig *pgx.ConnConfig) err return nil } -func OpenDB(config pgx.ConnConfig, opts ...OptionOpenDB) *sql.DB { +func GetConnector(config pgx.ConnConfig, opts ...OptionOpenDB) driver.Connector { c := connector{ ConnConfig: config, BeforeConnect: func(context.Context, *pgx.ConnConfig) error { return nil }, // noop before connect by default @@ -175,7 +175,11 @@ func OpenDB(config pgx.ConnConfig, opts ...OptionOpenDB) *sql.DB { for _, opt := range opts { opt(&c) } + return c +} +func OpenDB(config pgx.ConnConfig, opts ...OptionOpenDB) *sql.DB { + c := GetConnector(config, opts...) return sql.OpenDB(c) } diff --git a/vendor/github.com/jackc/pgx/v4/tx.go b/vendor/github.com/jackc/pgx/v4/tx.go index 1971ed673..2914ada7d 100644 --- a/vendor/github.com/jackc/pgx/v4/tx.go +++ b/vendor/github.com/jackc/pgx/v4/tx.go @@ -192,7 +192,7 @@ func (tx *dbTx) Begin(ctx context.Context) (Tx, error) { return nil, err } - return &dbSavepoint{tx: tx, savepointNum: tx.savepointNum}, nil + return &dbSimulatedNestedTx{tx: tx, savepointNum: tx.savepointNum}, nil } func (tx *dbTx) BeginFunc(ctx context.Context, f func(Tx) error) (err error) { @@ -329,15 +329,15 @@ func (tx *dbTx) Conn() *Conn { return tx.conn } -// dbSavepoint represents a nested transaction implemented by a savepoint. -type dbSavepoint struct { +// dbSimulatedNestedTx represents a simulated nested transaction implemented by a savepoint. +type dbSimulatedNestedTx struct { tx Tx savepointNum int64 closed bool } // Begin starts a pseudo nested transaction implemented with a savepoint. -func (sp *dbSavepoint) Begin(ctx context.Context) (Tx, error) { +func (sp *dbSimulatedNestedTx) Begin(ctx context.Context) (Tx, error) { if sp.closed { return nil, ErrTxClosed } @@ -345,7 +345,7 @@ func (sp *dbSavepoint) Begin(ctx context.Context) (Tx, error) { return sp.tx.Begin(ctx) } -func (sp *dbSavepoint) BeginFunc(ctx context.Context, f func(Tx) error) (err error) { +func (sp *dbSimulatedNestedTx) BeginFunc(ctx context.Context, f func(Tx) error) (err error) { if sp.closed { return ErrTxClosed } @@ -354,7 +354,7 @@ func (sp *dbSavepoint) BeginFunc(ctx context.Context, f func(Tx) error) (err err } // Commit releases the savepoint essentially committing the pseudo nested transaction. -func (sp *dbSavepoint) Commit(ctx context.Context) error { +func (sp *dbSimulatedNestedTx) Commit(ctx context.Context) error { if sp.closed { return ErrTxClosed } @@ -367,7 +367,7 @@ func (sp *dbSavepoint) Commit(ctx context.Context) error { // Rollback rolls back to the savepoint essentially rolling back the pseudo nested transaction. Rollback will return // ErrTxClosed if the dbSavepoint is already closed, but is otherwise safe to call multiple times. Hence, a defer sp.Rollback() // is safe even if sp.Commit() will be called first in a non-error condition. -func (sp *dbSavepoint) Rollback(ctx context.Context) error { +func (sp *dbSimulatedNestedTx) Rollback(ctx context.Context) error { if sp.closed { return ErrTxClosed } @@ -378,7 +378,7 @@ func (sp *dbSavepoint) Rollback(ctx context.Context) error { } // Exec delegates to the underlying Tx -func (sp *dbSavepoint) Exec(ctx context.Context, sql string, arguments ...interface{}) (commandTag pgconn.CommandTag, err error) { +func (sp *dbSimulatedNestedTx) Exec(ctx context.Context, sql string, arguments ...interface{}) (commandTag pgconn.CommandTag, err error) { if sp.closed { return nil, ErrTxClosed } @@ -387,7 +387,7 @@ func (sp *dbSavepoint) Exec(ctx context.Context, sql string, arguments ...interf } // Prepare delegates to the underlying Tx -func (sp *dbSavepoint) Prepare(ctx context.Context, name, sql string) (*pgconn.StatementDescription, error) { +func (sp *dbSimulatedNestedTx) Prepare(ctx context.Context, name, sql string) (*pgconn.StatementDescription, error) { if sp.closed { return nil, ErrTxClosed } @@ -396,7 +396,7 @@ func (sp *dbSavepoint) Prepare(ctx context.Context, name, sql string) (*pgconn.S } // Query delegates to the underlying Tx -func (sp *dbSavepoint) Query(ctx context.Context, sql string, args ...interface{}) (Rows, error) { +func (sp *dbSimulatedNestedTx) Query(ctx context.Context, sql string, args ...interface{}) (Rows, error) { if sp.closed { // Because checking for errors can be deferred to the *Rows, build one with the error err := ErrTxClosed @@ -407,13 +407,13 @@ func (sp *dbSavepoint) Query(ctx context.Context, sql string, args ...interface{ } // QueryRow delegates to the underlying Tx -func (sp *dbSavepoint) QueryRow(ctx context.Context, sql string, args ...interface{}) Row { +func (sp *dbSimulatedNestedTx) QueryRow(ctx context.Context, sql string, args ...interface{}) Row { rows, _ := sp.Query(ctx, sql, args...) return (*connRow)(rows.(*connRows)) } // QueryFunc delegates to the underlying Tx. -func (sp *dbSavepoint) QueryFunc(ctx context.Context, sql string, args []interface{}, scans []interface{}, f func(QueryFuncRow) error) (pgconn.CommandTag, error) { +func (sp *dbSimulatedNestedTx) QueryFunc(ctx context.Context, sql string, args []interface{}, scans []interface{}, f func(QueryFuncRow) error) (pgconn.CommandTag, error) { if sp.closed { return nil, ErrTxClosed } @@ -422,7 +422,7 @@ func (sp *dbSavepoint) QueryFunc(ctx context.Context, sql string, args []interfa } // CopyFrom delegates to the underlying *Conn -func (sp *dbSavepoint) CopyFrom(ctx context.Context, tableName Identifier, columnNames []string, rowSrc CopyFromSource) (int64, error) { +func (sp *dbSimulatedNestedTx) CopyFrom(ctx context.Context, tableName Identifier, columnNames []string, rowSrc CopyFromSource) (int64, error) { if sp.closed { return 0, ErrTxClosed } @@ -431,7 +431,7 @@ func (sp *dbSavepoint) CopyFrom(ctx context.Context, tableName Identifier, colum } // SendBatch delegates to the underlying *Conn -func (sp *dbSavepoint) SendBatch(ctx context.Context, b *Batch) BatchResults { +func (sp *dbSimulatedNestedTx) SendBatch(ctx context.Context, b *Batch) BatchResults { if sp.closed { return &batchResults{err: ErrTxClosed} } @@ -439,10 +439,10 @@ func (sp *dbSavepoint) SendBatch(ctx context.Context, b *Batch) BatchResults { return sp.tx.SendBatch(ctx, b) } -func (sp *dbSavepoint) LargeObjects() LargeObjects { +func (sp *dbSimulatedNestedTx) LargeObjects() LargeObjects { return LargeObjects{tx: sp} } -func (sp *dbSavepoint) Conn() *Conn { +func (sp *dbSimulatedNestedTx) Conn() *Conn { return sp.tx.Conn() } diff --git a/vendor/github.com/klauspost/compress/s2/README.md b/vendor/github.com/klauspost/compress/s2/README.md index 119793456..73c0c462d 100644 --- a/vendor/github.com/klauspost/compress/s2/README.md +++ b/vendor/github.com/klauspost/compress/s2/README.md @@ -19,6 +19,7 @@ This is important, so you don't have to worry about spending CPU cycles on alrea * Adjustable compression (3 levels) * Concurrent stream compression * Faster decompression, even for Snappy compatible content +* Concurrent Snappy/S2 stream decompression * Ability to quickly skip forward in compressed stream * Random seeking with indexes * Compatible with reading Snappy compressed content @@ -415,6 +416,25 @@ Without assembly decompression is also very fast; single goroutine decompression Even though S2 typically compresses better than Snappy, decompression speed is always better. +### Concurrent Stream Decompression + +For full stream decompression S2 offers a [DecodeConcurrent](https://pkg.go.dev/github.com/klauspost/compress/s2#Reader.DecodeConcurrent) +that will decode a full stream using multiple goroutines. + +Example scaling, AMD Ryzen 3950X, 16 cores, decompression using `s2d -bench=3 <input>`, best of 3: + +| Input | `-cpu=1` | `-cpu=2` | `-cpu=4` | `-cpu=8` | `-cpu=16` | +|-------------------------------------------|------------|------------|------------|------------|-------------| +| enwik10.snappy | 1098.6MB/s | 1819.8MB/s | 3625.6MB/s | 6910.6MB/s | 10818.2MB/s | +| enwik10.s2 | 1303.5MB/s | 2606.1MB/s | 4847.9MB/s | 8878.4MB/s | 9592.1MB/s | +| sofia-air-quality-dataset.tar.snappy | 1302.0MB/s | 2165.0MB/s | 4244.5MB/s | 8241.0MB/s | 12920.5MB/s | +| sofia-air-quality-dataset.tar.s2 | 1399.2MB/s | 2463.2MB/s | 5196.5MB/s | 9639.8MB/s | 11439.5MB/s | +| sofia-air-quality-dataset.tar.s2 (no asm) | 837.5MB/s | 1652.6MB/s | 3183.6MB/s | 5945.0MB/s | 9620.7MB/s | + +Scaling can be expected to be pretty linear until memory bandwidth is saturated. + +For now the DecodeConcurrent can only be used for full streams without seeking or combining with regular reads. + ## Block compression @@ -873,7 +893,7 @@ for each entry { } // Uncompressed uses previous offset and adds EstBlockSize - entry[entryNum].UncompressedOffset = entry[entryNum-1].UncompressedOffset + EstBlockSize + entry[entryNum].UncompressedOffset = entry[entryNum-1].UncompressedOffset + EstBlockSize + uOff } @@ -901,6 +921,14 @@ for each entry { } ``` +To decode from any given uncompressed offset `(wantOffset)`: + +* Iterate entries until `entry[n].UncompressedOffset > wantOffset`. +* Start decoding from `entry[n-1].CompressedOffset`. +* Discard `entry[n-1].UncompressedOffset - wantOffset` bytes from the decoded stream. + +See [using indexes](https://github.com/klauspost/compress/tree/master/s2#using-indexes) for functions that perform the operations with a simpler interface. + # Format Extensions * Frame [Stream identifier](https://github.com/google/snappy/blob/master/framing_format.txt#L68) changed from `sNaPpY` to `S2sTwO`. diff --git a/vendor/github.com/klauspost/compress/s2/decode.go b/vendor/github.com/klauspost/compress/s2/decode.go index 9e7fce885..27c0f3c2c 100644 --- a/vendor/github.com/klauspost/compress/s2/decode.go +++ b/vendor/github.com/klauspost/compress/s2/decode.go @@ -11,6 +11,9 @@ import ( "fmt" "io" "io/ioutil" + "math" + "runtime" + "sync" ) var ( @@ -169,6 +172,14 @@ func ReaderSkippableCB(id uint8, fn func(r io.Reader) error) ReaderOption { } } +// ReaderIgnoreCRC will make the reader skip CRC calculation and checks. +func ReaderIgnoreCRC() ReaderOption { + return func(r *Reader) error { + r.ignoreCRC = true + return nil + } +} + // Reader is an io.Reader that can read Snappy-compressed bytes. type Reader struct { r io.Reader @@ -191,18 +202,19 @@ type Reader struct { paramsOK bool snappyFrame bool ignoreStreamID bool + ignoreCRC bool } // ensureBufferSize will ensure that the buffer can take at least n bytes. // If false is returned the buffer exceeds maximum allowed size. func (r *Reader) ensureBufferSize(n int) bool { - if len(r.buf) >= n { - return true - } if n > r.maxBufSize { r.err = ErrCorrupt return false } + if cap(r.buf) >= n { + return true + } // Realloc buffer. r.buf = make([]byte, n) return true @@ -220,6 +232,7 @@ func (r *Reader) Reset(reader io.Reader) { r.err = nil r.i = 0 r.j = 0 + r.blockStart = 0 r.readHeader = r.ignoreStreamID } @@ -344,7 +357,7 @@ func (r *Reader) Read(p []byte) (int, error) { r.err = err return 0, r.err } - if crc(r.decoded[:n]) != checksum { + if !r.ignoreCRC && crc(r.decoded[:n]) != checksum { r.err = ErrCRC return 0, r.err } @@ -385,7 +398,7 @@ func (r *Reader) Read(p []byte) (int, error) { if !r.readFull(r.decoded[:n], false) { return 0, r.err } - if crc(r.decoded[:n]) != checksum { + if !r.ignoreCRC && crc(r.decoded[:n]) != checksum { r.err = ErrCRC return 0, r.err } @@ -435,6 +448,259 @@ func (r *Reader) Read(p []byte) (int, error) { } } +// DecodeConcurrent will decode the full stream to w. +// This function should not be combined with reading, seeking or other operations. +// Up to 'concurrent' goroutines will be used. +// If <= 0, runtime.NumCPU will be used. +// On success the number of bytes decompressed nil and is returned. +// This is mainly intended for bigger streams. +func (r *Reader) DecodeConcurrent(w io.Writer, concurrent int) (written int64, err error) { + if r.i > 0 || r.j > 0 || r.blockStart > 0 { + return 0, errors.New("DecodeConcurrent called after ") + } + if concurrent <= 0 { + concurrent = runtime.NumCPU() + } + + // Write to output + var errMu sync.Mutex + var aErr error + setErr := func(e error) (ok bool) { + errMu.Lock() + defer errMu.Unlock() + if e == nil { + return aErr == nil + } + if aErr == nil { + aErr = e + } + return false + } + hasErr := func() (ok bool) { + errMu.Lock() + v := aErr != nil + errMu.Unlock() + return v + } + + var aWritten int64 + toRead := make(chan []byte, concurrent) + writtenBlocks := make(chan []byte, concurrent) + queue := make(chan chan []byte, concurrent) + reUse := make(chan chan []byte, concurrent) + for i := 0; i < concurrent; i++ { + toRead <- make([]byte, 0, r.maxBufSize) + writtenBlocks <- make([]byte, 0, r.maxBufSize) + reUse <- make(chan []byte, 1) + } + // Writer + var wg sync.WaitGroup + wg.Add(1) + go func() { + defer wg.Done() + for toWrite := range queue { + entry := <-toWrite + reUse <- toWrite + if hasErr() { + writtenBlocks <- entry + continue + } + n, err := w.Write(entry) + want := len(entry) + writtenBlocks <- entry + if err != nil { + setErr(err) + continue + } + if n != want { + setErr(io.ErrShortWrite) + continue + } + aWritten += int64(n) + } + }() + + // Reader + defer func() { + close(queue) + if r.err != nil { + err = r.err + setErr(r.err) + } + wg.Wait() + if err == nil { + err = aErr + } + written = aWritten + }() + + for !hasErr() { + if !r.readFull(r.buf[:4], true) { + if r.err == io.EOF { + r.err = nil + } + return 0, r.err + } + chunkType := r.buf[0] + if !r.readHeader { + if chunkType != chunkTypeStreamIdentifier { + r.err = ErrCorrupt + return 0, r.err + } + r.readHeader = true + } + chunkLen := int(r.buf[1]) | int(r.buf[2])<<8 | int(r.buf[3])<<16 + + // The chunk types are specified at + // https://github.com/google/snappy/blob/master/framing_format.txt + switch chunkType { + case chunkTypeCompressedData: + r.blockStart += int64(r.j) + // Section 4.2. Compressed data (chunk type 0x00). + if chunkLen < checksumSize { + r.err = ErrCorrupt + return 0, r.err + } + if chunkLen > r.maxBufSize { + r.err = ErrCorrupt + return 0, r.err + } + orgBuf := <-toRead + buf := orgBuf[:chunkLen] + + if !r.readFull(buf, false) { + return 0, r.err + } + + checksum := uint32(buf[0]) | uint32(buf[1])<<8 | uint32(buf[2])<<16 | uint32(buf[3])<<24 + buf = buf[checksumSize:] + + n, err := DecodedLen(buf) + if err != nil { + r.err = err + return 0, r.err + } + if r.snappyFrame && n > maxSnappyBlockSize { + r.err = ErrCorrupt + return 0, r.err + } + + if n > r.maxBlock { + r.err = ErrCorrupt + return 0, r.err + } + wg.Add(1) + + decoded := <-writtenBlocks + entry := <-reUse + queue <- entry + go func() { + defer wg.Done() + decoded = decoded[:n] + _, err := Decode(decoded, buf) + toRead <- orgBuf + if err != nil { + writtenBlocks <- decoded + setErr(err) + return + } + if !r.ignoreCRC && crc(decoded) != checksum { + writtenBlocks <- decoded + setErr(ErrCRC) + return + } + entry <- decoded + }() + continue + + case chunkTypeUncompressedData: + + // Section 4.3. Uncompressed data (chunk type 0x01). + if chunkLen < checksumSize { + r.err = ErrCorrupt + return 0, r.err + } + if chunkLen > r.maxBufSize { + r.err = ErrCorrupt + return 0, r.err + } + // Grab write buffer + orgBuf := <-writtenBlocks + buf := orgBuf[:checksumSize] + if !r.readFull(buf, false) { + return 0, r.err + } + checksum := uint32(buf[0]) | uint32(buf[1])<<8 | uint32(buf[2])<<16 | uint32(buf[3])<<24 + // Read content. + n := chunkLen - checksumSize + + if r.snappyFrame && n > maxSnappyBlockSize { + r.err = ErrCorrupt + return 0, r.err + } + if n > r.maxBlock { + r.err = ErrCorrupt + return 0, r.err + } + // Read uncompressed + buf = orgBuf[:n] + if !r.readFull(buf, false) { + return 0, r.err + } + + if !r.ignoreCRC && crc(buf) != checksum { + r.err = ErrCRC + return 0, r.err + } + entry := <-reUse + queue <- entry + entry <- buf + continue + + case chunkTypeStreamIdentifier: + // Section 4.1. Stream identifier (chunk type 0xff). + if chunkLen != len(magicBody) { + r.err = ErrCorrupt + return 0, r.err + } + if !r.readFull(r.buf[:len(magicBody)], false) { + return 0, r.err + } + if string(r.buf[:len(magicBody)]) != magicBody { + if string(r.buf[:len(magicBody)]) != magicBodySnappy { + r.err = ErrCorrupt + return 0, r.err + } else { + r.snappyFrame = true + } + } else { + r.snappyFrame = false + } + continue + } + + if chunkType <= 0x7f { + // Section 4.5. Reserved unskippable chunks (chunk types 0x02-0x7f). + // fmt.Printf("ERR chunktype: 0x%x\n", chunkType) + r.err = ErrUnsupported + return 0, r.err + } + // Section 4.4 Padding (chunk type 0xfe). + // Section 4.6. Reserved skippable chunks (chunk types 0x80-0xfd). + if chunkLen > maxChunkSize { + // fmt.Printf("ERR chunkLen: 0x%x\n", chunkLen) + r.err = ErrUnsupported + return 0, r.err + } + + // fmt.Printf("skippable: ID: 0x%x, len: 0x%x\n", chunkType, chunkLen) + if !r.skippable(r.buf, chunkLen, false, chunkType) { + return 0, r.err + } + } + return 0, r.err +} + // Skip will skip n bytes forward in the decompressed output. // For larger skips this consumes less CPU and is faster than reading output and discarding it. // CRC is not checked on skipped blocks. @@ -454,7 +720,11 @@ func (r *Reader) Skip(n int64) error { // decoded[i:j] contains decoded bytes that have not yet been passed on. left := int64(r.j - r.i) if left >= n { - r.i += int(n) + tmp := int64(r.i) + n + if tmp > math.MaxInt32 { + return errors.New("s2: internal overflow in skip") + } + r.i = int(tmp) return nil } n -= int64(r.j - r.i) @@ -526,6 +796,7 @@ func (r *Reader) Skip(n int64) error { } else { // Skip block completely n -= int64(dLen) + r.blockStart += int64(dLen) dLen = 0 } r.i, r.j = 0, dLen @@ -656,6 +927,15 @@ func (r *Reader) ReadSeeker(random bool, index []byte) (*ReadSeeker, error) { err = r.index.LoadStream(rs) if err != nil { if err == ErrUnsupported { + // If we don't require random seeking, reset input and return. + if !random { + _, err = rs.Seek(pos, io.SeekStart) + if err != nil { + return nil, ErrCantSeek{Reason: "resetting stream returned: " + err.Error()} + } + r.index = nil + return &ReadSeeker{Reader: r}, nil + } return nil, ErrCantSeek{Reason: "input stream does not contain an index"} } return nil, ErrCantSeek{Reason: "reading index returned: " + err.Error()} @@ -699,8 +979,16 @@ func (r *ReadSeeker) Seek(offset int64, whence int) (int64, error) { case io.SeekCurrent: offset += r.blockStart + int64(r.i) case io.SeekEnd: - offset = -offset + if offset > 0 { + return 0, errors.New("seek after end of file") + } + offset = r.index.TotalUncompressed + offset + } + + if offset < 0 { + return 0, errors.New("seek before start of file") } + c, u, err := r.index.Find(offset) if err != nil { return r.blockStart + int64(r.i), err @@ -712,10 +1000,6 @@ func (r *ReadSeeker) Seek(offset int64, whence int) (int64, error) { return 0, err } - if offset < 0 { - offset = r.index.TotalUncompressed + offset - } - r.i = r.j // Remove rest of current block. if u < offset { // Forward inside block diff --git a/vendor/github.com/klauspost/compress/s2/encode.go b/vendor/github.com/klauspost/compress/s2/encode.go index 59f992ca6..1aefabf31 100644 --- a/vendor/github.com/klauspost/compress/s2/encode.go +++ b/vendor/github.com/klauspost/compress/s2/encode.go @@ -1119,12 +1119,6 @@ func (w *Writer) closeIndex(idx bool) ([]byte, error) { if w.appendIndex { w.written += int64(len(index)) } - if true { - _, err := w.index.Load(index) - if err != nil { - panic(err) - } - } } if w.pad > 1 { diff --git a/vendor/github.com/klauspost/compress/s2/encode_best.go b/vendor/github.com/klauspost/compress/s2/encode_best.go index 448034776..4bc80bc6a 100644 --- a/vendor/github.com/klauspost/compress/s2/encode_best.go +++ b/vendor/github.com/klauspost/compress/s2/encode_best.go @@ -370,7 +370,7 @@ func encodeBlockBestSnappy(dst, src []byte) (d int) { } offset := m.s - m.offset - return score - emitCopySize(offset, m.length) + return score - emitCopyNoRepeatSize(offset, m.length) } matchAt := func(offset, s int, first uint32) match { @@ -567,6 +567,10 @@ func emitCopySize(offset, length int) int { // Offset no more than 2 bytes. if length > 64 { + if offset < 2048 { + // Emit 8 bytes, then rest as repeats... + return 2 + emitRepeatSize(offset, length-8) + } // Emit remaining as repeats, at least 4 bytes remain. return 3 + emitRepeatSize(offset, length-60) } @@ -577,6 +581,28 @@ func emitCopySize(offset, length int) int { return 2 } +// emitCopyNoRepeatSize returns the size to encode the offset+length +// +// It assumes that: +// 1 <= offset && offset <= math.MaxUint32 +// 4 <= length && length <= 1 << 24 +func emitCopyNoRepeatSize(offset, length int) int { + if offset >= 65536 { + return 5 + 5*(length/64) + } + + // Offset no more than 2 bytes. + if length > 64 { + // Emit remaining as repeats, at least 4 bytes remain. + return 3 + 3*(length/60) + } + if length >= 12 || offset >= 2048 { + return 3 + } + // Emit the remaining copy, encoded as 2 bytes. + return 2 +} + // emitRepeatSize returns the number of bytes required to encode a repeat. // Length must be at least 4 and < 1<<24 func emitRepeatSize(offset, length int) int { diff --git a/vendor/github.com/klauspost/compress/s2/encode_go.go b/vendor/github.com/klauspost/compress/s2/encode_go.go index 43d43534e..94784b82a 100644 --- a/vendor/github.com/klauspost/compress/s2/encode_go.go +++ b/vendor/github.com/klauspost/compress/s2/encode_go.go @@ -180,14 +180,23 @@ func emitCopy(dst []byte, offset, length int) int { // Offset no more than 2 bytes. if length > 64 { - // Emit a length 60 copy, encoded as 3 bytes. - // Emit remaining as repeat value (minimum 4 bytes). - dst[2] = uint8(offset >> 8) - dst[1] = uint8(offset) - dst[0] = 59<<2 | tagCopy2 - length -= 60 + off := 3 + if offset < 2048 { + // emit 8 bytes as tagCopy1, rest as repeats. + dst[1] = uint8(offset) + dst[0] = uint8(offset>>8)<<5 | uint8(8-4)<<2 | tagCopy1 + length -= 8 + off = 2 + } else { + // Emit a length 60 copy, encoded as 3 bytes. + // Emit remaining as repeat value (minimum 4 bytes). + dst[2] = uint8(offset >> 8) + dst[1] = uint8(offset) + dst[0] = 59<<2 | tagCopy2 + length -= 60 + } // Emit remaining as repeats, at least 4 bytes remain. - return 3 + emitRepeat(dst[3:], offset, length) + return off + emitRepeat(dst[off:], offset, length) } if length >= 12 || offset >= 2048 { // Emit the remaining copy, encoded as 3 bytes. diff --git a/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.go b/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.go index d9312e5b9..88f27c099 100644 --- a/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.go +++ b/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.go @@ -5,6 +5,8 @@ package s2 +func _dummy_() + // encodeBlockAsm encodes a non-empty src to a guaranteed-large-enough dst. // Maximum input 4294967295 bytes. // It assumes that the varint-encoded length of the decompressed bytes has already been written. diff --git a/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.s b/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.s index 729dbf536..36915d949 100644 --- a/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.s +++ b/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.s @@ -5,6 +5,15 @@ #include "textflag.h" +// func _dummy_() +TEXT ·_dummy_(SB), $0 +#ifdef GOAMD64_v4 +#ifndef GOAMD64_v3 +#define GOAMD64_v3 +#endif +#endif + RET + // func encodeBlockAsm(dst []byte, src []byte) int // Requires: BMI, SSE2 TEXT ·encodeBlockAsm(SB), $65560-56 @@ -253,17 +262,6 @@ matchlen_loopback_repeat_extend_encodeBlockAsm: #ifdef GOAMD64_v3 TZCNTQ R11, R11 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R11, R11 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R11, R11 @@ -476,6 +474,90 @@ four_bytes_remain_repeat_as_copy_encodeBlockAsm: two_byte_offset_repeat_as_copy_encodeBlockAsm: CMPL SI, $0x40 JLE two_byte_offset_short_repeat_as_copy_encodeBlockAsm + CMPL DI, $0x00000800 + JAE long_offset_short_repeat_as_copy_encodeBlockAsm + MOVL $0x00000001, R8 + LEAL 16(R8), R8 + MOVB DI, 1(AX) + MOVL DI, R9 + SHRL $0x08, R9 + SHLL $0x05, R9 + ORL R9, R8 + MOVB R8, (AX) + ADDQ $0x02, AX + SUBL $0x08, SI + + // emitRepeat + LEAL -4(SI), SI + JMP cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b + +emit_repeat_again_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: + MOVL SI, R8 + LEAL -4(SI), SI + CMPL R8, $0x08 + JLE repeat_two_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b + CMPL R8, $0x0c + JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b + CMPL DI, $0x00000800 + JLT repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b + +cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: + CMPL SI, $0x00000104 + JLT repeat_three_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b + CMPL SI, $0x00010100 + JLT repeat_four_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b + CMPL SI, $0x0100ffff + JLT repeat_five_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b + LEAL -16842747(SI), SI + MOVW $0x001d, (AX) + MOVW $0xfffb, 2(AX) + MOVB $0xff, 4(AX) + ADDQ $0x05, AX + JMP emit_repeat_again_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b + +repeat_five_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: + LEAL -65536(SI), SI + MOVL SI, DI + MOVW $0x001d, (AX) + MOVW SI, 2(AX) + SARL $0x10, DI + MOVB DI, 4(AX) + ADDQ $0x05, AX + JMP repeat_end_emit_encodeBlockAsm + +repeat_four_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: + LEAL -256(SI), SI + MOVW $0x0019, (AX) + MOVW SI, 2(AX) + ADDQ $0x04, AX + JMP repeat_end_emit_encodeBlockAsm + +repeat_three_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: + LEAL -4(SI), SI + MOVW $0x0015, (AX) + MOVB SI, 2(AX) + ADDQ $0x03, AX + JMP repeat_end_emit_encodeBlockAsm + +repeat_two_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: + SHLL $0x02, SI + ORL $0x01, SI + MOVW SI, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeBlockAsm + +repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: + XORQ R8, R8 + LEAL 1(R8)(SI*4), SI + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, SI + MOVB SI, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeBlockAsm + +long_offset_short_repeat_as_copy_encodeBlockAsm: MOVB $0xee, (AX) MOVW DI, 1(AX) LEAL -60(SI), SI @@ -791,17 +873,6 @@ matchlen_loopback_match_nolit_encodeBlockAsm: #ifdef GOAMD64_v3 TZCNTQ R9, R9 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R9, R9 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R9, R9 @@ -944,6 +1015,90 @@ four_bytes_remain_match_nolit_encodeBlockAsm: two_byte_offset_match_nolit_encodeBlockAsm: CMPL R10, $0x40 JLE two_byte_offset_short_match_nolit_encodeBlockAsm + CMPL SI, $0x00000800 + JAE long_offset_short_match_nolit_encodeBlockAsm + MOVL $0x00000001, DI + LEAL 16(DI), DI + MOVB SI, 1(AX) + MOVL SI, R8 + SHRL $0x08, R8 + SHLL $0x05, R8 + ORL R8, DI + MOVB DI, (AX) + ADDQ $0x02, AX + SUBL $0x08, R10 + + // emitRepeat + LEAL -4(R10), R10 + JMP cant_repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy_short_2b + +emit_repeat_again_match_nolit_encodeBlockAsm_emit_copy_short_2b: + MOVL R10, DI + LEAL -4(R10), R10 + CMPL DI, $0x08 + JLE repeat_two_match_nolit_encodeBlockAsm_emit_copy_short_2b + CMPL DI, $0x0c + JGE cant_repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy_short_2b + CMPL SI, $0x00000800 + JLT repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy_short_2b + +cant_repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy_short_2b: + CMPL R10, $0x00000104 + JLT repeat_three_match_nolit_encodeBlockAsm_emit_copy_short_2b + CMPL R10, $0x00010100 + JLT repeat_four_match_nolit_encodeBlockAsm_emit_copy_short_2b + CMPL R10, $0x0100ffff + JLT repeat_five_match_nolit_encodeBlockAsm_emit_copy_short_2b + LEAL -16842747(R10), R10 + MOVW $0x001d, (AX) + MOVW $0xfffb, 2(AX) + MOVB $0xff, 4(AX) + ADDQ $0x05, AX + JMP emit_repeat_again_match_nolit_encodeBlockAsm_emit_copy_short_2b + +repeat_five_match_nolit_encodeBlockAsm_emit_copy_short_2b: + LEAL -65536(R10), R10 + MOVL R10, SI + MOVW $0x001d, (AX) + MOVW R10, 2(AX) + SARL $0x10, SI + MOVB SI, 4(AX) + ADDQ $0x05, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm + +repeat_four_match_nolit_encodeBlockAsm_emit_copy_short_2b: + LEAL -256(R10), R10 + MOVW $0x0019, (AX) + MOVW R10, 2(AX) + ADDQ $0x04, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm + +repeat_three_match_nolit_encodeBlockAsm_emit_copy_short_2b: + LEAL -4(R10), R10 + MOVW $0x0015, (AX) + MOVB R10, 2(AX) + ADDQ $0x03, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm + +repeat_two_match_nolit_encodeBlockAsm_emit_copy_short_2b: + SHLL $0x02, R10 + ORL $0x01, R10 + MOVW R10, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm + +repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy_short_2b: + XORQ DI, DI + LEAL 1(DI)(R10*4), R10 + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, R10 + MOVB R10, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm + +long_offset_short_match_nolit_encodeBlockAsm: MOVB $0xee, (AX) MOVW SI, 1(AX) LEAL -60(R10), R10 @@ -1134,17 +1289,36 @@ memmove_emit_remainder_encodeBlockAsm: MOVL SI, BX // genMemMoveShort + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeBlockAsm_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeBlockAsm_memmove_move_3 CMPQ BX, $0x08 - JLE emit_lit_memmove_emit_remainder_encodeBlockAsm_memmove_move_8 + JB emit_lit_memmove_emit_remainder_encodeBlockAsm_memmove_move_4through7 CMPQ BX, $0x10 JBE emit_lit_memmove_emit_remainder_encodeBlockAsm_memmove_move_8through16 CMPQ BX, $0x20 JBE emit_lit_memmove_emit_remainder_encodeBlockAsm_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeBlockAsm_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeBlockAsm_memmove_move_8: - MOVQ (CX), SI - MOVQ SI, (AX) +emit_lit_memmove_emit_remainder_encodeBlockAsm_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeBlockAsm + +emit_lit_memmove_emit_remainder_encodeBlockAsm_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) + JMP memmove_end_copy_emit_remainder_encodeBlockAsm + +emit_lit_memmove_emit_remainder_encodeBlockAsm_memmove_move_4through7: + MOVL (CX), SI + MOVL -4(CX)(BX*1), CX + MOVL SI, (AX) + MOVL CX, -4(AX)(BX*1) JMP memmove_end_copy_emit_remainder_encodeBlockAsm emit_lit_memmove_emit_remainder_encodeBlockAsm_memmove_move_8through16: @@ -1466,17 +1640,6 @@ matchlen_loopback_repeat_extend_encodeBlockAsm4MB: #ifdef GOAMD64_v3 TZCNTQ R11, R11 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R11, R11 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R11, R11 @@ -1667,6 +1830,77 @@ four_bytes_remain_repeat_as_copy_encodeBlockAsm4MB: two_byte_offset_repeat_as_copy_encodeBlockAsm4MB: CMPL SI, $0x40 JLE two_byte_offset_short_repeat_as_copy_encodeBlockAsm4MB + CMPL DI, $0x00000800 + JAE long_offset_short_repeat_as_copy_encodeBlockAsm4MB + MOVL $0x00000001, R8 + LEAL 16(R8), R8 + MOVB DI, 1(AX) + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, R8 + MOVB R8, (AX) + ADDQ $0x02, AX + SUBL $0x08, SI + + // emitRepeat + LEAL -4(SI), SI + JMP cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b + MOVL SI, R8 + LEAL -4(SI), SI + CMPL R8, $0x08 + JLE repeat_two_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b + CMPL R8, $0x0c + JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b + CMPL DI, $0x00000800 + JLT repeat_two_offset_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b + +cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b: + CMPL SI, $0x00000104 + JLT repeat_three_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b + CMPL SI, $0x00010100 + JLT repeat_four_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b + LEAL -65536(SI), SI + MOVL SI, DI + MOVW $0x001d, (AX) + MOVW SI, 2(AX) + SARL $0x10, DI + MOVB DI, 4(AX) + ADDQ $0x05, AX + JMP repeat_end_emit_encodeBlockAsm4MB + +repeat_four_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b: + LEAL -256(SI), SI + MOVW $0x0019, (AX) + MOVW SI, 2(AX) + ADDQ $0x04, AX + JMP repeat_end_emit_encodeBlockAsm4MB + +repeat_three_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b: + LEAL -4(SI), SI + MOVW $0x0015, (AX) + MOVB SI, 2(AX) + ADDQ $0x03, AX + JMP repeat_end_emit_encodeBlockAsm4MB + +repeat_two_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b: + SHLL $0x02, SI + ORL $0x01, SI + MOVW SI, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeBlockAsm4MB + +repeat_two_offset_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b: + XORQ R8, R8 + LEAL 1(R8)(SI*4), SI + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, SI + MOVB SI, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeBlockAsm4MB + +long_offset_short_repeat_as_copy_encodeBlockAsm4MB: MOVB $0xee, (AX) MOVW DI, 1(AX) LEAL -60(SI), SI @@ -1963,17 +2197,6 @@ matchlen_loopback_match_nolit_encodeBlockAsm4MB: #ifdef GOAMD64_v3 TZCNTQ R9, R9 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R9, R9 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R9, R9 @@ -2105,6 +2328,77 @@ four_bytes_remain_match_nolit_encodeBlockAsm4MB: two_byte_offset_match_nolit_encodeBlockAsm4MB: CMPL R10, $0x40 JLE two_byte_offset_short_match_nolit_encodeBlockAsm4MB + CMPL SI, $0x00000800 + JAE long_offset_short_match_nolit_encodeBlockAsm4MB + MOVL $0x00000001, DI + LEAL 16(DI), DI + MOVB SI, 1(AX) + SHRL $0x08, SI + SHLL $0x05, SI + ORL SI, DI + MOVB DI, (AX) + ADDQ $0x02, AX + SUBL $0x08, R10 + + // emitRepeat + LEAL -4(R10), R10 + JMP cant_repeat_two_offset_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b + MOVL R10, DI + LEAL -4(R10), R10 + CMPL DI, $0x08 + JLE repeat_two_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b + CMPL DI, $0x0c + JGE cant_repeat_two_offset_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b + CMPL SI, $0x00000800 + JLT repeat_two_offset_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b + +cant_repeat_two_offset_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b: + CMPL R10, $0x00000104 + JLT repeat_three_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b + CMPL R10, $0x00010100 + JLT repeat_four_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b + LEAL -65536(R10), R10 + MOVL R10, SI + MOVW $0x001d, (AX) + MOVW R10, 2(AX) + SARL $0x10, SI + MOVB SI, 4(AX) + ADDQ $0x05, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm4MB + +repeat_four_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b: + LEAL -256(R10), R10 + MOVW $0x0019, (AX) + MOVW R10, 2(AX) + ADDQ $0x04, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm4MB + +repeat_three_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b: + LEAL -4(R10), R10 + MOVW $0x0015, (AX) + MOVB R10, 2(AX) + ADDQ $0x03, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm4MB + +repeat_two_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b: + SHLL $0x02, R10 + ORL $0x01, R10 + MOVW R10, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm4MB + +repeat_two_offset_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b: + XORQ DI, DI + LEAL 1(DI)(R10*4), R10 + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, R10 + MOVB R10, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm4MB + +long_offset_short_match_nolit_encodeBlockAsm4MB: MOVB $0xee, (AX) MOVW SI, 1(AX) LEAL -60(R10), R10 @@ -2276,17 +2570,36 @@ memmove_emit_remainder_encodeBlockAsm4MB: MOVL SI, BX // genMemMoveShort + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeBlockAsm4MB_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeBlockAsm4MB_memmove_move_3 CMPQ BX, $0x08 - JLE emit_lit_memmove_emit_remainder_encodeBlockAsm4MB_memmove_move_8 + JB emit_lit_memmove_emit_remainder_encodeBlockAsm4MB_memmove_move_4through7 CMPQ BX, $0x10 JBE emit_lit_memmove_emit_remainder_encodeBlockAsm4MB_memmove_move_8through16 CMPQ BX, $0x20 JBE emit_lit_memmove_emit_remainder_encodeBlockAsm4MB_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeBlockAsm4MB_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeBlockAsm4MB_memmove_move_8: - MOVQ (CX), SI - MOVQ SI, (AX) +emit_lit_memmove_emit_remainder_encodeBlockAsm4MB_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeBlockAsm4MB + +emit_lit_memmove_emit_remainder_encodeBlockAsm4MB_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) + JMP memmove_end_copy_emit_remainder_encodeBlockAsm4MB + +emit_lit_memmove_emit_remainder_encodeBlockAsm4MB_memmove_move_4through7: + MOVL (CX), SI + MOVL -4(CX)(BX*1), CX + MOVL SI, (AX) + MOVL CX, -4(AX)(BX*1) JMP memmove_end_copy_emit_remainder_encodeBlockAsm4MB emit_lit_memmove_emit_remainder_encodeBlockAsm4MB_memmove_move_8through16: @@ -2597,17 +2910,6 @@ matchlen_loopback_repeat_extend_encodeBlockAsm12B: #ifdef GOAMD64_v3 TZCNTQ R11, R11 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R11, R11 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R11, R11 @@ -2706,6 +3008,65 @@ repeat_as_copy_encodeBlockAsm12B: two_byte_offset_repeat_as_copy_encodeBlockAsm12B: CMPL SI, $0x40 JLE two_byte_offset_short_repeat_as_copy_encodeBlockAsm12B + CMPL DI, $0x00000800 + JAE long_offset_short_repeat_as_copy_encodeBlockAsm12B + MOVL $0x00000001, R8 + LEAL 16(R8), R8 + MOVB DI, 1(AX) + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, R8 + MOVB R8, (AX) + ADDQ $0x02, AX + SUBL $0x08, SI + + // emitRepeat + LEAL -4(SI), SI + JMP cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm12B_emit_copy_short_2b + MOVL SI, R8 + LEAL -4(SI), SI + CMPL R8, $0x08 + JLE repeat_two_repeat_as_copy_encodeBlockAsm12B_emit_copy_short_2b + CMPL R8, $0x0c + JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm12B_emit_copy_short_2b + CMPL DI, $0x00000800 + JLT repeat_two_offset_repeat_as_copy_encodeBlockAsm12B_emit_copy_short_2b + +cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm12B_emit_copy_short_2b: + CMPL SI, $0x00000104 + JLT repeat_three_repeat_as_copy_encodeBlockAsm12B_emit_copy_short_2b + LEAL -256(SI), SI + MOVW $0x0019, (AX) + MOVW SI, 2(AX) + ADDQ $0x04, AX + JMP repeat_end_emit_encodeBlockAsm12B + +repeat_three_repeat_as_copy_encodeBlockAsm12B_emit_copy_short_2b: + LEAL -4(SI), SI + MOVW $0x0015, (AX) + MOVB SI, 2(AX) + ADDQ $0x03, AX + JMP repeat_end_emit_encodeBlockAsm12B + +repeat_two_repeat_as_copy_encodeBlockAsm12B_emit_copy_short_2b: + SHLL $0x02, SI + ORL $0x01, SI + MOVW SI, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeBlockAsm12B + +repeat_two_offset_repeat_as_copy_encodeBlockAsm12B_emit_copy_short_2b: + XORQ R8, R8 + LEAL 1(R8)(SI*4), SI + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, SI + MOVB SI, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeBlockAsm12B + +long_offset_short_repeat_as_copy_encodeBlockAsm12B: MOVB $0xee, (AX) MOVW DI, 1(AX) LEAL -60(SI), SI @@ -2979,17 +3340,6 @@ matchlen_loopback_match_nolit_encodeBlockAsm12B: #ifdef GOAMD64_v3 TZCNTQ R9, R9 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R9, R9 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R9, R9 @@ -3041,6 +3391,65 @@ match_nolit_end_encodeBlockAsm12B: two_byte_offset_match_nolit_encodeBlockAsm12B: CMPL R10, $0x40 JLE two_byte_offset_short_match_nolit_encodeBlockAsm12B + CMPL SI, $0x00000800 + JAE long_offset_short_match_nolit_encodeBlockAsm12B + MOVL $0x00000001, DI + LEAL 16(DI), DI + MOVB SI, 1(AX) + SHRL $0x08, SI + SHLL $0x05, SI + ORL SI, DI + MOVB DI, (AX) + ADDQ $0x02, AX + SUBL $0x08, R10 + + // emitRepeat + LEAL -4(R10), R10 + JMP cant_repeat_two_offset_match_nolit_encodeBlockAsm12B_emit_copy_short_2b + MOVL R10, DI + LEAL -4(R10), R10 + CMPL DI, $0x08 + JLE repeat_two_match_nolit_encodeBlockAsm12B_emit_copy_short_2b + CMPL DI, $0x0c + JGE cant_repeat_two_offset_match_nolit_encodeBlockAsm12B_emit_copy_short_2b + CMPL SI, $0x00000800 + JLT repeat_two_offset_match_nolit_encodeBlockAsm12B_emit_copy_short_2b + +cant_repeat_two_offset_match_nolit_encodeBlockAsm12B_emit_copy_short_2b: + CMPL R10, $0x00000104 + JLT repeat_three_match_nolit_encodeBlockAsm12B_emit_copy_short_2b + LEAL -256(R10), R10 + MOVW $0x0019, (AX) + MOVW R10, 2(AX) + ADDQ $0x04, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm12B + +repeat_three_match_nolit_encodeBlockAsm12B_emit_copy_short_2b: + LEAL -4(R10), R10 + MOVW $0x0015, (AX) + MOVB R10, 2(AX) + ADDQ $0x03, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm12B + +repeat_two_match_nolit_encodeBlockAsm12B_emit_copy_short_2b: + SHLL $0x02, R10 + ORL $0x01, R10 + MOVW R10, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm12B + +repeat_two_offset_match_nolit_encodeBlockAsm12B_emit_copy_short_2b: + XORQ DI, DI + LEAL 1(DI)(R10*4), R10 + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, R10 + MOVB R10, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm12B + +long_offset_short_match_nolit_encodeBlockAsm12B: MOVB $0xee, (AX) MOVW SI, 1(AX) LEAL -60(R10), R10 @@ -3189,17 +3598,36 @@ memmove_emit_remainder_encodeBlockAsm12B: MOVL SI, BX // genMemMoveShort + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeBlockAsm12B_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeBlockAsm12B_memmove_move_3 CMPQ BX, $0x08 - JLE emit_lit_memmove_emit_remainder_encodeBlockAsm12B_memmove_move_8 + JB emit_lit_memmove_emit_remainder_encodeBlockAsm12B_memmove_move_4through7 CMPQ BX, $0x10 JBE emit_lit_memmove_emit_remainder_encodeBlockAsm12B_memmove_move_8through16 CMPQ BX, $0x20 JBE emit_lit_memmove_emit_remainder_encodeBlockAsm12B_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeBlockAsm12B_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeBlockAsm12B_memmove_move_8: - MOVQ (CX), SI - MOVQ SI, (AX) +emit_lit_memmove_emit_remainder_encodeBlockAsm12B_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeBlockAsm12B + +emit_lit_memmove_emit_remainder_encodeBlockAsm12B_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) + JMP memmove_end_copy_emit_remainder_encodeBlockAsm12B + +emit_lit_memmove_emit_remainder_encodeBlockAsm12B_memmove_move_4through7: + MOVL (CX), SI + MOVL -4(CX)(BX*1), CX + MOVL SI, (AX) + MOVL CX, -4(AX)(BX*1) JMP memmove_end_copy_emit_remainder_encodeBlockAsm12B emit_lit_memmove_emit_remainder_encodeBlockAsm12B_memmove_move_8through16: @@ -3510,17 +3938,6 @@ matchlen_loopback_repeat_extend_encodeBlockAsm10B: #ifdef GOAMD64_v3 TZCNTQ R11, R11 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R11, R11 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R11, R11 @@ -3619,6 +4036,65 @@ repeat_as_copy_encodeBlockAsm10B: two_byte_offset_repeat_as_copy_encodeBlockAsm10B: CMPL SI, $0x40 JLE two_byte_offset_short_repeat_as_copy_encodeBlockAsm10B + CMPL DI, $0x00000800 + JAE long_offset_short_repeat_as_copy_encodeBlockAsm10B + MOVL $0x00000001, R8 + LEAL 16(R8), R8 + MOVB DI, 1(AX) + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, R8 + MOVB R8, (AX) + ADDQ $0x02, AX + SUBL $0x08, SI + + // emitRepeat + LEAL -4(SI), SI + JMP cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm10B_emit_copy_short_2b + MOVL SI, R8 + LEAL -4(SI), SI + CMPL R8, $0x08 + JLE repeat_two_repeat_as_copy_encodeBlockAsm10B_emit_copy_short_2b + CMPL R8, $0x0c + JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm10B_emit_copy_short_2b + CMPL DI, $0x00000800 + JLT repeat_two_offset_repeat_as_copy_encodeBlockAsm10B_emit_copy_short_2b + +cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm10B_emit_copy_short_2b: + CMPL SI, $0x00000104 + JLT repeat_three_repeat_as_copy_encodeBlockAsm10B_emit_copy_short_2b + LEAL -256(SI), SI + MOVW $0x0019, (AX) + MOVW SI, 2(AX) + ADDQ $0x04, AX + JMP repeat_end_emit_encodeBlockAsm10B + +repeat_three_repeat_as_copy_encodeBlockAsm10B_emit_copy_short_2b: + LEAL -4(SI), SI + MOVW $0x0015, (AX) + MOVB SI, 2(AX) + ADDQ $0x03, AX + JMP repeat_end_emit_encodeBlockAsm10B + +repeat_two_repeat_as_copy_encodeBlockAsm10B_emit_copy_short_2b: + SHLL $0x02, SI + ORL $0x01, SI + MOVW SI, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeBlockAsm10B + +repeat_two_offset_repeat_as_copy_encodeBlockAsm10B_emit_copy_short_2b: + XORQ R8, R8 + LEAL 1(R8)(SI*4), SI + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, SI + MOVB SI, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeBlockAsm10B + +long_offset_short_repeat_as_copy_encodeBlockAsm10B: MOVB $0xee, (AX) MOVW DI, 1(AX) LEAL -60(SI), SI @@ -3892,17 +4368,6 @@ matchlen_loopback_match_nolit_encodeBlockAsm10B: #ifdef GOAMD64_v3 TZCNTQ R9, R9 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R9, R9 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R9, R9 @@ -3954,6 +4419,65 @@ match_nolit_end_encodeBlockAsm10B: two_byte_offset_match_nolit_encodeBlockAsm10B: CMPL R10, $0x40 JLE two_byte_offset_short_match_nolit_encodeBlockAsm10B + CMPL SI, $0x00000800 + JAE long_offset_short_match_nolit_encodeBlockAsm10B + MOVL $0x00000001, DI + LEAL 16(DI), DI + MOVB SI, 1(AX) + SHRL $0x08, SI + SHLL $0x05, SI + ORL SI, DI + MOVB DI, (AX) + ADDQ $0x02, AX + SUBL $0x08, R10 + + // emitRepeat + LEAL -4(R10), R10 + JMP cant_repeat_two_offset_match_nolit_encodeBlockAsm10B_emit_copy_short_2b + MOVL R10, DI + LEAL -4(R10), R10 + CMPL DI, $0x08 + JLE repeat_two_match_nolit_encodeBlockAsm10B_emit_copy_short_2b + CMPL DI, $0x0c + JGE cant_repeat_two_offset_match_nolit_encodeBlockAsm10B_emit_copy_short_2b + CMPL SI, $0x00000800 + JLT repeat_two_offset_match_nolit_encodeBlockAsm10B_emit_copy_short_2b + +cant_repeat_two_offset_match_nolit_encodeBlockAsm10B_emit_copy_short_2b: + CMPL R10, $0x00000104 + JLT repeat_three_match_nolit_encodeBlockAsm10B_emit_copy_short_2b + LEAL -256(R10), R10 + MOVW $0x0019, (AX) + MOVW R10, 2(AX) + ADDQ $0x04, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm10B + +repeat_three_match_nolit_encodeBlockAsm10B_emit_copy_short_2b: + LEAL -4(R10), R10 + MOVW $0x0015, (AX) + MOVB R10, 2(AX) + ADDQ $0x03, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm10B + +repeat_two_match_nolit_encodeBlockAsm10B_emit_copy_short_2b: + SHLL $0x02, R10 + ORL $0x01, R10 + MOVW R10, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm10B + +repeat_two_offset_match_nolit_encodeBlockAsm10B_emit_copy_short_2b: + XORQ DI, DI + LEAL 1(DI)(R10*4), R10 + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, R10 + MOVB R10, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm10B + +long_offset_short_match_nolit_encodeBlockAsm10B: MOVB $0xee, (AX) MOVW SI, 1(AX) LEAL -60(R10), R10 @@ -4102,17 +4626,36 @@ memmove_emit_remainder_encodeBlockAsm10B: MOVL SI, BX // genMemMoveShort + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeBlockAsm10B_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeBlockAsm10B_memmove_move_3 CMPQ BX, $0x08 - JLE emit_lit_memmove_emit_remainder_encodeBlockAsm10B_memmove_move_8 + JB emit_lit_memmove_emit_remainder_encodeBlockAsm10B_memmove_move_4through7 CMPQ BX, $0x10 JBE emit_lit_memmove_emit_remainder_encodeBlockAsm10B_memmove_move_8through16 CMPQ BX, $0x20 JBE emit_lit_memmove_emit_remainder_encodeBlockAsm10B_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeBlockAsm10B_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeBlockAsm10B_memmove_move_8: - MOVQ (CX), SI - MOVQ SI, (AX) +emit_lit_memmove_emit_remainder_encodeBlockAsm10B_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeBlockAsm10B + +emit_lit_memmove_emit_remainder_encodeBlockAsm10B_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) + JMP memmove_end_copy_emit_remainder_encodeBlockAsm10B + +emit_lit_memmove_emit_remainder_encodeBlockAsm10B_memmove_move_4through7: + MOVL (CX), SI + MOVL -4(CX)(BX*1), CX + MOVL SI, (AX) + MOVL CX, -4(AX)(BX*1) JMP memmove_end_copy_emit_remainder_encodeBlockAsm10B emit_lit_memmove_emit_remainder_encodeBlockAsm10B_memmove_move_8through16: @@ -4423,17 +4966,6 @@ matchlen_loopback_repeat_extend_encodeBlockAsm8B: #ifdef GOAMD64_v3 TZCNTQ R11, R11 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R11, R11 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R11, R11 @@ -4528,6 +5060,61 @@ repeat_as_copy_encodeBlockAsm8B: two_byte_offset_repeat_as_copy_encodeBlockAsm8B: CMPL SI, $0x40 JLE two_byte_offset_short_repeat_as_copy_encodeBlockAsm8B + CMPL DI, $0x00000800 + JAE long_offset_short_repeat_as_copy_encodeBlockAsm8B + MOVL $0x00000001, R8 + LEAL 16(R8), R8 + MOVB DI, 1(AX) + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, R8 + MOVB R8, (AX) + ADDQ $0x02, AX + SUBL $0x08, SI + + // emitRepeat + LEAL -4(SI), SI + JMP cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm8B_emit_copy_short_2b + MOVL SI, DI + LEAL -4(SI), SI + CMPL DI, $0x08 + JLE repeat_two_repeat_as_copy_encodeBlockAsm8B_emit_copy_short_2b + CMPL DI, $0x0c + JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm8B_emit_copy_short_2b + +cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm8B_emit_copy_short_2b: + CMPL SI, $0x00000104 + JLT repeat_three_repeat_as_copy_encodeBlockAsm8B_emit_copy_short_2b + LEAL -256(SI), SI + MOVW $0x0019, (AX) + MOVW SI, 2(AX) + ADDQ $0x04, AX + JMP repeat_end_emit_encodeBlockAsm8B + +repeat_three_repeat_as_copy_encodeBlockAsm8B_emit_copy_short_2b: + LEAL -4(SI), SI + MOVW $0x0015, (AX) + MOVB SI, 2(AX) + ADDQ $0x03, AX + JMP repeat_end_emit_encodeBlockAsm8B + +repeat_two_repeat_as_copy_encodeBlockAsm8B_emit_copy_short_2b: + SHLL $0x02, SI + ORL $0x01, SI + MOVW SI, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeBlockAsm8B + XORQ R8, R8 + LEAL 1(R8)(SI*4), SI + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, SI + MOVB SI, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeBlockAsm8B + +long_offset_short_repeat_as_copy_encodeBlockAsm8B: MOVB $0xee, (AX) MOVW DI, 1(AX) LEAL -60(SI), SI @@ -4795,17 +5382,6 @@ matchlen_loopback_match_nolit_encodeBlockAsm8B: #ifdef GOAMD64_v3 TZCNTQ R9, R9 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R9, R9 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R9, R9 @@ -4857,6 +5433,61 @@ match_nolit_end_encodeBlockAsm8B: two_byte_offset_match_nolit_encodeBlockAsm8B: CMPL R10, $0x40 JLE two_byte_offset_short_match_nolit_encodeBlockAsm8B + CMPL SI, $0x00000800 + JAE long_offset_short_match_nolit_encodeBlockAsm8B + MOVL $0x00000001, DI + LEAL 16(DI), DI + MOVB SI, 1(AX) + SHRL $0x08, SI + SHLL $0x05, SI + ORL SI, DI + MOVB DI, (AX) + ADDQ $0x02, AX + SUBL $0x08, R10 + + // emitRepeat + LEAL -4(R10), R10 + JMP cant_repeat_two_offset_match_nolit_encodeBlockAsm8B_emit_copy_short_2b + MOVL R10, SI + LEAL -4(R10), R10 + CMPL SI, $0x08 + JLE repeat_two_match_nolit_encodeBlockAsm8B_emit_copy_short_2b + CMPL SI, $0x0c + JGE cant_repeat_two_offset_match_nolit_encodeBlockAsm8B_emit_copy_short_2b + +cant_repeat_two_offset_match_nolit_encodeBlockAsm8B_emit_copy_short_2b: + CMPL R10, $0x00000104 + JLT repeat_three_match_nolit_encodeBlockAsm8B_emit_copy_short_2b + LEAL -256(R10), R10 + MOVW $0x0019, (AX) + MOVW R10, 2(AX) + ADDQ $0x04, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm8B + +repeat_three_match_nolit_encodeBlockAsm8B_emit_copy_short_2b: + LEAL -4(R10), R10 + MOVW $0x0015, (AX) + MOVB R10, 2(AX) + ADDQ $0x03, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm8B + +repeat_two_match_nolit_encodeBlockAsm8B_emit_copy_short_2b: + SHLL $0x02, R10 + ORL $0x01, R10 + MOVW R10, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm8B + XORQ DI, DI + LEAL 1(DI)(R10*4), R10 + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, R10 + MOVB R10, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm8B + +long_offset_short_match_nolit_encodeBlockAsm8B: MOVB $0xee, (AX) MOVW SI, 1(AX) LEAL -60(R10), R10 @@ -4999,17 +5630,36 @@ memmove_emit_remainder_encodeBlockAsm8B: MOVL SI, BX // genMemMoveShort + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeBlockAsm8B_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeBlockAsm8B_memmove_move_3 CMPQ BX, $0x08 - JLE emit_lit_memmove_emit_remainder_encodeBlockAsm8B_memmove_move_8 + JB emit_lit_memmove_emit_remainder_encodeBlockAsm8B_memmove_move_4through7 CMPQ BX, $0x10 JBE emit_lit_memmove_emit_remainder_encodeBlockAsm8B_memmove_move_8through16 CMPQ BX, $0x20 JBE emit_lit_memmove_emit_remainder_encodeBlockAsm8B_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeBlockAsm8B_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeBlockAsm8B_memmove_move_8: - MOVQ (CX), SI - MOVQ SI, (AX) +emit_lit_memmove_emit_remainder_encodeBlockAsm8B_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeBlockAsm8B + +emit_lit_memmove_emit_remainder_encodeBlockAsm8B_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) + JMP memmove_end_copy_emit_remainder_encodeBlockAsm8B + +emit_lit_memmove_emit_remainder_encodeBlockAsm8B_memmove_move_4through7: + MOVL (CX), SI + MOVL -4(CX)(BX*1), CX + MOVL SI, (AX) + MOVL CX, -4(AX)(BX*1) JMP memmove_end_copy_emit_remainder_encodeBlockAsm8B emit_lit_memmove_emit_remainder_encodeBlockAsm8B_memmove_move_8through16: @@ -5225,17 +5875,6 @@ matchlen_loopback_match_nolit_encodeBetterBlockAsm: #ifdef GOAMD64_v3 TZCNTQ R11, R11 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R11, R11 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R11, R11 @@ -5541,6 +6180,90 @@ four_bytes_remain_match_nolit_encodeBetterBlockAsm: two_byte_offset_match_nolit_encodeBetterBlockAsm: CMPL R12, $0x40 JLE two_byte_offset_short_match_nolit_encodeBetterBlockAsm + CMPL R8, $0x00000800 + JAE long_offset_short_match_nolit_encodeBetterBlockAsm + MOVL $0x00000001, SI + LEAL 16(SI), SI + MOVB R8, 1(AX) + MOVL R8, R9 + SHRL $0x08, R9 + SHLL $0x05, R9 + ORL R9, SI + MOVB SI, (AX) + ADDQ $0x02, AX + SUBL $0x08, R12 + + // emitRepeat + LEAL -4(R12), R12 + JMP cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b + +emit_repeat_again_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b: + MOVL R12, SI + LEAL -4(R12), R12 + CMPL SI, $0x08 + JLE repeat_two_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b + CMPL SI, $0x0c + JGE cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b + CMPL R8, $0x00000800 + JLT repeat_two_offset_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b + +cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b: + CMPL R12, $0x00000104 + JLT repeat_three_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b + CMPL R12, $0x00010100 + JLT repeat_four_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b + CMPL R12, $0x0100ffff + JLT repeat_five_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b + LEAL -16842747(R12), R12 + MOVW $0x001d, (AX) + MOVW $0xfffb, 2(AX) + MOVB $0xff, 4(AX) + ADDQ $0x05, AX + JMP emit_repeat_again_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b + +repeat_five_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b: + LEAL -65536(R12), R12 + MOVL R12, R8 + MOVW $0x001d, (AX) + MOVW R12, 2(AX) + SARL $0x10, R8 + MOVB R8, 4(AX) + ADDQ $0x05, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm + +repeat_four_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b: + LEAL -256(R12), R12 + MOVW $0x0019, (AX) + MOVW R12, 2(AX) + ADDQ $0x04, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm + +repeat_three_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b: + LEAL -4(R12), R12 + MOVW $0x0015, (AX) + MOVB R12, 2(AX) + ADDQ $0x03, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm + +repeat_two_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b: + SHLL $0x02, R12 + ORL $0x01, R12 + MOVW R12, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm + +repeat_two_offset_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b: + XORQ SI, SI + LEAL 1(SI)(R12*4), R12 + MOVB R8, 1(AX) + SARL $0x08, R8 + SHLL $0x05, R8 + ORL R8, R12 + MOVB R12, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm + +long_offset_short_match_nolit_encodeBetterBlockAsm: MOVB $0xee, (AX) MOVW R8, 1(AX) LEAL -60(R12), R12 @@ -5979,8 +6702,9 @@ memmove_emit_remainder_encodeBetterBlockAsm: MOVL SI, BX // genMemMoveShort - CMPQ BX, $0x04 - JLE emit_lit_memmove_emit_remainder_encodeBetterBlockAsm_memmove_move_4 + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeBetterBlockAsm_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeBetterBlockAsm_memmove_move_3 CMPQ BX, $0x08 JB emit_lit_memmove_emit_remainder_encodeBetterBlockAsm_memmove_move_4through7 CMPQ BX, $0x10 @@ -5989,9 +6713,18 @@ memmove_emit_remainder_encodeBetterBlockAsm: JBE emit_lit_memmove_emit_remainder_encodeBetterBlockAsm_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeBetterBlockAsm_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeBetterBlockAsm_memmove_move_4: - MOVL (CX), SI - MOVL SI, (AX) +emit_lit_memmove_emit_remainder_encodeBetterBlockAsm_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeBetterBlockAsm + +emit_lit_memmove_emit_remainder_encodeBetterBlockAsm_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) JMP memmove_end_copy_emit_remainder_encodeBetterBlockAsm emit_lit_memmove_emit_remainder_encodeBetterBlockAsm_memmove_move_4through7: @@ -6214,17 +6947,6 @@ matchlen_loopback_match_nolit_encodeBetterBlockAsm4MB: #ifdef GOAMD64_v3 TZCNTQ R11, R11 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R11, R11 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R11, R11 @@ -6511,6 +7233,77 @@ four_bytes_remain_match_nolit_encodeBetterBlockAsm4MB: two_byte_offset_match_nolit_encodeBetterBlockAsm4MB: CMPL R12, $0x40 JLE two_byte_offset_short_match_nolit_encodeBetterBlockAsm4MB + CMPL R8, $0x00000800 + JAE long_offset_short_match_nolit_encodeBetterBlockAsm4MB + MOVL $0x00000001, SI + LEAL 16(SI), SI + MOVB R8, 1(AX) + SHRL $0x08, R8 + SHLL $0x05, R8 + ORL R8, SI + MOVB SI, (AX) + ADDQ $0x02, AX + SUBL $0x08, R12 + + // emitRepeat + LEAL -4(R12), R12 + JMP cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b + MOVL R12, SI + LEAL -4(R12), R12 + CMPL SI, $0x08 + JLE repeat_two_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b + CMPL SI, $0x0c + JGE cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b + CMPL R8, $0x00000800 + JLT repeat_two_offset_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b + +cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b: + CMPL R12, $0x00000104 + JLT repeat_three_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b + CMPL R12, $0x00010100 + JLT repeat_four_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b + LEAL -65536(R12), R12 + MOVL R12, R8 + MOVW $0x001d, (AX) + MOVW R12, 2(AX) + SARL $0x10, R8 + MOVB R8, 4(AX) + ADDQ $0x05, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB + +repeat_four_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b: + LEAL -256(R12), R12 + MOVW $0x0019, (AX) + MOVW R12, 2(AX) + ADDQ $0x04, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB + +repeat_three_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b: + LEAL -4(R12), R12 + MOVW $0x0015, (AX) + MOVB R12, 2(AX) + ADDQ $0x03, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB + +repeat_two_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b: + SHLL $0x02, R12 + ORL $0x01, R12 + MOVW R12, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB + +repeat_two_offset_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b: + XORQ SI, SI + LEAL 1(SI)(R12*4), R12 + MOVB R8, 1(AX) + SARL $0x08, R8 + SHLL $0x05, R8 + ORL R8, R12 + MOVB R12, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB + +long_offset_short_match_nolit_encodeBetterBlockAsm4MB: MOVB $0xee, (AX) MOVW R8, 1(AX) LEAL -60(R12), R12 @@ -6911,8 +7704,9 @@ memmove_emit_remainder_encodeBetterBlockAsm4MB: MOVL SI, BX // genMemMoveShort - CMPQ BX, $0x04 - JLE emit_lit_memmove_emit_remainder_encodeBetterBlockAsm4MB_memmove_move_4 + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeBetterBlockAsm4MB_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeBetterBlockAsm4MB_memmove_move_3 CMPQ BX, $0x08 JB emit_lit_memmove_emit_remainder_encodeBetterBlockAsm4MB_memmove_move_4through7 CMPQ BX, $0x10 @@ -6921,9 +7715,18 @@ memmove_emit_remainder_encodeBetterBlockAsm4MB: JBE emit_lit_memmove_emit_remainder_encodeBetterBlockAsm4MB_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeBetterBlockAsm4MB_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeBetterBlockAsm4MB_memmove_move_4: - MOVL (CX), SI - MOVL SI, (AX) +emit_lit_memmove_emit_remainder_encodeBetterBlockAsm4MB_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeBetterBlockAsm4MB + +emit_lit_memmove_emit_remainder_encodeBetterBlockAsm4MB_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) JMP memmove_end_copy_emit_remainder_encodeBetterBlockAsm4MB emit_lit_memmove_emit_remainder_encodeBetterBlockAsm4MB_memmove_move_4through7: @@ -7138,17 +7941,6 @@ matchlen_loopback_match_nolit_encodeBetterBlockAsm12B: #ifdef GOAMD64_v3 TZCNTQ R11, R11 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R11, R11 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R11, R11 @@ -7335,6 +8127,65 @@ emit_literal_done_match_emit_encodeBetterBlockAsm12B: two_byte_offset_match_nolit_encodeBetterBlockAsm12B: CMPL R12, $0x40 JLE two_byte_offset_short_match_nolit_encodeBetterBlockAsm12B + CMPL R8, $0x00000800 + JAE long_offset_short_match_nolit_encodeBetterBlockAsm12B + MOVL $0x00000001, SI + LEAL 16(SI), SI + MOVB R8, 1(AX) + SHRL $0x08, R8 + SHLL $0x05, R8 + ORL R8, SI + MOVB SI, (AX) + ADDQ $0x02, AX + SUBL $0x08, R12 + + // emitRepeat + LEAL -4(R12), R12 + JMP cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm12B_emit_copy_short_2b + MOVL R12, SI + LEAL -4(R12), R12 + CMPL SI, $0x08 + JLE repeat_two_match_nolit_encodeBetterBlockAsm12B_emit_copy_short_2b + CMPL SI, $0x0c + JGE cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm12B_emit_copy_short_2b + CMPL R8, $0x00000800 + JLT repeat_two_offset_match_nolit_encodeBetterBlockAsm12B_emit_copy_short_2b + +cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm12B_emit_copy_short_2b: + CMPL R12, $0x00000104 + JLT repeat_three_match_nolit_encodeBetterBlockAsm12B_emit_copy_short_2b + LEAL -256(R12), R12 + MOVW $0x0019, (AX) + MOVW R12, 2(AX) + ADDQ $0x04, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm12B + +repeat_three_match_nolit_encodeBetterBlockAsm12B_emit_copy_short_2b: + LEAL -4(R12), R12 + MOVW $0x0015, (AX) + MOVB R12, 2(AX) + ADDQ $0x03, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm12B + +repeat_two_match_nolit_encodeBetterBlockAsm12B_emit_copy_short_2b: + SHLL $0x02, R12 + ORL $0x01, R12 + MOVW R12, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm12B + +repeat_two_offset_match_nolit_encodeBetterBlockAsm12B_emit_copy_short_2b: + XORQ SI, SI + LEAL 1(SI)(R12*4), R12 + MOVB R8, 1(AX) + SARL $0x08, R8 + SHLL $0x05, R8 + ORL R8, R12 + MOVB R12, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm12B + +long_offset_short_match_nolit_encodeBetterBlockAsm12B: MOVB $0xee, (AX) MOVW R8, 1(AX) LEAL -60(R12), R12 @@ -7689,8 +8540,9 @@ memmove_emit_remainder_encodeBetterBlockAsm12B: MOVL SI, BX // genMemMoveShort - CMPQ BX, $0x04 - JLE emit_lit_memmove_emit_remainder_encodeBetterBlockAsm12B_memmove_move_4 + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeBetterBlockAsm12B_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeBetterBlockAsm12B_memmove_move_3 CMPQ BX, $0x08 JB emit_lit_memmove_emit_remainder_encodeBetterBlockAsm12B_memmove_move_4through7 CMPQ BX, $0x10 @@ -7699,9 +8551,18 @@ memmove_emit_remainder_encodeBetterBlockAsm12B: JBE emit_lit_memmove_emit_remainder_encodeBetterBlockAsm12B_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeBetterBlockAsm12B_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeBetterBlockAsm12B_memmove_move_4: - MOVL (CX), SI - MOVL SI, (AX) +emit_lit_memmove_emit_remainder_encodeBetterBlockAsm12B_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeBetterBlockAsm12B + +emit_lit_memmove_emit_remainder_encodeBetterBlockAsm12B_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) JMP memmove_end_copy_emit_remainder_encodeBetterBlockAsm12B emit_lit_memmove_emit_remainder_encodeBetterBlockAsm12B_memmove_move_4through7: @@ -7916,17 +8777,6 @@ matchlen_loopback_match_nolit_encodeBetterBlockAsm10B: #ifdef GOAMD64_v3 TZCNTQ R11, R11 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R11, R11 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R11, R11 @@ -8113,6 +8963,65 @@ emit_literal_done_match_emit_encodeBetterBlockAsm10B: two_byte_offset_match_nolit_encodeBetterBlockAsm10B: CMPL R12, $0x40 JLE two_byte_offset_short_match_nolit_encodeBetterBlockAsm10B + CMPL R8, $0x00000800 + JAE long_offset_short_match_nolit_encodeBetterBlockAsm10B + MOVL $0x00000001, SI + LEAL 16(SI), SI + MOVB R8, 1(AX) + SHRL $0x08, R8 + SHLL $0x05, R8 + ORL R8, SI + MOVB SI, (AX) + ADDQ $0x02, AX + SUBL $0x08, R12 + + // emitRepeat + LEAL -4(R12), R12 + JMP cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm10B_emit_copy_short_2b + MOVL R12, SI + LEAL -4(R12), R12 + CMPL SI, $0x08 + JLE repeat_two_match_nolit_encodeBetterBlockAsm10B_emit_copy_short_2b + CMPL SI, $0x0c + JGE cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm10B_emit_copy_short_2b + CMPL R8, $0x00000800 + JLT repeat_two_offset_match_nolit_encodeBetterBlockAsm10B_emit_copy_short_2b + +cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm10B_emit_copy_short_2b: + CMPL R12, $0x00000104 + JLT repeat_three_match_nolit_encodeBetterBlockAsm10B_emit_copy_short_2b + LEAL -256(R12), R12 + MOVW $0x0019, (AX) + MOVW R12, 2(AX) + ADDQ $0x04, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm10B + +repeat_three_match_nolit_encodeBetterBlockAsm10B_emit_copy_short_2b: + LEAL -4(R12), R12 + MOVW $0x0015, (AX) + MOVB R12, 2(AX) + ADDQ $0x03, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm10B + +repeat_two_match_nolit_encodeBetterBlockAsm10B_emit_copy_short_2b: + SHLL $0x02, R12 + ORL $0x01, R12 + MOVW R12, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm10B + +repeat_two_offset_match_nolit_encodeBetterBlockAsm10B_emit_copy_short_2b: + XORQ SI, SI + LEAL 1(SI)(R12*4), R12 + MOVB R8, 1(AX) + SARL $0x08, R8 + SHLL $0x05, R8 + ORL R8, R12 + MOVB R12, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm10B + +long_offset_short_match_nolit_encodeBetterBlockAsm10B: MOVB $0xee, (AX) MOVW R8, 1(AX) LEAL -60(R12), R12 @@ -8467,8 +9376,9 @@ memmove_emit_remainder_encodeBetterBlockAsm10B: MOVL SI, BX // genMemMoveShort - CMPQ BX, $0x04 - JLE emit_lit_memmove_emit_remainder_encodeBetterBlockAsm10B_memmove_move_4 + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeBetterBlockAsm10B_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeBetterBlockAsm10B_memmove_move_3 CMPQ BX, $0x08 JB emit_lit_memmove_emit_remainder_encodeBetterBlockAsm10B_memmove_move_4through7 CMPQ BX, $0x10 @@ -8477,9 +9387,18 @@ memmove_emit_remainder_encodeBetterBlockAsm10B: JBE emit_lit_memmove_emit_remainder_encodeBetterBlockAsm10B_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeBetterBlockAsm10B_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeBetterBlockAsm10B_memmove_move_4: - MOVL (CX), SI - MOVL SI, (AX) +emit_lit_memmove_emit_remainder_encodeBetterBlockAsm10B_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeBetterBlockAsm10B + +emit_lit_memmove_emit_remainder_encodeBetterBlockAsm10B_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) JMP memmove_end_copy_emit_remainder_encodeBetterBlockAsm10B emit_lit_memmove_emit_remainder_encodeBetterBlockAsm10B_memmove_move_4through7: @@ -8694,17 +9613,6 @@ matchlen_loopback_match_nolit_encodeBetterBlockAsm8B: #ifdef GOAMD64_v3 TZCNTQ R11, R11 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R11, R11 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R11, R11 @@ -8891,6 +9799,61 @@ emit_literal_done_match_emit_encodeBetterBlockAsm8B: two_byte_offset_match_nolit_encodeBetterBlockAsm8B: CMPL R12, $0x40 JLE two_byte_offset_short_match_nolit_encodeBetterBlockAsm8B + CMPL R8, $0x00000800 + JAE long_offset_short_match_nolit_encodeBetterBlockAsm8B + MOVL $0x00000001, SI + LEAL 16(SI), SI + MOVB R8, 1(AX) + SHRL $0x08, R8 + SHLL $0x05, R8 + ORL R8, SI + MOVB SI, (AX) + ADDQ $0x02, AX + SUBL $0x08, R12 + + // emitRepeat + LEAL -4(R12), R12 + JMP cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b + MOVL R12, SI + LEAL -4(R12), R12 + CMPL SI, $0x08 + JLE repeat_two_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b + CMPL SI, $0x0c + JGE cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b + +cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b: + CMPL R12, $0x00000104 + JLT repeat_three_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b + LEAL -256(R12), R12 + MOVW $0x0019, (AX) + MOVW R12, 2(AX) + ADDQ $0x04, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B + +repeat_three_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b: + LEAL -4(R12), R12 + MOVW $0x0015, (AX) + MOVB R12, 2(AX) + ADDQ $0x03, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B + +repeat_two_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b: + SHLL $0x02, R12 + ORL $0x01, R12 + MOVW R12, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B + XORQ SI, SI + LEAL 1(SI)(R12*4), R12 + MOVB R8, 1(AX) + SARL $0x08, R8 + SHLL $0x05, R8 + ORL R8, R12 + MOVB R12, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B + +long_offset_short_match_nolit_encodeBetterBlockAsm8B: MOVB $0xee, (AX) MOVW R8, 1(AX) LEAL -60(R12), R12 @@ -9235,8 +10198,9 @@ memmove_emit_remainder_encodeBetterBlockAsm8B: MOVL SI, BX // genMemMoveShort - CMPQ BX, $0x04 - JLE emit_lit_memmove_emit_remainder_encodeBetterBlockAsm8B_memmove_move_4 + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeBetterBlockAsm8B_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeBetterBlockAsm8B_memmove_move_3 CMPQ BX, $0x08 JB emit_lit_memmove_emit_remainder_encodeBetterBlockAsm8B_memmove_move_4through7 CMPQ BX, $0x10 @@ -9245,9 +10209,18 @@ memmove_emit_remainder_encodeBetterBlockAsm8B: JBE emit_lit_memmove_emit_remainder_encodeBetterBlockAsm8B_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeBetterBlockAsm8B_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeBetterBlockAsm8B_memmove_move_4: - MOVL (CX), SI - MOVL SI, (AX) +emit_lit_memmove_emit_remainder_encodeBetterBlockAsm8B_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeBetterBlockAsm8B + +emit_lit_memmove_emit_remainder_encodeBetterBlockAsm8B_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) JMP memmove_end_copy_emit_remainder_encodeBetterBlockAsm8B emit_lit_memmove_emit_remainder_encodeBetterBlockAsm8B_memmove_move_4through7: @@ -9584,17 +10557,6 @@ matchlen_loopback_repeat_extend_encodeSnappyBlockAsm: #ifdef GOAMD64_v3 TZCNTQ R10, R10 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R10, R10 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R10, R10 @@ -9918,17 +10880,6 @@ matchlen_loopback_match_nolit_encodeSnappyBlockAsm: #ifdef GOAMD64_v3 TZCNTQ R9, R9 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R9, R9 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R9, R9 @@ -10127,17 +11078,36 @@ memmove_emit_remainder_encodeSnappyBlockAsm: MOVL SI, BX // genMemMoveShort + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm_memmove_move_3 CMPQ BX, $0x08 - JLE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm_memmove_move_8 + JB emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm_memmove_move_4through7 CMPQ BX, $0x10 JBE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm_memmove_move_8through16 CMPQ BX, $0x20 JBE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm_memmove_move_8: - MOVQ (CX), SI - MOVQ SI, (AX) +emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeSnappyBlockAsm + +emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) + JMP memmove_end_copy_emit_remainder_encodeSnappyBlockAsm + +emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm_memmove_move_4through7: + MOVL (CX), SI + MOVL -4(CX)(BX*1), CX + MOVL SI, (AX) + MOVL CX, -4(AX)(BX*1) JMP memmove_end_copy_emit_remainder_encodeSnappyBlockAsm emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm_memmove_move_8through16: @@ -10448,17 +11418,6 @@ matchlen_loopback_repeat_extend_encodeSnappyBlockAsm64K: #ifdef GOAMD64_v3 TZCNTQ R10, R10 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R10, R10 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R10, R10 @@ -10739,17 +11698,6 @@ matchlen_loopback_match_nolit_encodeSnappyBlockAsm64K: #ifdef GOAMD64_v3 TZCNTQ R9, R9 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R9, R9 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R9, R9 @@ -10905,17 +11853,36 @@ memmove_emit_remainder_encodeSnappyBlockAsm64K: MOVL SI, BX // genMemMoveShort + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm64K_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm64K_memmove_move_3 CMPQ BX, $0x08 - JLE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm64K_memmove_move_8 + JB emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm64K_memmove_move_4through7 CMPQ BX, $0x10 JBE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm64K_memmove_move_8through16 CMPQ BX, $0x20 JBE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm64K_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm64K_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm64K_memmove_move_8: - MOVQ (CX), SI - MOVQ SI, (AX) +emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm64K_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeSnappyBlockAsm64K + +emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm64K_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) + JMP memmove_end_copy_emit_remainder_encodeSnappyBlockAsm64K + +emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm64K_memmove_move_4through7: + MOVL (CX), SI + MOVL -4(CX)(BX*1), CX + MOVL SI, (AX) + MOVL CX, -4(AX)(BX*1) JMP memmove_end_copy_emit_remainder_encodeSnappyBlockAsm64K emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm64K_memmove_move_8through16: @@ -11226,17 +12193,6 @@ matchlen_loopback_repeat_extend_encodeSnappyBlockAsm12B: #ifdef GOAMD64_v3 TZCNTQ R10, R10 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R10, R10 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R10, R10 @@ -11517,17 +12473,6 @@ matchlen_loopback_match_nolit_encodeSnappyBlockAsm12B: #ifdef GOAMD64_v3 TZCNTQ R9, R9 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R9, R9 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R9, R9 @@ -11683,17 +12628,36 @@ memmove_emit_remainder_encodeSnappyBlockAsm12B: MOVL SI, BX // genMemMoveShort + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm12B_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm12B_memmove_move_3 CMPQ BX, $0x08 - JLE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm12B_memmove_move_8 + JB emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm12B_memmove_move_4through7 CMPQ BX, $0x10 JBE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm12B_memmove_move_8through16 CMPQ BX, $0x20 JBE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm12B_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm12B_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm12B_memmove_move_8: - MOVQ (CX), SI - MOVQ SI, (AX) +emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm12B_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeSnappyBlockAsm12B + +emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm12B_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) + JMP memmove_end_copy_emit_remainder_encodeSnappyBlockAsm12B + +emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm12B_memmove_move_4through7: + MOVL (CX), SI + MOVL -4(CX)(BX*1), CX + MOVL SI, (AX) + MOVL CX, -4(AX)(BX*1) JMP memmove_end_copy_emit_remainder_encodeSnappyBlockAsm12B emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm12B_memmove_move_8through16: @@ -12004,17 +12968,6 @@ matchlen_loopback_repeat_extend_encodeSnappyBlockAsm10B: #ifdef GOAMD64_v3 TZCNTQ R10, R10 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R10, R10 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R10, R10 @@ -12295,17 +13248,6 @@ matchlen_loopback_match_nolit_encodeSnappyBlockAsm10B: #ifdef GOAMD64_v3 TZCNTQ R9, R9 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R9, R9 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R9, R9 @@ -12461,17 +13403,36 @@ memmove_emit_remainder_encodeSnappyBlockAsm10B: MOVL SI, BX // genMemMoveShort + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm10B_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm10B_memmove_move_3 CMPQ BX, $0x08 - JLE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm10B_memmove_move_8 + JB emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm10B_memmove_move_4through7 CMPQ BX, $0x10 JBE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm10B_memmove_move_8through16 CMPQ BX, $0x20 JBE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm10B_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm10B_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm10B_memmove_move_8: - MOVQ (CX), SI - MOVQ SI, (AX) +emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm10B_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeSnappyBlockAsm10B + +emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm10B_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) + JMP memmove_end_copy_emit_remainder_encodeSnappyBlockAsm10B + +emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm10B_memmove_move_4through7: + MOVL (CX), SI + MOVL -4(CX)(BX*1), CX + MOVL SI, (AX) + MOVL CX, -4(AX)(BX*1) JMP memmove_end_copy_emit_remainder_encodeSnappyBlockAsm10B emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm10B_memmove_move_8through16: @@ -12782,17 +13743,6 @@ matchlen_loopback_repeat_extend_encodeSnappyBlockAsm8B: #ifdef GOAMD64_v3 TZCNTQ R10, R10 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R10, R10 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R10, R10 @@ -13071,17 +14021,6 @@ matchlen_loopback_match_nolit_encodeSnappyBlockAsm8B: #ifdef GOAMD64_v3 TZCNTQ R9, R9 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R9, R9 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R9, R9 @@ -13235,17 +14174,36 @@ memmove_emit_remainder_encodeSnappyBlockAsm8B: MOVL SI, BX // genMemMoveShort + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm8B_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm8B_memmove_move_3 CMPQ BX, $0x08 - JLE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm8B_memmove_move_8 + JB emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm8B_memmove_move_4through7 CMPQ BX, $0x10 JBE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm8B_memmove_move_8through16 CMPQ BX, $0x20 JBE emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm8B_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm8B_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm8B_memmove_move_8: - MOVQ (CX), SI - MOVQ SI, (AX) +emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm8B_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeSnappyBlockAsm8B + +emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm8B_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) + JMP memmove_end_copy_emit_remainder_encodeSnappyBlockAsm8B + +emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm8B_memmove_move_4through7: + MOVL (CX), SI + MOVL -4(CX)(BX*1), CX + MOVL SI, (AX) + MOVL CX, -4(AX)(BX*1) JMP memmove_end_copy_emit_remainder_encodeSnappyBlockAsm8B emit_lit_memmove_emit_remainder_encodeSnappyBlockAsm8B_memmove_move_8through16: @@ -13461,17 +14419,6 @@ matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm: #ifdef GOAMD64_v3 TZCNTQ R11, R11 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R11, R11 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R11, R11 @@ -13850,17 +14797,36 @@ memmove_emit_remainder_encodeSnappyBetterBlockAsm: MOVL SI, BX // genMemMoveShort + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm_memmove_move_3 CMPQ BX, $0x08 - JLE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm_memmove_move_8 + JB emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm_memmove_move_4through7 CMPQ BX, $0x10 JBE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm_memmove_move_8through16 CMPQ BX, $0x20 JBE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm_memmove_move_8: - MOVQ (CX), SI - MOVQ SI, (AX) +emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeSnappyBetterBlockAsm + +emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) + JMP memmove_end_copy_emit_remainder_encodeSnappyBetterBlockAsm + +emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm_memmove_move_4through7: + MOVL (CX), SI + MOVL -4(CX)(BX*1), CX + MOVL SI, (AX) + MOVL CX, -4(AX)(BX*1) JMP memmove_end_copy_emit_remainder_encodeSnappyBetterBlockAsm emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm_memmove_move_8through16: @@ -14068,17 +15034,6 @@ matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm64K: #ifdef GOAMD64_v3 TZCNTQ R11, R11 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R11, R11 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R11, R11 @@ -14386,17 +15341,36 @@ memmove_emit_remainder_encodeSnappyBetterBlockAsm64K: MOVL SI, BX // genMemMoveShort + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm64K_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm64K_memmove_move_3 CMPQ BX, $0x08 - JLE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm64K_memmove_move_8 + JB emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm64K_memmove_move_4through7 CMPQ BX, $0x10 JBE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm64K_memmove_move_8through16 CMPQ BX, $0x20 JBE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm64K_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm64K_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm64K_memmove_move_8: - MOVQ (CX), SI - MOVQ SI, (AX) +emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm64K_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeSnappyBetterBlockAsm64K + +emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm64K_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) + JMP memmove_end_copy_emit_remainder_encodeSnappyBetterBlockAsm64K + +emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm64K_memmove_move_4through7: + MOVL (CX), SI + MOVL -4(CX)(BX*1), CX + MOVL SI, (AX) + MOVL CX, -4(AX)(BX*1) JMP memmove_end_copy_emit_remainder_encodeSnappyBetterBlockAsm64K emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm64K_memmove_move_8through16: @@ -14604,17 +15578,6 @@ matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm12B: #ifdef GOAMD64_v3 TZCNTQ R11, R11 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R11, R11 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R11, R11 @@ -14922,17 +15885,36 @@ memmove_emit_remainder_encodeSnappyBetterBlockAsm12B: MOVL SI, BX // genMemMoveShort + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm12B_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm12B_memmove_move_3 CMPQ BX, $0x08 - JLE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm12B_memmove_move_8 + JB emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm12B_memmove_move_4through7 CMPQ BX, $0x10 JBE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm12B_memmove_move_8through16 CMPQ BX, $0x20 JBE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm12B_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm12B_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm12B_memmove_move_8: - MOVQ (CX), SI - MOVQ SI, (AX) +emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm12B_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeSnappyBetterBlockAsm12B + +emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm12B_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) + JMP memmove_end_copy_emit_remainder_encodeSnappyBetterBlockAsm12B + +emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm12B_memmove_move_4through7: + MOVL (CX), SI + MOVL -4(CX)(BX*1), CX + MOVL SI, (AX) + MOVL CX, -4(AX)(BX*1) JMP memmove_end_copy_emit_remainder_encodeSnappyBetterBlockAsm12B emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm12B_memmove_move_8through16: @@ -15140,17 +16122,6 @@ matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm10B: #ifdef GOAMD64_v3 TZCNTQ R11, R11 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R11, R11 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R11, R11 @@ -15458,17 +16429,36 @@ memmove_emit_remainder_encodeSnappyBetterBlockAsm10B: MOVL SI, BX // genMemMoveShort + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm10B_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm10B_memmove_move_3 CMPQ BX, $0x08 - JLE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm10B_memmove_move_8 + JB emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm10B_memmove_move_4through7 CMPQ BX, $0x10 JBE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm10B_memmove_move_8through16 CMPQ BX, $0x20 JBE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm10B_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm10B_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm10B_memmove_move_8: - MOVQ (CX), SI - MOVQ SI, (AX) +emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm10B_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeSnappyBetterBlockAsm10B + +emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm10B_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) + JMP memmove_end_copy_emit_remainder_encodeSnappyBetterBlockAsm10B + +emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm10B_memmove_move_4through7: + MOVL (CX), SI + MOVL -4(CX)(BX*1), CX + MOVL SI, (AX) + MOVL CX, -4(AX)(BX*1) JMP memmove_end_copy_emit_remainder_encodeSnappyBetterBlockAsm10B emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm10B_memmove_move_8through16: @@ -15676,17 +16666,6 @@ matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm8B: #ifdef GOAMD64_v3 TZCNTQ R11, R11 -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ R11, R11 - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ R11, R11 @@ -15992,17 +16971,36 @@ memmove_emit_remainder_encodeSnappyBetterBlockAsm8B: MOVL SI, BX // genMemMoveShort + CMPQ BX, $0x03 + JB emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm8B_memmove_move_1or2 + JE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm8B_memmove_move_3 CMPQ BX, $0x08 - JLE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm8B_memmove_move_8 + JB emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm8B_memmove_move_4through7 CMPQ BX, $0x10 JBE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm8B_memmove_move_8through16 CMPQ BX, $0x20 JBE emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm8B_memmove_move_17through32 JMP emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm8B_memmove_move_33through64 -emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm8B_memmove_move_8: - MOVQ (CX), SI - MOVQ SI, (AX) +emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm8B_memmove_move_1or2: + MOVB (CX), SI + MOVB -1(CX)(BX*1), CL + MOVB SI, (AX) + MOVB CL, -1(AX)(BX*1) + JMP memmove_end_copy_emit_remainder_encodeSnappyBetterBlockAsm8B + +emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm8B_memmove_move_3: + MOVW (CX), SI + MOVB 2(CX), CL + MOVW SI, (AX) + MOVB CL, 2(AX) + JMP memmove_end_copy_emit_remainder_encodeSnappyBetterBlockAsm8B + +emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm8B_memmove_move_4through7: + MOVL (CX), SI + MOVL -4(CX)(BX*1), CX + MOVL SI, (AX) + MOVL CX, -4(AX)(BX*1) JMP memmove_end_copy_emit_remainder_encodeSnappyBetterBlockAsm8B emit_lit_memmove_emit_remainder_encodeSnappyBetterBlockAsm8B_memmove_move_8through16: @@ -16443,6 +17441,97 @@ four_bytes_remain_standalone: two_byte_offset_standalone: CMPL DX, $0x40 JLE two_byte_offset_short_standalone + CMPL CX, $0x00000800 + JAE long_offset_short_standalone + MOVL $0x00000001, SI + LEAL 16(SI), SI + MOVB CL, 1(AX) + MOVL CX, DI + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, SI + MOVB SI, (AX) + ADDQ $0x02, BX + ADDQ $0x02, AX + SUBL $0x08, DX + + // emitRepeat + LEAL -4(DX), DX + JMP cant_repeat_two_offset_standalone_emit_copy_short_2b + +emit_repeat_again_standalone_emit_copy_short_2b: + MOVL DX, SI + LEAL -4(DX), DX + CMPL SI, $0x08 + JLE repeat_two_standalone_emit_copy_short_2b + CMPL SI, $0x0c + JGE cant_repeat_two_offset_standalone_emit_copy_short_2b + CMPL CX, $0x00000800 + JLT repeat_two_offset_standalone_emit_copy_short_2b + +cant_repeat_two_offset_standalone_emit_copy_short_2b: + CMPL DX, $0x00000104 + JLT repeat_three_standalone_emit_copy_short_2b + CMPL DX, $0x00010100 + JLT repeat_four_standalone_emit_copy_short_2b + CMPL DX, $0x0100ffff + JLT repeat_five_standalone_emit_copy_short_2b + LEAL -16842747(DX), DX + MOVW $0x001d, (AX) + MOVW $0xfffb, 2(AX) + MOVB $0xff, 4(AX) + ADDQ $0x05, AX + ADDQ $0x05, BX + JMP emit_repeat_again_standalone_emit_copy_short_2b + +repeat_five_standalone_emit_copy_short_2b: + LEAL -65536(DX), DX + MOVL DX, CX + MOVW $0x001d, (AX) + MOVW DX, 2(AX) + SARL $0x10, CX + MOVB CL, 4(AX) + ADDQ $0x05, BX + ADDQ $0x05, AX + JMP gen_emit_copy_end + +repeat_four_standalone_emit_copy_short_2b: + LEAL -256(DX), DX + MOVW $0x0019, (AX) + MOVW DX, 2(AX) + ADDQ $0x04, BX + ADDQ $0x04, AX + JMP gen_emit_copy_end + +repeat_three_standalone_emit_copy_short_2b: + LEAL -4(DX), DX + MOVW $0x0015, (AX) + MOVB DL, 2(AX) + ADDQ $0x03, BX + ADDQ $0x03, AX + JMP gen_emit_copy_end + +repeat_two_standalone_emit_copy_short_2b: + SHLL $0x02, DX + ORL $0x01, DX + MOVW DX, (AX) + ADDQ $0x02, BX + ADDQ $0x02, AX + JMP gen_emit_copy_end + +repeat_two_offset_standalone_emit_copy_short_2b: + XORQ SI, SI + LEAL 1(SI)(DX*4), DX + MOVB CL, 1(AX) + SARL $0x08, CX + SHLL $0x05, CX + ORL CX, DX + MOVB DL, (AX) + ADDQ $0x02, BX + ADDQ $0x02, AX + JMP gen_emit_copy_end + +long_offset_short_standalone: MOVB $0xee, (AX) MOVW CX, 1(AX) LEAL -60(DX), DX @@ -16644,17 +17733,6 @@ matchlen_loopback_standalone: #ifdef GOAMD64_v3 TZCNTQ BX, BX -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef GOAMD64_v4 - TZCNTQ BX, BX - -#define TZCNTQ_EMITTED 1 -#endif - -#ifdef TZCNTQ_EMITTED -#undef TZCNTQ_EMITTED #else BSFQ BX, BX diff --git a/vendor/github.com/klauspost/compress/s2/index.go b/vendor/github.com/klauspost/compress/s2/index.go index fd857682e..dd9ecfe71 100644 --- a/vendor/github.com/klauspost/compress/s2/index.go +++ b/vendor/github.com/klauspost/compress/s2/index.go @@ -10,6 +10,7 @@ import ( "encoding/json" "fmt" "io" + "sort" ) const ( @@ -100,6 +101,15 @@ func (i *Index) Find(offset int64) (compressedOff, uncompressedOff int64, err er if offset > i.TotalUncompressed { return 0, 0, io.ErrUnexpectedEOF } + if len(i.info) > 200 { + n := sort.Search(len(i.info), func(n int) bool { + return i.info[n].uncompressedOffset > offset + }) + if n == 0 { + n = 1 + } + return i.info[n-1].compressedOffset, i.info[n-1].uncompressedOffset, nil + } for _, info := range i.info { if info.uncompressedOffset > offset { break @@ -523,3 +533,66 @@ func (i *Index) JSON() []byte { b, _ := json.MarshalIndent(x, "", " ") return b } + +// RemoveIndexHeaders will trim all headers and trailers from a given index. +// This is expected to save 20 bytes. +// These can be restored using RestoreIndexHeaders. +// This removes a layer of security, but is the most compact representation. +// Returns nil if headers contains errors. +// The returned slice references the provided slice. +func RemoveIndexHeaders(b []byte) []byte { + const save = 4 + len(S2IndexHeader) + len(S2IndexTrailer) + 4 + if len(b) <= save { + return nil + } + if b[0] != ChunkTypeIndex { + return nil + } + chunkLen := int(b[1]) | int(b[2])<<8 | int(b[3])<<16 + b = b[4:] + + // Validate we have enough... + if len(b) < chunkLen { + return nil + } + b = b[:chunkLen] + + if !bytes.Equal(b[:len(S2IndexHeader)], []byte(S2IndexHeader)) { + return nil + } + b = b[len(S2IndexHeader):] + if !bytes.HasSuffix(b, []byte(S2IndexTrailer)) { + return nil + } + b = bytes.TrimSuffix(b, []byte(S2IndexTrailer)) + + if len(b) < 4 { + return nil + } + return b[:len(b)-4] +} + +// RestoreIndexHeaders will index restore headers removed by RemoveIndexHeaders. +// No error checking is performed on the input. +// If a 0 length slice is sent, it is returned without modification. +func RestoreIndexHeaders(in []byte) []byte { + if len(in) == 0 { + return in + } + b := make([]byte, 0, 4+len(S2IndexHeader)+len(in)+len(S2IndexTrailer)+4) + b = append(b, ChunkTypeIndex, 0, 0, 0) + b = append(b, []byte(S2IndexHeader)...) + b = append(b, in...) + + var tmp [4]byte + binary.LittleEndian.PutUint32(tmp[:], uint32(len(b)+4+len(S2IndexTrailer))) + b = append(b, tmp[:4]...) + // Trailer + b = append(b, []byte(S2IndexTrailer)...) + + chunkLen := len(b) - skippableFrameHeader + b[1] = uint8(chunkLen >> 0) + b[2] = uint8(chunkLen >> 8) + b[3] = uint8(chunkLen >> 16) + return b +} diff --git a/vendor/github.com/klauspost/cpuid/.travis.yml b/vendor/github.com/klauspost/cpuid/.travis.yml deleted file mode 100644 index 77d975fe2..000000000 --- a/vendor/github.com/klauspost/cpuid/.travis.yml +++ /dev/null @@ -1,46 +0,0 @@ -language: go - -os: - - linux - - osx - - windows - -arch: - - amd64 - - arm64 - -go: - - 1.12.x - - 1.13.x - - 1.14.x - - master - -script: - - go vet ./... - - go test -race ./... - - go test -tags=noasm ./... - -stages: - - gofmt - - test - -matrix: - allow_failures: - - go: 'master' - fast_finish: true - include: - - stage: gofmt - go: 1.14.x - os: linux - arch: amd64 - script: - - diff <(gofmt -d .) <(printf "") - - diff <(gofmt -d ./private) <(printf "") - - go install github.com/klauspost/asmfmt/cmd/asmfmt - - diff <(asmfmt -d .) <(printf "") - - stage: i386 - go: 1.14.x - os: linux - arch: amd64 - script: - - GOOS=linux GOARCH=386 go test . diff --git a/vendor/github.com/klauspost/cpuid/README.md b/vendor/github.com/klauspost/cpuid/README.md deleted file mode 100644 index 38d4a8b93..000000000 --- a/vendor/github.com/klauspost/cpuid/README.md +++ /dev/null @@ -1,191 +0,0 @@ -# cpuid -Package cpuid provides information about the CPU running the current program. - -CPU features are detected on startup, and kept for fast access through the life of the application. -Currently x86 / x64 (AMD64/i386) and ARM (ARM64) is supported, and no external C (cgo) code is used, which should make the library very easy to use. - -You can access the CPU information by accessing the shared CPU variable of the cpuid library. - -Package home: https://github.com/klauspost/cpuid - -[![GoDoc][1]][2] [![Build Status][3]][4] - -[1]: https://godoc.org/github.com/klauspost/cpuid?status.svg -[2]: https://godoc.org/github.com/klauspost/cpuid -[3]: https://travis-ci.org/klauspost/cpuid.svg?branch=master -[4]: https://travis-ci.org/klauspost/cpuid - -# features - -## x86 CPU Instructions -* **CMOV** (i686 CMOV) -* **NX** (NX (No-Execute) bit) -* **AMD3DNOW** (AMD 3DNOW) -* **AMD3DNOWEXT** (AMD 3DNowExt) -* **MMX** (standard MMX) -* **MMXEXT** (SSE integer functions or AMD MMX ext) -* **SSE** (SSE functions) -* **SSE2** (P4 SSE functions) -* **SSE3** (Prescott SSE3 functions) -* **SSSE3** (Conroe SSSE3 functions) -* **SSE4** (Penryn SSE4.1 functions) -* **SSE4A** (AMD Barcelona microarchitecture SSE4a instructions) -* **SSE42** (Nehalem SSE4.2 functions) -* **AVX** (AVX functions) -* **AVX2** (AVX2 functions) -* **FMA3** (Intel FMA 3) -* **FMA4** (Bulldozer FMA4 functions) -* **XOP** (Bulldozer XOP functions) -* **F16C** (Half-precision floating-point conversion) -* **BMI1** (Bit Manipulation Instruction Set 1) -* **BMI2** (Bit Manipulation Instruction Set 2) -* **TBM** (AMD Trailing Bit Manipulation) -* **LZCNT** (LZCNT instruction) -* **POPCNT** (POPCNT instruction) -* **AESNI** (Advanced Encryption Standard New Instructions) -* **CLMUL** (Carry-less Multiplication) -* **HTT** (Hyperthreading (enabled)) -* **HLE** (Hardware Lock Elision) -* **RTM** (Restricted Transactional Memory) -* **RDRAND** (RDRAND instruction is available) -* **RDSEED** (RDSEED instruction is available) -* **ADX** (Intel ADX (Multi-Precision Add-Carry Instruction Extensions)) -* **SHA** (Intel SHA Extensions) -* **AVX512F** (AVX-512 Foundation) -* **AVX512DQ** (AVX-512 Doubleword and Quadword Instructions) -* **AVX512IFMA** (AVX-512 Integer Fused Multiply-Add Instructions) -* **AVX512PF** (AVX-512 Prefetch Instructions) -* **AVX512ER** (AVX-512 Exponential and Reciprocal Instructions) -* **AVX512CD** (AVX-512 Conflict Detection Instructions) -* **AVX512BW** (AVX-512 Byte and Word Instructions) -* **AVX512VL** (AVX-512 Vector Length Extensions) -* **AVX512VBMI** (AVX-512 Vector Bit Manipulation Instructions) -* **AVX512VBMI2** (AVX-512 Vector Bit Manipulation Instructions, Version 2) -* **AVX512VNNI** (AVX-512 Vector Neural Network Instructions) -* **AVX512VPOPCNTDQ** (AVX-512 Vector Population Count Doubleword and Quadword) -* **GFNI** (Galois Field New Instructions) -* **VAES** (Vector AES) -* **AVX512BITALG** (AVX-512 Bit Algorithms) -* **VPCLMULQDQ** (Carry-Less Multiplication Quadword) -* **AVX512BF16** (AVX-512 BFLOAT16 Instructions) -* **AVX512VP2INTERSECT** (AVX-512 Intersect for D/Q) -* **MPX** (Intel MPX (Memory Protection Extensions)) -* **ERMS** (Enhanced REP MOVSB/STOSB) -* **RDTSCP** (RDTSCP Instruction) -* **CX16** (CMPXCHG16B Instruction) -* **SGX** (Software Guard Extensions, with activation details) -* **VMX** (Virtual Machine Extensions) - -## Performance -* **RDTSCP()** Returns current cycle count. Can be used for benchmarking. -* **SSE2SLOW** (SSE2 is supported, but usually not faster) -* **SSE3SLOW** (SSE3 is supported, but usually not faster) -* **ATOM** (Atom processor, some SSSE3 instructions are slower) -* **Cache line** (Probable size of a cache line). -* **L1, L2, L3 Cache size** on newer Intel/AMD CPUs. - -## ARM CPU features - -# ARM FEATURE DETECTION DISABLED! - -See [#52](https://github.com/klauspost/cpuid/issues/52). - -Currently only `arm64` platforms are implemented. - -* **FP** Single-precision and double-precision floating point -* **ASIMD** Advanced SIMD -* **EVTSTRM** Generic timer -* **AES** AES instructions -* **PMULL** Polynomial Multiply instructions (PMULL/PMULL2) -* **SHA1** SHA-1 instructions (SHA1C, etc) -* **SHA2** SHA-2 instructions (SHA256H, etc) -* **CRC32** CRC32/CRC32C instructions -* **ATOMICS** Large System Extensions (LSE) -* **FPHP** Half-precision floating point -* **ASIMDHP** Advanced SIMD half-precision floating point -* **ARMCPUID** Some CPU ID registers readable at user-level -* **ASIMDRDM** Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) -* **JSCVT** Javascript-style double->int convert (FJCVTZS) -* **FCMA** Floating point complex number addition and multiplication -* **LRCPC** Weaker release consistency (LDAPR, etc) -* **DCPOP** Data cache clean to Point of Persistence (DC CVAP) -* **SHA3** SHA-3 instructions (EOR3, RAXI, XAR, BCAX) -* **SM3** SM3 instructions -* **SM4** SM4 instructions -* **ASIMDDP** SIMD Dot Product -* **SHA512** SHA512 instructions -* **SVE** Scalable Vector Extension -* **GPA** Generic Pointer Authentication - -## Cpu Vendor/VM -* **Intel** -* **AMD** -* **VIA** -* **Transmeta** -* **NSC** -* **KVM** (Kernel-based Virtual Machine) -* **MSVM** (Microsoft Hyper-V or Windows Virtual PC) -* **VMware** -* **XenHVM** -* **Bhyve** -* **Hygon** - -# installing - -```go get github.com/klauspost/cpuid``` - -# example - -```Go -package main - -import ( - "fmt" - "github.com/klauspost/cpuid" -) - -func main() { - // Print basic CPU information: - fmt.Println("Name:", cpuid.CPU.BrandName) - fmt.Println("PhysicalCores:", cpuid.CPU.PhysicalCores) - fmt.Println("ThreadsPerCore:", cpuid.CPU.ThreadsPerCore) - fmt.Println("LogicalCores:", cpuid.CPU.LogicalCores) - fmt.Println("Family", cpuid.CPU.Family, "Model:", cpuid.CPU.Model) - fmt.Println("Features:", cpuid.CPU.Features) - fmt.Println("Cacheline bytes:", cpuid.CPU.CacheLine) - fmt.Println("L1 Data Cache:", cpuid.CPU.Cache.L1D, "bytes") - fmt.Println("L1 Instruction Cache:", cpuid.CPU.Cache.L1D, "bytes") - fmt.Println("L2 Cache:", cpuid.CPU.Cache.L2, "bytes") - fmt.Println("L3 Cache:", cpuid.CPU.Cache.L3, "bytes") - - // Test if we have a specific feature: - if cpuid.CPU.SSE() { - fmt.Println("We have Streaming SIMD Extensions") - } -} -``` - -Sample output: -``` ->go run main.go -Name: Intel(R) Core(TM) i5-2540M CPU @ 2.60GHz -PhysicalCores: 2 -ThreadsPerCore: 2 -LogicalCores: 4 -Family 6 Model: 42 -Features: CMOV,MMX,MMXEXT,SSE,SSE2,SSE3,SSSE3,SSE4.1,SSE4.2,AVX,AESNI,CLMUL -Cacheline bytes: 64 -We have Streaming SIMD Extensions -``` - -# private package - -In the "private" folder you can find an autogenerated version of the library you can include in your own packages. - -For this purpose all exports are removed, and functions and constants are lowercased. - -This is not a recommended way of using the library, but provided for convenience, if it is difficult for you to use external packages. - -# license - -This code is published under an MIT license. See LICENSE file for more information. diff --git a/vendor/github.com/klauspost/cpuid/cpuid.go b/vendor/github.com/klauspost/cpuid/cpuid.go deleted file mode 100644 index 208b3e79b..000000000 --- a/vendor/github.com/klauspost/cpuid/cpuid.go +++ /dev/null @@ -1,1504 +0,0 @@ -// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. - -// Package cpuid provides information about the CPU running the current program. -// -// CPU features are detected on startup, and kept for fast access through the life of the application. -// Currently x86 / x64 (AMD64) as well as arm64 is supported. -// -// You can access the CPU information by accessing the shared CPU variable of the cpuid library. -// -// Package home: https://github.com/klauspost/cpuid -package cpuid - -import ( - "math" - "strings" -) - -// AMD refererence: https://www.amd.com/system/files/TechDocs/25481.pdf -// and Processor Programming Reference (PPR) - -// Vendor is a representation of a CPU vendor. -type Vendor int - -const ( - Other Vendor = iota - Intel - AMD - VIA - Transmeta - NSC - KVM // Kernel-based Virtual Machine - MSVM // Microsoft Hyper-V or Windows Virtual PC - VMware - XenHVM - Bhyve - Hygon - SiS - RDC -) - -const ( - CMOV = 1 << iota // i686 CMOV - NX // NX (No-Execute) bit - AMD3DNOW // AMD 3DNOW - AMD3DNOWEXT // AMD 3DNowExt - MMX // standard MMX - MMXEXT // SSE integer functions or AMD MMX ext - SSE // SSE functions - SSE2 // P4 SSE functions - SSE3 // Prescott SSE3 functions - SSSE3 // Conroe SSSE3 functions - SSE4 // Penryn SSE4.1 functions - SSE4A // AMD Barcelona microarchitecture SSE4a instructions - SSE42 // Nehalem SSE4.2 functions - AVX // AVX functions - AVX2 // AVX2 functions - FMA3 // Intel FMA 3 - FMA4 // Bulldozer FMA4 functions - XOP // Bulldozer XOP functions - F16C // Half-precision floating-point conversion - BMI1 // Bit Manipulation Instruction Set 1 - BMI2 // Bit Manipulation Instruction Set 2 - TBM // AMD Trailing Bit Manipulation - LZCNT // LZCNT instruction - POPCNT // POPCNT instruction - AESNI // Advanced Encryption Standard New Instructions - CLMUL // Carry-less Multiplication - HTT // Hyperthreading (enabled) - HLE // Hardware Lock Elision - RTM // Restricted Transactional Memory - RDRAND // RDRAND instruction is available - RDSEED // RDSEED instruction is available - ADX // Intel ADX (Multi-Precision Add-Carry Instruction Extensions) - SHA // Intel SHA Extensions - AVX512F // AVX-512 Foundation - AVX512DQ // AVX-512 Doubleword and Quadword Instructions - AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions - AVX512PF // AVX-512 Prefetch Instructions - AVX512ER // AVX-512 Exponential and Reciprocal Instructions - AVX512CD // AVX-512 Conflict Detection Instructions - AVX512BW // AVX-512 Byte and Word Instructions - AVX512VL // AVX-512 Vector Length Extensions - AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions - AVX512VBMI2 // AVX-512 Vector Bit Manipulation Instructions, Version 2 - AVX512VNNI // AVX-512 Vector Neural Network Instructions - AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword - GFNI // Galois Field New Instructions - VAES // Vector AES - AVX512BITALG // AVX-512 Bit Algorithms - VPCLMULQDQ // Carry-Less Multiplication Quadword - AVX512BF16 // AVX-512 BFLOAT16 Instructions - AVX512VP2INTERSECT // AVX-512 Intersect for D/Q - MPX // Intel MPX (Memory Protection Extensions) - ERMS // Enhanced REP MOVSB/STOSB - RDTSCP // RDTSCP Instruction - CX16 // CMPXCHG16B Instruction - SGX // Software Guard Extensions - SGXLC // Software Guard Extensions Launch Control - IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) - STIBP // Single Thread Indirect Branch Predictors - VMX // Virtual Machine Extensions - - // Performance indicators - SSE2SLOW // SSE2 is supported, but usually not faster - SSE3SLOW // SSE3 is supported, but usually not faster - ATOM // Atom processor, some SSSE3 instructions are slower -) - -var flagNames = map[Flags]string{ - CMOV: "CMOV", // i686 CMOV - NX: "NX", // NX (No-Execute) bit - AMD3DNOW: "AMD3DNOW", // AMD 3DNOW - AMD3DNOWEXT: "AMD3DNOWEXT", // AMD 3DNowExt - MMX: "MMX", // Standard MMX - MMXEXT: "MMXEXT", // SSE integer functions or AMD MMX ext - SSE: "SSE", // SSE functions - SSE2: "SSE2", // P4 SSE2 functions - SSE3: "SSE3", // Prescott SSE3 functions - SSSE3: "SSSE3", // Conroe SSSE3 functions - SSE4: "SSE4.1", // Penryn SSE4.1 functions - SSE4A: "SSE4A", // AMD Barcelona microarchitecture SSE4a instructions - SSE42: "SSE4.2", // Nehalem SSE4.2 functions - AVX: "AVX", // AVX functions - AVX2: "AVX2", // AVX functions - FMA3: "FMA3", // Intel FMA 3 - FMA4: "FMA4", // Bulldozer FMA4 functions - XOP: "XOP", // Bulldozer XOP functions - F16C: "F16C", // Half-precision floating-point conversion - BMI1: "BMI1", // Bit Manipulation Instruction Set 1 - BMI2: "BMI2", // Bit Manipulation Instruction Set 2 - TBM: "TBM", // AMD Trailing Bit Manipulation - LZCNT: "LZCNT", // LZCNT instruction - POPCNT: "POPCNT", // POPCNT instruction - AESNI: "AESNI", // Advanced Encryption Standard New Instructions - CLMUL: "CLMUL", // Carry-less Multiplication - HTT: "HTT", // Hyperthreading (enabled) - HLE: "HLE", // Hardware Lock Elision - RTM: "RTM", // Restricted Transactional Memory - RDRAND: "RDRAND", // RDRAND instruction is available - RDSEED: "RDSEED", // RDSEED instruction is available - ADX: "ADX", // Intel ADX (Multi-Precision Add-Carry Instruction Extensions) - SHA: "SHA", // Intel SHA Extensions - AVX512F: "AVX512F", // AVX-512 Foundation - AVX512DQ: "AVX512DQ", // AVX-512 Doubleword and Quadword Instructions - AVX512IFMA: "AVX512IFMA", // AVX-512 Integer Fused Multiply-Add Instructions - AVX512PF: "AVX512PF", // AVX-512 Prefetch Instructions - AVX512ER: "AVX512ER", // AVX-512 Exponential and Reciprocal Instructions - AVX512CD: "AVX512CD", // AVX-512 Conflict Detection Instructions - AVX512BW: "AVX512BW", // AVX-512 Byte and Word Instructions - AVX512VL: "AVX512VL", // AVX-512 Vector Length Extensions - AVX512VBMI: "AVX512VBMI", // AVX-512 Vector Bit Manipulation Instructions - AVX512VBMI2: "AVX512VBMI2", // AVX-512 Vector Bit Manipulation Instructions, Version 2 - AVX512VNNI: "AVX512VNNI", // AVX-512 Vector Neural Network Instructions - AVX512VPOPCNTDQ: "AVX512VPOPCNTDQ", // AVX-512 Vector Population Count Doubleword and Quadword - GFNI: "GFNI", // Galois Field New Instructions - VAES: "VAES", // Vector AES - AVX512BITALG: "AVX512BITALG", // AVX-512 Bit Algorithms - VPCLMULQDQ: "VPCLMULQDQ", // Carry-Less Multiplication Quadword - AVX512BF16: "AVX512BF16", // AVX-512 BFLOAT16 Instruction - AVX512VP2INTERSECT: "AVX512VP2INTERSECT", // AVX-512 Intersect for D/Q - MPX: "MPX", // Intel MPX (Memory Protection Extensions) - ERMS: "ERMS", // Enhanced REP MOVSB/STOSB - RDTSCP: "RDTSCP", // RDTSCP Instruction - CX16: "CX16", // CMPXCHG16B Instruction - SGX: "SGX", // Software Guard Extensions - SGXLC: "SGXLC", // Software Guard Extensions Launch Control - IBPB: "IBPB", // Indirect Branch Restricted Speculation and Indirect Branch Predictor Barrier - STIBP: "STIBP", // Single Thread Indirect Branch Predictors - VMX: "VMX", // Virtual Machine Extensions - - // Performance indicators - SSE2SLOW: "SSE2SLOW", // SSE2 supported, but usually not faster - SSE3SLOW: "SSE3SLOW", // SSE3 supported, but usually not faster - ATOM: "ATOM", // Atom processor, some SSSE3 instructions are slower - -} - -/* all special features for arm64 should be defined here */ -const ( - /* extension instructions */ - FP ArmFlags = 1 << iota - ASIMD - EVTSTRM - AES - PMULL - SHA1 - SHA2 - CRC32 - ATOMICS - FPHP - ASIMDHP - ARMCPUID - ASIMDRDM - JSCVT - FCMA - LRCPC - DCPOP - SHA3 - SM3 - SM4 - ASIMDDP - SHA512 - SVE - GPA -) - -var flagNamesArm = map[ArmFlags]string{ - FP: "FP", // Single-precision and double-precision floating point - ASIMD: "ASIMD", // Advanced SIMD - EVTSTRM: "EVTSTRM", // Generic timer - AES: "AES", // AES instructions - PMULL: "PMULL", // Polynomial Multiply instructions (PMULL/PMULL2) - SHA1: "SHA1", // SHA-1 instructions (SHA1C, etc) - SHA2: "SHA2", // SHA-2 instructions (SHA256H, etc) - CRC32: "CRC32", // CRC32/CRC32C instructions - ATOMICS: "ATOMICS", // Large System Extensions (LSE) - FPHP: "FPHP", // Half-precision floating point - ASIMDHP: "ASIMDHP", // Advanced SIMD half-precision floating point - ARMCPUID: "CPUID", // Some CPU ID registers readable at user-level - ASIMDRDM: "ASIMDRDM", // Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) - JSCVT: "JSCVT", // Javascript-style double->int convert (FJCVTZS) - FCMA: "FCMA", // Floatin point complex number addition and multiplication - LRCPC: "LRCPC", // Weaker release consistency (LDAPR, etc) - DCPOP: "DCPOP", // Data cache clean to Point of Persistence (DC CVAP) - SHA3: "SHA3", // SHA-3 instructions (EOR3, RAXI, XAR, BCAX) - SM3: "SM3", // SM3 instructions - SM4: "SM4", // SM4 instructions - ASIMDDP: "ASIMDDP", // SIMD Dot Product - SHA512: "SHA512", // SHA512 instructions - SVE: "SVE", // Scalable Vector Extension - GPA: "GPA", // Generic Pointer Authentication -} - -// CPUInfo contains information about the detected system CPU. -type CPUInfo struct { - BrandName string // Brand name reported by the CPU - VendorID Vendor // Comparable CPU vendor ID - VendorString string // Raw vendor string. - Features Flags // Features of the CPU (x64) - Arm ArmFlags // Features of the CPU (arm) - PhysicalCores int // Number of physical processor cores in your CPU. Will be 0 if undetectable. - ThreadsPerCore int // Number of threads per physical core. Will be 1 if undetectable. - LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable. - Family int // CPU family number - Model int // CPU model number - CacheLine int // Cache line size in bytes. Will be 0 if undetectable. - Hz int64 // Clock speed, if known - Cache struct { - L1I int // L1 Instruction Cache (per core or shared). Will be -1 if undetected - L1D int // L1 Data Cache (per core or shared). Will be -1 if undetected - L2 int // L2 Cache (per core or shared). Will be -1 if undetected - L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected - } - SGX SGXSupport - maxFunc uint32 - maxExFunc uint32 -} - -var cpuid func(op uint32) (eax, ebx, ecx, edx uint32) -var cpuidex func(op, op2 uint32) (eax, ebx, ecx, edx uint32) -var xgetbv func(index uint32) (eax, edx uint32) -var rdtscpAsm func() (eax, ebx, ecx, edx uint32) - -// CPU contains information about the CPU as detected on startup, -// or when Detect last was called. -// -// Use this as the primary entry point to you data. -var CPU CPUInfo - -func init() { - initCPU() - Detect() -} - -// Detect will re-detect current CPU info. -// This will replace the content of the exported CPU variable. -// -// Unless you expect the CPU to change while you are running your program -// you should not need to call this function. -// If you call this, you must ensure that no other goroutine is accessing the -// exported CPU variable. -func Detect() { - // Set defaults - CPU.ThreadsPerCore = 1 - CPU.Cache.L1I = -1 - CPU.Cache.L1D = -1 - CPU.Cache.L2 = -1 - CPU.Cache.L3 = -1 - addInfo(&CPU) -} - -// Generated here: http://play.golang.org/p/BxFH2Gdc0G - -// Cmov indicates support of CMOV instructions -func (c CPUInfo) Cmov() bool { - return c.Features&CMOV != 0 -} - -// Amd3dnow indicates support of AMD 3DNOW! instructions -func (c CPUInfo) Amd3dnow() bool { - return c.Features&AMD3DNOW != 0 -} - -// Amd3dnowExt indicates support of AMD 3DNOW! Extended instructions -func (c CPUInfo) Amd3dnowExt() bool { - return c.Features&AMD3DNOWEXT != 0 -} - -// VMX indicates support of VMX -func (c CPUInfo) VMX() bool { - return c.Features&VMX != 0 -} - -// MMX indicates support of MMX instructions -func (c CPUInfo) MMX() bool { - return c.Features&MMX != 0 -} - -// MMXExt indicates support of MMXEXT instructions -// (SSE integer functions or AMD MMX ext) -func (c CPUInfo) MMXExt() bool { - return c.Features&MMXEXT != 0 -} - -// SSE indicates support of SSE instructions -func (c CPUInfo) SSE() bool { - return c.Features&SSE != 0 -} - -// SSE2 indicates support of SSE 2 instructions -func (c CPUInfo) SSE2() bool { - return c.Features&SSE2 != 0 -} - -// SSE3 indicates support of SSE 3 instructions -func (c CPUInfo) SSE3() bool { - return c.Features&SSE3 != 0 -} - -// SSSE3 indicates support of SSSE 3 instructions -func (c CPUInfo) SSSE3() bool { - return c.Features&SSSE3 != 0 -} - -// SSE4 indicates support of SSE 4 (also called SSE 4.1) instructions -func (c CPUInfo) SSE4() bool { - return c.Features&SSE4 != 0 -} - -// SSE42 indicates support of SSE4.2 instructions -func (c CPUInfo) SSE42() bool { - return c.Features&SSE42 != 0 -} - -// AVX indicates support of AVX instructions -// and operating system support of AVX instructions -func (c CPUInfo) AVX() bool { - return c.Features&AVX != 0 -} - -// AVX2 indicates support of AVX2 instructions -func (c CPUInfo) AVX2() bool { - return c.Features&AVX2 != 0 -} - -// FMA3 indicates support of FMA3 instructions -func (c CPUInfo) FMA3() bool { - return c.Features&FMA3 != 0 -} - -// FMA4 indicates support of FMA4 instructions -func (c CPUInfo) FMA4() bool { - return c.Features&FMA4 != 0 -} - -// XOP indicates support of XOP instructions -func (c CPUInfo) XOP() bool { - return c.Features&XOP != 0 -} - -// F16C indicates support of F16C instructions -func (c CPUInfo) F16C() bool { - return c.Features&F16C != 0 -} - -// BMI1 indicates support of BMI1 instructions -func (c CPUInfo) BMI1() bool { - return c.Features&BMI1 != 0 -} - -// BMI2 indicates support of BMI2 instructions -func (c CPUInfo) BMI2() bool { - return c.Features&BMI2 != 0 -} - -// TBM indicates support of TBM instructions -// (AMD Trailing Bit Manipulation) -func (c CPUInfo) TBM() bool { - return c.Features&TBM != 0 -} - -// Lzcnt indicates support of LZCNT instruction -func (c CPUInfo) Lzcnt() bool { - return c.Features&LZCNT != 0 -} - -// Popcnt indicates support of POPCNT instruction -func (c CPUInfo) Popcnt() bool { - return c.Features&POPCNT != 0 -} - -// HTT indicates the processor has Hyperthreading enabled -func (c CPUInfo) HTT() bool { - return c.Features&HTT != 0 -} - -// SSE2Slow indicates that SSE2 may be slow on this processor -func (c CPUInfo) SSE2Slow() bool { - return c.Features&SSE2SLOW != 0 -} - -// SSE3Slow indicates that SSE3 may be slow on this processor -func (c CPUInfo) SSE3Slow() bool { - return c.Features&SSE3SLOW != 0 -} - -// AesNi indicates support of AES-NI instructions -// (Advanced Encryption Standard New Instructions) -func (c CPUInfo) AesNi() bool { - return c.Features&AESNI != 0 -} - -// Clmul indicates support of CLMUL instructions -// (Carry-less Multiplication) -func (c CPUInfo) Clmul() bool { - return c.Features&CLMUL != 0 -} - -// NX indicates support of NX (No-Execute) bit -func (c CPUInfo) NX() bool { - return c.Features&NX != 0 -} - -// SSE4A indicates support of AMD Barcelona microarchitecture SSE4a instructions -func (c CPUInfo) SSE4A() bool { - return c.Features&SSE4A != 0 -} - -// HLE indicates support of Hardware Lock Elision -func (c CPUInfo) HLE() bool { - return c.Features&HLE != 0 -} - -// RTM indicates support of Restricted Transactional Memory -func (c CPUInfo) RTM() bool { - return c.Features&RTM != 0 -} - -// Rdrand indicates support of RDRAND instruction is available -func (c CPUInfo) Rdrand() bool { - return c.Features&RDRAND != 0 -} - -// Rdseed indicates support of RDSEED instruction is available -func (c CPUInfo) Rdseed() bool { - return c.Features&RDSEED != 0 -} - -// ADX indicates support of Intel ADX (Multi-Precision Add-Carry Instruction Extensions) -func (c CPUInfo) ADX() bool { - return c.Features&ADX != 0 -} - -// SHA indicates support of Intel SHA Extensions -func (c CPUInfo) SHA() bool { - return c.Features&SHA != 0 -} - -// AVX512F indicates support of AVX-512 Foundation -func (c CPUInfo) AVX512F() bool { - return c.Features&AVX512F != 0 -} - -// AVX512DQ indicates support of AVX-512 Doubleword and Quadword Instructions -func (c CPUInfo) AVX512DQ() bool { - return c.Features&AVX512DQ != 0 -} - -// AVX512IFMA indicates support of AVX-512 Integer Fused Multiply-Add Instructions -func (c CPUInfo) AVX512IFMA() bool { - return c.Features&AVX512IFMA != 0 -} - -// AVX512PF indicates support of AVX-512 Prefetch Instructions -func (c CPUInfo) AVX512PF() bool { - return c.Features&AVX512PF != 0 -} - -// AVX512ER indicates support of AVX-512 Exponential and Reciprocal Instructions -func (c CPUInfo) AVX512ER() bool { - return c.Features&AVX512ER != 0 -} - -// AVX512CD indicates support of AVX-512 Conflict Detection Instructions -func (c CPUInfo) AVX512CD() bool { - return c.Features&AVX512CD != 0 -} - -// AVX512BW indicates support of AVX-512 Byte and Word Instructions -func (c CPUInfo) AVX512BW() bool { - return c.Features&AVX512BW != 0 -} - -// AVX512VL indicates support of AVX-512 Vector Length Extensions -func (c CPUInfo) AVX512VL() bool { - return c.Features&AVX512VL != 0 -} - -// AVX512VBMI indicates support of AVX-512 Vector Bit Manipulation Instructions -func (c CPUInfo) AVX512VBMI() bool { - return c.Features&AVX512VBMI != 0 -} - -// AVX512VBMI2 indicates support of AVX-512 Vector Bit Manipulation Instructions, Version 2 -func (c CPUInfo) AVX512VBMI2() bool { - return c.Features&AVX512VBMI2 != 0 -} - -// AVX512VNNI indicates support of AVX-512 Vector Neural Network Instructions -func (c CPUInfo) AVX512VNNI() bool { - return c.Features&AVX512VNNI != 0 -} - -// AVX512VPOPCNTDQ indicates support of AVX-512 Vector Population Count Doubleword and Quadword -func (c CPUInfo) AVX512VPOPCNTDQ() bool { - return c.Features&AVX512VPOPCNTDQ != 0 -} - -// GFNI indicates support of Galois Field New Instructions -func (c CPUInfo) GFNI() bool { - return c.Features&GFNI != 0 -} - -// VAES indicates support of Vector AES -func (c CPUInfo) VAES() bool { - return c.Features&VAES != 0 -} - -// AVX512BITALG indicates support of AVX-512 Bit Algorithms -func (c CPUInfo) AVX512BITALG() bool { - return c.Features&AVX512BITALG != 0 -} - -// VPCLMULQDQ indicates support of Carry-Less Multiplication Quadword -func (c CPUInfo) VPCLMULQDQ() bool { - return c.Features&VPCLMULQDQ != 0 -} - -// AVX512BF16 indicates support of -func (c CPUInfo) AVX512BF16() bool { - return c.Features&AVX512BF16 != 0 -} - -// AVX512VP2INTERSECT indicates support of -func (c CPUInfo) AVX512VP2INTERSECT() bool { - return c.Features&AVX512VP2INTERSECT != 0 -} - -// MPX indicates support of Intel MPX (Memory Protection Extensions) -func (c CPUInfo) MPX() bool { - return c.Features&MPX != 0 -} - -// ERMS indicates support of Enhanced REP MOVSB/STOSB -func (c CPUInfo) ERMS() bool { - return c.Features&ERMS != 0 -} - -// RDTSCP Instruction is available. -func (c CPUInfo) RDTSCP() bool { - return c.Features&RDTSCP != 0 -} - -// CX16 indicates if CMPXCHG16B instruction is available. -func (c CPUInfo) CX16() bool { - return c.Features&CX16 != 0 -} - -// TSX is split into HLE (Hardware Lock Elision) and RTM (Restricted Transactional Memory) detection. -// So TSX simply checks that. -func (c CPUInfo) TSX() bool { - return c.Features&(HLE|RTM) == HLE|RTM -} - -// Atom indicates an Atom processor -func (c CPUInfo) Atom() bool { - return c.Features&ATOM != 0 -} - -// Intel returns true if vendor is recognized as Intel -func (c CPUInfo) Intel() bool { - return c.VendorID == Intel -} - -// AMD returns true if vendor is recognized as AMD -func (c CPUInfo) AMD() bool { - return c.VendorID == AMD -} - -// Hygon returns true if vendor is recognized as Hygon -func (c CPUInfo) Hygon() bool { - return c.VendorID == Hygon -} - -// Transmeta returns true if vendor is recognized as Transmeta -func (c CPUInfo) Transmeta() bool { - return c.VendorID == Transmeta -} - -// NSC returns true if vendor is recognized as National Semiconductor -func (c CPUInfo) NSC() bool { - return c.VendorID == NSC -} - -// VIA returns true if vendor is recognized as VIA -func (c CPUInfo) VIA() bool { - return c.VendorID == VIA -} - -// RTCounter returns the 64-bit time-stamp counter -// Uses the RDTSCP instruction. The value 0 is returned -// if the CPU does not support the instruction. -func (c CPUInfo) RTCounter() uint64 { - if !c.RDTSCP() { - return 0 - } - a, _, _, d := rdtscpAsm() - return uint64(a) | (uint64(d) << 32) -} - -// Ia32TscAux returns the IA32_TSC_AUX part of the RDTSCP. -// This variable is OS dependent, but on Linux contains information -// about the current cpu/core the code is running on. -// If the RDTSCP instruction isn't supported on the CPU, the value 0 is returned. -func (c CPUInfo) Ia32TscAux() uint32 { - if !c.RDTSCP() { - return 0 - } - _, _, ecx, _ := rdtscpAsm() - return ecx -} - -// LogicalCPU will return the Logical CPU the code is currently executing on. -// This is likely to change when the OS re-schedules the running thread -// to another CPU. -// If the current core cannot be detected, -1 will be returned. -func (c CPUInfo) LogicalCPU() int { - if c.maxFunc < 1 { - return -1 - } - _, ebx, _, _ := cpuid(1) - return int(ebx >> 24) -} - -// hertz tries to compute the clock speed of the CPU. If leaf 15 is -// supported, use it, otherwise parse the brand string. Yes, really. -func hertz(model string) int64 { - mfi := maxFunctionID() - if mfi >= 0x15 { - eax, ebx, ecx, _ := cpuid(0x15) - if eax != 0 && ebx != 0 && ecx != 0 { - return int64((int64(ecx) * int64(ebx)) / int64(eax)) - } - } - // computeHz determines the official rated speed of a CPU from its brand - // string. This insanity is *actually the official documented way to do - // this according to Intel*, prior to leaf 0x15 existing. The official - // documentation only shows this working for exactly `x.xx` or `xxxx` - // cases, e.g., `2.50GHz` or `1300MHz`; this parser will accept other - // sizes. - hz := strings.LastIndex(model, "Hz") - if hz < 3 { - return -1 - } - var multiplier int64 - switch model[hz-1] { - case 'M': - multiplier = 1000 * 1000 - case 'G': - multiplier = 1000 * 1000 * 1000 - case 'T': - multiplier = 1000 * 1000 * 1000 * 1000 - } - if multiplier == 0 { - return -1 - } - freq := int64(0) - divisor := int64(0) - decimalShift := int64(1) - var i int - for i = hz - 2; i >= 0 && model[i] != ' '; i-- { - if model[i] >= '0' && model[i] <= '9' { - freq += int64(model[i]-'0') * decimalShift - decimalShift *= 10 - } else if model[i] == '.' { - if divisor != 0 { - return -1 - } - divisor = decimalShift - } else { - return -1 - } - } - // we didn't find a space - if i < 0 { - return -1 - } - if divisor != 0 { - return (freq * multiplier) / divisor - } - return freq * multiplier -} - -// VM Will return true if the cpu id indicates we are in -// a virtual machine. This is only a hint, and will very likely -// have many false negatives. -func (c CPUInfo) VM() bool { - switch c.VendorID { - case MSVM, KVM, VMware, XenHVM, Bhyve: - return true - } - return false -} - -// Flags contains detected cpu features and characteristics -type Flags uint64 - -// ArmFlags contains detected ARM cpu features and characteristics -type ArmFlags uint64 - -// String returns a string representation of the detected -// CPU features. -func (f Flags) String() string { - return strings.Join(f.Strings(), ",") -} - -// Strings returns an array of the detected features. -func (f Flags) Strings() []string { - r := make([]string, 0, 20) - for i := uint(0); i < 64; i++ { - key := Flags(1 << i) - val := flagNames[key] - if f&key != 0 { - r = append(r, val) - } - } - return r -} - -// String returns a string representation of the detected -// CPU features. -func (f ArmFlags) String() string { - return strings.Join(f.Strings(), ",") -} - -// Strings returns an array of the detected features. -func (f ArmFlags) Strings() []string { - r := make([]string, 0, 20) - for i := uint(0); i < 64; i++ { - key := ArmFlags(1 << i) - val := flagNamesArm[key] - if f&key != 0 { - r = append(r, val) - } - } - return r -} -func maxExtendedFunction() uint32 { - eax, _, _, _ := cpuid(0x80000000) - return eax -} - -func maxFunctionID() uint32 { - a, _, _, _ := cpuid(0) - return a -} - -func brandName() string { - if maxExtendedFunction() >= 0x80000004 { - v := make([]uint32, 0, 48) - for i := uint32(0); i < 3; i++ { - a, b, c, d := cpuid(0x80000002 + i) - v = append(v, a, b, c, d) - } - return strings.Trim(string(valAsString(v...)), " ") - } - return "unknown" -} - -func threadsPerCore() int { - mfi := maxFunctionID() - vend, _ := vendorID() - - if mfi < 0x4 || (vend != Intel && vend != AMD) { - return 1 - } - - if mfi < 0xb { - if vend != Intel { - return 1 - } - _, b, _, d := cpuid(1) - if (d & (1 << 28)) != 0 { - // v will contain logical core count - v := (b >> 16) & 255 - if v > 1 { - a4, _, _, _ := cpuid(4) - // physical cores - v2 := (a4 >> 26) + 1 - if v2 > 0 { - return int(v) / int(v2) - } - } - } - return 1 - } - _, b, _, _ := cpuidex(0xb, 0) - if b&0xffff == 0 { - return 1 - } - return int(b & 0xffff) -} - -func logicalCores() int { - mfi := maxFunctionID() - v, _ := vendorID() - switch v { - case Intel: - // Use this on old Intel processors - if mfi < 0xb { - if mfi < 1 { - return 0 - } - // CPUID.1:EBX[23:16] represents the maximum number of addressable IDs (initial APIC ID) - // that can be assigned to logical processors in a physical package. - // The value may not be the same as the number of logical processors that are present in the hardware of a physical package. - _, ebx, _, _ := cpuid(1) - logical := (ebx >> 16) & 0xff - return int(logical) - } - _, b, _, _ := cpuidex(0xb, 1) - return int(b & 0xffff) - case AMD, Hygon: - _, b, _, _ := cpuid(1) - return int((b >> 16) & 0xff) - default: - return 0 - } -} - -func familyModel() (int, int) { - if maxFunctionID() < 0x1 { - return 0, 0 - } - eax, _, _, _ := cpuid(1) - family := ((eax >> 8) & 0xf) + ((eax >> 20) & 0xff) - model := ((eax >> 4) & 0xf) + ((eax >> 12) & 0xf0) - return int(family), int(model) -} - -func physicalCores() int { - v, _ := vendorID() - switch v { - case Intel: - return logicalCores() / threadsPerCore() - case AMD, Hygon: - lc := logicalCores() - tpc := threadsPerCore() - if lc > 0 && tpc > 0 { - return lc / tpc - } - // The following is inaccurate on AMD EPYC 7742 64-Core Processor - - if maxExtendedFunction() >= 0x80000008 { - _, _, c, _ := cpuid(0x80000008) - return int(c&0xff) + 1 - } - } - return 0 -} - -// Except from http://en.wikipedia.org/wiki/CPUID#EAX.3D0:_Get_vendor_ID -var vendorMapping = map[string]Vendor{ - "AMDisbetter!": AMD, - "AuthenticAMD": AMD, - "CentaurHauls": VIA, - "GenuineIntel": Intel, - "TransmetaCPU": Transmeta, - "GenuineTMx86": Transmeta, - "Geode by NSC": NSC, - "VIA VIA VIA ": VIA, - "KVMKVMKVMKVM": KVM, - "Microsoft Hv": MSVM, - "VMwareVMware": VMware, - "XenVMMXenVMM": XenHVM, - "bhyve bhyve ": Bhyve, - "HygonGenuine": Hygon, - "Vortex86 SoC": SiS, - "SiS SiS SiS ": SiS, - "RiseRiseRise": SiS, - "Genuine RDC": RDC, -} - -func vendorID() (Vendor, string) { - _, b, c, d := cpuid(0) - v := string(valAsString(b, d, c)) - vend, ok := vendorMapping[v] - if !ok { - return Other, v - } - return vend, v -} - -func cacheLine() int { - if maxFunctionID() < 0x1 { - return 0 - } - - _, ebx, _, _ := cpuid(1) - cache := (ebx & 0xff00) >> 5 // cflush size - if cache == 0 && maxExtendedFunction() >= 0x80000006 { - _, _, ecx, _ := cpuid(0x80000006) - cache = ecx & 0xff // cacheline size - } - // TODO: Read from Cache and TLB Information - return int(cache) -} - -func (c *CPUInfo) cacheSize() { - c.Cache.L1D = -1 - c.Cache.L1I = -1 - c.Cache.L2 = -1 - c.Cache.L3 = -1 - vendor, _ := vendorID() - switch vendor { - case Intel: - if maxFunctionID() < 4 { - return - } - for i := uint32(0); ; i++ { - eax, ebx, ecx, _ := cpuidex(4, i) - cacheType := eax & 15 - if cacheType == 0 { - break - } - cacheLevel := (eax >> 5) & 7 - coherency := int(ebx&0xfff) + 1 - partitions := int((ebx>>12)&0x3ff) + 1 - associativity := int((ebx>>22)&0x3ff) + 1 - sets := int(ecx) + 1 - size := associativity * partitions * coherency * sets - switch cacheLevel { - case 1: - if cacheType == 1 { - // 1 = Data Cache - c.Cache.L1D = size - } else if cacheType == 2 { - // 2 = Instruction Cache - c.Cache.L1I = size - } else { - if c.Cache.L1D < 0 { - c.Cache.L1I = size - } - if c.Cache.L1I < 0 { - c.Cache.L1I = size - } - } - case 2: - c.Cache.L2 = size - case 3: - c.Cache.L3 = size - } - } - case AMD, Hygon: - // Untested. - if maxExtendedFunction() < 0x80000005 { - return - } - _, _, ecx, edx := cpuid(0x80000005) - c.Cache.L1D = int(((ecx >> 24) & 0xFF) * 1024) - c.Cache.L1I = int(((edx >> 24) & 0xFF) * 1024) - - if maxExtendedFunction() < 0x80000006 { - return - } - _, _, ecx, _ = cpuid(0x80000006) - c.Cache.L2 = int(((ecx >> 16) & 0xFFFF) * 1024) - - // CPUID Fn8000_001D_EAX_x[N:0] Cache Properties - if maxExtendedFunction() < 0x8000001D { - return - } - for i := uint32(0); i < math.MaxUint32; i++ { - eax, ebx, ecx, _ := cpuidex(0x8000001D, i) - - level := (eax >> 5) & 7 - cacheNumSets := ecx + 1 - cacheLineSize := 1 + (ebx & 2047) - cachePhysPartitions := 1 + ((ebx >> 12) & 511) - cacheNumWays := 1 + ((ebx >> 22) & 511) - - typ := eax & 15 - size := int(cacheNumSets * cacheLineSize * cachePhysPartitions * cacheNumWays) - if typ == 0 { - return - } - - switch level { - case 1: - switch typ { - case 1: - // Data cache - c.Cache.L1D = size - case 2: - // Inst cache - c.Cache.L1I = size - default: - if c.Cache.L1D < 0 { - c.Cache.L1I = size - } - if c.Cache.L1I < 0 { - c.Cache.L1I = size - } - } - case 2: - c.Cache.L2 = size - case 3: - c.Cache.L3 = size - } - } - } - - return -} - -type SGXEPCSection struct { - BaseAddress uint64 - EPCSize uint64 -} - -type SGXSupport struct { - Available bool - LaunchControl bool - SGX1Supported bool - SGX2Supported bool - MaxEnclaveSizeNot64 int64 - MaxEnclaveSize64 int64 - EPCSections []SGXEPCSection -} - -func hasSGX(available, lc bool) (rval SGXSupport) { - rval.Available = available - - if !available { - return - } - - rval.LaunchControl = lc - - a, _, _, d := cpuidex(0x12, 0) - rval.SGX1Supported = a&0x01 != 0 - rval.SGX2Supported = a&0x02 != 0 - rval.MaxEnclaveSizeNot64 = 1 << (d & 0xFF) // pow 2 - rval.MaxEnclaveSize64 = 1 << ((d >> 8) & 0xFF) // pow 2 - rval.EPCSections = make([]SGXEPCSection, 0) - - for subleaf := uint32(2); subleaf < 2+8; subleaf++ { - eax, ebx, ecx, edx := cpuidex(0x12, subleaf) - leafType := eax & 0xf - - if leafType == 0 { - // Invalid subleaf, stop iterating - break - } else if leafType == 1 { - // EPC Section subleaf - baseAddress := uint64(eax&0xfffff000) + (uint64(ebx&0x000fffff) << 32) - size := uint64(ecx&0xfffff000) + (uint64(edx&0x000fffff) << 32) - - section := SGXEPCSection{BaseAddress: baseAddress, EPCSize: size} - rval.EPCSections = append(rval.EPCSections, section) - } - } - - return -} - -func support() Flags { - mfi := maxFunctionID() - vend, _ := vendorID() - if mfi < 0x1 { - return 0 - } - rval := uint64(0) - _, _, c, d := cpuid(1) - if (d & (1 << 15)) != 0 { - rval |= CMOV - } - if (d & (1 << 23)) != 0 { - rval |= MMX - } - if (d & (1 << 25)) != 0 { - rval |= MMXEXT - } - if (d & (1 << 25)) != 0 { - rval |= SSE - } - if (d & (1 << 26)) != 0 { - rval |= SSE2 - } - if (c & 1) != 0 { - rval |= SSE3 - } - if (c & (1 << 5)) != 0 { - rval |= VMX - } - if (c & 0x00000200) != 0 { - rval |= SSSE3 - } - if (c & 0x00080000) != 0 { - rval |= SSE4 - } - if (c & 0x00100000) != 0 { - rval |= SSE42 - } - if (c & (1 << 25)) != 0 { - rval |= AESNI - } - if (c & (1 << 1)) != 0 { - rval |= CLMUL - } - if c&(1<<23) != 0 { - rval |= POPCNT - } - if c&(1<<30) != 0 { - rval |= RDRAND - } - if c&(1<<29) != 0 { - rval |= F16C - } - if c&(1<<13) != 0 { - rval |= CX16 - } - if vend == Intel && (d&(1<<28)) != 0 && mfi >= 4 { - if threadsPerCore() > 1 { - rval |= HTT - } - } - if vend == AMD && (d&(1<<28)) != 0 && mfi >= 4 { - if threadsPerCore() > 1 { - rval |= HTT - } - } - // Check XGETBV, OXSAVE and AVX bits - if c&(1<<26) != 0 && c&(1<<27) != 0 && c&(1<<28) != 0 { - // Check for OS support - eax, _ := xgetbv(0) - if (eax & 0x6) == 0x6 { - rval |= AVX - if (c & 0x00001000) != 0 { - rval |= FMA3 - } - } - } - - // Check AVX2, AVX2 requires OS support, but BMI1/2 don't. - if mfi >= 7 { - _, ebx, ecx, edx := cpuidex(7, 0) - eax1, _, _, _ := cpuidex(7, 1) - if (rval&AVX) != 0 && (ebx&0x00000020) != 0 { - rval |= AVX2 - } - if (ebx & 0x00000008) != 0 { - rval |= BMI1 - if (ebx & 0x00000100) != 0 { - rval |= BMI2 - } - } - if ebx&(1<<2) != 0 { - rval |= SGX - } - if ebx&(1<<4) != 0 { - rval |= HLE - } - if ebx&(1<<9) != 0 { - rval |= ERMS - } - if ebx&(1<<11) != 0 { - rval |= RTM - } - if ebx&(1<<14) != 0 { - rval |= MPX - } - if ebx&(1<<18) != 0 { - rval |= RDSEED - } - if ebx&(1<<19) != 0 { - rval |= ADX - } - if ebx&(1<<29) != 0 { - rval |= SHA - } - if edx&(1<<26) != 0 { - rval |= IBPB - } - if ecx&(1<<30) != 0 { - rval |= SGXLC - } - if edx&(1<<27) != 0 { - rval |= STIBP - } - - // Only detect AVX-512 features if XGETBV is supported - if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) { - // Check for OS support - eax, _ := xgetbv(0) - - // Verify that XCR0[7:5] = ‘111b’ (OPMASK state, upper 256-bit of ZMM0-ZMM15 and - // ZMM16-ZMM31 state are enabled by OS) - /// and that XCR0[2:1] = ‘11b’ (XMM state and YMM state are enabled by OS). - if (eax>>5)&7 == 7 && (eax>>1)&3 == 3 { - if ebx&(1<<16) != 0 { - rval |= AVX512F - } - if ebx&(1<<17) != 0 { - rval |= AVX512DQ - } - if ebx&(1<<21) != 0 { - rval |= AVX512IFMA - } - if ebx&(1<<26) != 0 { - rval |= AVX512PF - } - if ebx&(1<<27) != 0 { - rval |= AVX512ER - } - if ebx&(1<<28) != 0 { - rval |= AVX512CD - } - if ebx&(1<<30) != 0 { - rval |= AVX512BW - } - if ebx&(1<<31) != 0 { - rval |= AVX512VL - } - // ecx - if ecx&(1<<1) != 0 { - rval |= AVX512VBMI - } - if ecx&(1<<6) != 0 { - rval |= AVX512VBMI2 - } - if ecx&(1<<8) != 0 { - rval |= GFNI - } - if ecx&(1<<9) != 0 { - rval |= VAES - } - if ecx&(1<<10) != 0 { - rval |= VPCLMULQDQ - } - if ecx&(1<<11) != 0 { - rval |= AVX512VNNI - } - if ecx&(1<<12) != 0 { - rval |= AVX512BITALG - } - if ecx&(1<<14) != 0 { - rval |= AVX512VPOPCNTDQ - } - // edx - if edx&(1<<8) != 0 { - rval |= AVX512VP2INTERSECT - } - // cpuid eax 07h,ecx=1 - if eax1&(1<<5) != 0 { - rval |= AVX512BF16 - } - } - } - } - - if maxExtendedFunction() >= 0x80000001 { - _, _, c, d := cpuid(0x80000001) - if (c & (1 << 5)) != 0 { - rval |= LZCNT - rval |= POPCNT - } - if (d & (1 << 31)) != 0 { - rval |= AMD3DNOW - } - if (d & (1 << 30)) != 0 { - rval |= AMD3DNOWEXT - } - if (d & (1 << 23)) != 0 { - rval |= MMX - } - if (d & (1 << 22)) != 0 { - rval |= MMXEXT - } - if (c & (1 << 6)) != 0 { - rval |= SSE4A - } - if d&(1<<20) != 0 { - rval |= NX - } - if d&(1<<27) != 0 { - rval |= RDTSCP - } - - /* Allow for selectively disabling SSE2 functions on AMD processors - with SSE2 support but not SSE4a. This includes Athlon64, some - Opteron, and some Sempron processors. MMX, SSE, or 3DNow! are faster - than SSE2 often enough to utilize this special-case flag. - AV_CPU_FLAG_SSE2 and AV_CPU_FLAG_SSE2SLOW are both set in this case - so that SSE2 is used unless explicitly disabled by checking - AV_CPU_FLAG_SSE2SLOW. */ - if vend != Intel && - rval&SSE2 != 0 && (c&0x00000040) == 0 { - rval |= SSE2SLOW - } - - /* XOP and FMA4 use the AVX instruction coding scheme, so they can't be - * used unless the OS has AVX support. */ - if (rval & AVX) != 0 { - if (c & 0x00000800) != 0 { - rval |= XOP - } - if (c & 0x00010000) != 0 { - rval |= FMA4 - } - } - - if vend == Intel { - family, model := familyModel() - if family == 6 && (model == 9 || model == 13 || model == 14) { - /* 6/9 (pentium-m "banias"), 6/13 (pentium-m "dothan"), and - * 6/14 (core1 "yonah") theoretically support sse2, but it's - * usually slower than mmx. */ - if (rval & SSE2) != 0 { - rval |= SSE2SLOW - } - if (rval & SSE3) != 0 { - rval |= SSE3SLOW - } - } - /* The Atom processor has SSSE3 support, which is useful in many cases, - * but sometimes the SSSE3 version is slower than the SSE2 equivalent - * on the Atom, but is generally faster on other processors supporting - * SSSE3. This flag allows for selectively disabling certain SSSE3 - * functions on the Atom. */ - if family == 6 && model == 28 { - rval |= ATOM - } - } - } - return Flags(rval) -} - -func valAsString(values ...uint32) []byte { - r := make([]byte, 4*len(values)) - for i, v := range values { - dst := r[i*4:] - dst[0] = byte(v & 0xff) - dst[1] = byte((v >> 8) & 0xff) - dst[2] = byte((v >> 16) & 0xff) - dst[3] = byte((v >> 24) & 0xff) - switch { - case dst[0] == 0: - return r[:i*4] - case dst[1] == 0: - return r[:i*4+1] - case dst[2] == 0: - return r[:i*4+2] - case dst[3] == 0: - return r[:i*4+3] - } - } - return r -} - -// Single-precision and double-precision floating point -func (c CPUInfo) ArmFP() bool { - return c.Arm&FP != 0 -} - -// Advanced SIMD -func (c CPUInfo) ArmASIMD() bool { - return c.Arm&ASIMD != 0 -} - -// Generic timer -func (c CPUInfo) ArmEVTSTRM() bool { - return c.Arm&EVTSTRM != 0 -} - -// AES instructions -func (c CPUInfo) ArmAES() bool { - return c.Arm&AES != 0 -} - -// Polynomial Multiply instructions (PMULL/PMULL2) -func (c CPUInfo) ArmPMULL() bool { - return c.Arm&PMULL != 0 -} - -// SHA-1 instructions (SHA1C, etc) -func (c CPUInfo) ArmSHA1() bool { - return c.Arm&SHA1 != 0 -} - -// SHA-2 instructions (SHA256H, etc) -func (c CPUInfo) ArmSHA2() bool { - return c.Arm&SHA2 != 0 -} - -// CRC32/CRC32C instructions -func (c CPUInfo) ArmCRC32() bool { - return c.Arm&CRC32 != 0 -} - -// Large System Extensions (LSE) -func (c CPUInfo) ArmATOMICS() bool { - return c.Arm&ATOMICS != 0 -} - -// Half-precision floating point -func (c CPUInfo) ArmFPHP() bool { - return c.Arm&FPHP != 0 -} - -// Advanced SIMD half-precision floating point -func (c CPUInfo) ArmASIMDHP() bool { - return c.Arm&ASIMDHP != 0 -} - -// Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) -func (c CPUInfo) ArmASIMDRDM() bool { - return c.Arm&ASIMDRDM != 0 -} - -// Javascript-style double->int convert (FJCVTZS) -func (c CPUInfo) ArmJSCVT() bool { - return c.Arm&JSCVT != 0 -} - -// Floatin point complex number addition and multiplication -func (c CPUInfo) ArmFCMA() bool { - return c.Arm&FCMA != 0 -} - -// Weaker release consistency (LDAPR, etc) -func (c CPUInfo) ArmLRCPC() bool { - return c.Arm&LRCPC != 0 -} - -// Data cache clean to Point of Persistence (DC CVAP) -func (c CPUInfo) ArmDCPOP() bool { - return c.Arm&DCPOP != 0 -} - -// SHA-3 instructions (EOR3, RAXI, XAR, BCAX) -func (c CPUInfo) ArmSHA3() bool { - return c.Arm&SHA3 != 0 -} - -// SM3 instructions -func (c CPUInfo) ArmSM3() bool { - return c.Arm&SM3 != 0 -} - -// SM4 instructions -func (c CPUInfo) ArmSM4() bool { - return c.Arm&SM4 != 0 -} - -// SIMD Dot Product -func (c CPUInfo) ArmASIMDDP() bool { - return c.Arm&ASIMDDP != 0 -} - -// SHA512 instructions -func (c CPUInfo) ArmSHA512() bool { - return c.Arm&SHA512 != 0 -} - -// Scalable Vector Extension -func (c CPUInfo) ArmSVE() bool { - return c.Arm&SVE != 0 -} - -// Generic Pointer Authentication -func (c CPUInfo) ArmGPA() bool { - return c.Arm&GPA != 0 -} diff --git a/vendor/github.com/klauspost/cpuid/.gitignore b/vendor/github.com/klauspost/cpuid/v2/.gitignore index daf913b1b..daf913b1b 100644 --- a/vendor/github.com/klauspost/cpuid/.gitignore +++ b/vendor/github.com/klauspost/cpuid/v2/.gitignore diff --git a/vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml b/vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml new file mode 100644 index 000000000..944cc0007 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml @@ -0,0 +1,74 @@ +# This is an example goreleaser.yaml file with some sane defaults. +# Make sure to check the documentation at http://goreleaser.com + +builds: + - + id: "cpuid" + binary: cpuid + main: ./cmd/cpuid/main.go + env: + - CGO_ENABLED=0 + flags: + - -ldflags=-s -w + goos: + - aix + - linux + - freebsd + - netbsd + - windows + - darwin + goarch: + - 386 + - amd64 + - arm64 + goarm: + - 7 + +archives: + - + id: cpuid + name_template: "cpuid-{{ .Os }}_{{ .Arch }}_{{ .Version }}" + replacements: + aix: AIX + darwin: OSX + linux: Linux + windows: Windows + 386: i386 + amd64: x86_64 + freebsd: FreeBSD + netbsd: NetBSD + format_overrides: + - goos: windows + format: zip + files: + - LICENSE +checksum: + name_template: 'checksums.txt' +snapshot: + name_template: "{{ .Tag }}-next" +changelog: + sort: asc + filters: + exclude: + - '^doc:' + - '^docs:' + - '^test:' + - '^tests:' + - '^Update\sREADME.md' + +nfpms: + - + file_name_template: "cpuid_package_{{ .Version }}_{{ .Os }}_{{ .Arch }}" + vendor: Klaus Post + homepage: https://github.com/klauspost/cpuid + maintainer: Klaus Post <klauspost@gmail.com> + description: CPUID Tool + license: BSD 3-Clause + formats: + - deb + - rpm + replacements: + darwin: Darwin + linux: Linux + freebsd: FreeBSD + amd64: x86_64 diff --git a/vendor/github.com/klauspost/cpuid/CONTRIBUTING.txt b/vendor/github.com/klauspost/cpuid/v2/CONTRIBUTING.txt index 2ef4714f7..2ef4714f7 100644 --- a/vendor/github.com/klauspost/cpuid/CONTRIBUTING.txt +++ b/vendor/github.com/klauspost/cpuid/v2/CONTRIBUTING.txt diff --git a/vendor/github.com/klauspost/cpuid/LICENSE b/vendor/github.com/klauspost/cpuid/v2/LICENSE index 5cec7ee94..5cec7ee94 100644 --- a/vendor/github.com/klauspost/cpuid/LICENSE +++ b/vendor/github.com/klauspost/cpuid/v2/LICENSE diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md new file mode 100644 index 000000000..ea7df3dd8 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -0,0 +1,258 @@ +# cpuid +Package cpuid provides information about the CPU running the current program. + +CPU features are detected on startup, and kept for fast access through the life of the application. +Currently x86 / x64 (AMD64/i386) and ARM (ARM64) is supported, and no external C (cgo) code is used, which should make the library very easy to use. + +You can access the CPU information by accessing the shared CPU variable of the cpuid library. + +Package home: https://github.com/klauspost/cpuid + +[](https://pkg.go.dev/github.com/klauspost/cpuid/v2) +[![Build Status][3]][4] + +[3]: https://travis-ci.org/klauspost/cpuid.svg?branch=master +[4]: https://travis-ci.org/klauspost/cpuid + +## installing + +`go get -u github.com/klauspost/cpuid/v2` using modules. + +Drop `v2` for others. + +## example + +```Go +package main + +import ( + "fmt" + "strings" + + . "github.com/klauspost/cpuid/v2" +) + +func main() { + // Print basic CPU information: + fmt.Println("Name:", CPU.BrandName) + fmt.Println("PhysicalCores:", CPU.PhysicalCores) + fmt.Println("ThreadsPerCore:", CPU.ThreadsPerCore) + fmt.Println("LogicalCores:", CPU.LogicalCores) + fmt.Println("Family", CPU.Family, "Model:", CPU.Model, "Vendor ID:", CPU.VendorID) + fmt.Println("Features:", strings.Join(CPU.FeatureSet(), ",")) + fmt.Println("Cacheline bytes:", CPU.CacheLine) + fmt.Println("L1 Data Cache:", CPU.Cache.L1D, "bytes") + fmt.Println("L1 Instruction Cache:", CPU.Cache.L1I, "bytes") + fmt.Println("L2 Cache:", CPU.Cache.L2, "bytes") + fmt.Println("L3 Cache:", CPU.Cache.L3, "bytes") + fmt.Println("Frequency", CPU.Hz, "hz") + + // Test if we have these specific features: + if CPU.Supports(SSE, SSE2) { + fmt.Println("We have Streaming SIMD 2 Extensions") + } +} +``` + +Sample output: +``` +>go run main.go +Name: AMD Ryzen 9 3950X 16-Core Processor +PhysicalCores: 16 +ThreadsPerCore: 2 +LogicalCores: 32 +Family 23 Model: 113 Vendor ID: AMD +Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CMOV,CX16,F16C,FMA3,HTT,HYPERVISOR,LZCNT,MMX,MMXEXT,NX,POPCNT,RDRAND,RDSEED,RDTSCP,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3 +Cacheline bytes: 64 +L1 Data Cache: 32768 bytes +L1 Instruction Cache: 32768 bytes +L2 Cache: 524288 bytes +L3 Cache: 16777216 bytes +Frequency 0 hz +We have Streaming SIMD 2 Extensions +``` + +# usage + +The `cpuid.CPU` provides access to CPU features. Use `cpuid.CPU.Supports()` to check for CPU features. +A faster `cpuid.CPU.Has()` is provided which will usually be inlined by the gc compiler. + +Note that for some cpu/os combinations some features will not be detected. +`amd64` has rather good support and should work reliably on all platforms. + +Note that hypervisors may not pass through all CPU features. + +## arm64 feature detection + +Not all operating systems provide ARM features directly +and there is no safe way to do so for the rest. + +Currently `arm64/linux` and `arm64/freebsd` should be quite reliable. +`arm64/darwin` adds features expected from the M1 processor, but a lot remains undetected. + +A `DetectARM()` can be used if you are able to control your deployment, +it will detect CPU features, but may crash if the OS doesn't intercept the calls. +A `-cpu.arm` flag for detecting unsafe ARM features can be added. See below. + +Note that currently only features are detected on ARM, +no additional information is currently available. + +## flags + +It is possible to add flags that affects cpu detection. + +For this the `Flags()` command is provided. + +This must be called *before* `flag.Parse()` AND after the flags have been parsed `Detect()` must be called. + +This means that any detection used in `init()` functions will not contain these flags. + +Example: + +```Go +package main + +import ( + "flag" + "fmt" + "strings" + + "github.com/klauspost/cpuid/v2" +) + +func main() { + cpuid.Flags() + flag.Parse() + cpuid.Detect() + + // Test if we have these specific features: + if cpuid.CPU.Supports(cpuid.SSE, cpuid.SSE2) { + fmt.Println("We have Streaming SIMD 2 Extensions") + } +} +``` + +## commandline + +Download as binary from: https://github.com/klauspost/cpuid/releases + +Install from source: + +`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest` + +### Example + +``` +λ cpuid +Name: AMD Ryzen 9 3950X 16-Core Processor +Vendor String: AuthenticAMD +Vendor ID: AMD +PhysicalCores: 16 +Threads Per Core: 2 +Logical Cores: 32 +CPU Family 23 Model: 113 +Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CLZERO,CMOV,CMPXCHG8,CPBOOST,CX16,F16C,FMA3,FXSR,FXSROPT,HTT,HYPERVISOR,LAHF,LZCNT,MCAOVERFLOW,MMX,MMXEXT,MOVBE,NX,OSXSAVE,POPCNT,RDRAND,RDSEED,RDTSCP,SCE,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3,SUCCOR,X87,XSAVE +Microarchitecture level: 3 +Cacheline bytes: 64 +L1 Instruction Cache: 32768 bytes +L1 Data Cache: 32768 bytes +L2 Cache: 524288 bytes +L3 Cache: 16777216 bytes + +``` +### JSON Output: + +``` +λ cpuid --json +{ + "BrandName": "AMD Ryzen 9 3950X 16-Core Processor", + "VendorID": 2, + "VendorString": "AuthenticAMD", + "PhysicalCores": 16, + "ThreadsPerCore": 2, + "LogicalCores": 32, + "Family": 23, + "Model": 113, + "CacheLine": 64, + "Hz": 0, + "BoostFreq": 0, + "Cache": { + "L1I": 32768, + "L1D": 32768, + "L2": 524288, + "L3": 16777216 + }, + "SGX": { + "Available": false, + "LaunchControl": false, + "SGX1Supported": false, + "SGX2Supported": false, + "MaxEnclaveSizeNot64": 0, + "MaxEnclaveSize64": 0, + "EPCSections": null + }, + "Features": [ + "ADX", + "AESNI", + "AVX", + "AVX2", + "BMI1", + "BMI2", + "CLMUL", + "CLZERO", + "CMOV", + "CMPXCHG8", + "CPBOOST", + "CX16", + "F16C", + "FMA3", + "FXSR", + "FXSROPT", + "HTT", + "HYPERVISOR", + "LAHF", + "LZCNT", + "MCAOVERFLOW", + "MMX", + "MMXEXT", + "MOVBE", + "NX", + "OSXSAVE", + "POPCNT", + "RDRAND", + "RDSEED", + "RDTSCP", + "SCE", + "SHA", + "SSE", + "SSE2", + "SSE3", + "SSE4", + "SSE42", + "SSE4A", + "SSSE3", + "SUCCOR", + "X87", + "XSAVE" + ], + "X64Level": 3 +} +``` + +### Check CPU microarch level + +``` +λ cpuid --check-level=3 +2022/03/18 17:04:40 AMD Ryzen 9 3950X 16-Core Processor +2022/03/18 17:04:40 Microarchitecture level 3 is supported. Max level is 3. +Exit Code 0 + +λ cpuid --check-level=4 +2022/03/18 17:06:18 AMD Ryzen 9 3950X 16-Core Processor +2022/03/18 17:06:18 Microarchitecture level 4 not supported. Max level is 3. +Exit Code 1 +``` + +# license + +This code is published under an MIT license. See LICENSE file for more information. diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go new file mode 100644 index 000000000..27f33250e --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -0,0 +1,1291 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +// Package cpuid provides information about the CPU running the current program. +// +// CPU features are detected on startup, and kept for fast access through the life of the application. +// Currently x86 / x64 (AMD64) as well as arm64 is supported. +// +// You can access the CPU information by accessing the shared CPU variable of the cpuid library. +// +// Package home: https://github.com/klauspost/cpuid +package cpuid + +import ( + "flag" + "fmt" + "math" + "math/bits" + "os" + "runtime" + "strings" +) + +// AMD refererence: https://www.amd.com/system/files/TechDocs/25481.pdf +// and Processor Programming Reference (PPR) + +// Vendor is a representation of a CPU vendor. +type Vendor int + +const ( + VendorUnknown Vendor = iota + Intel + AMD + VIA + Transmeta + NSC + KVM // Kernel-based Virtual Machine + MSVM // Microsoft Hyper-V or Windows Virtual PC + VMware + XenHVM + Bhyve + Hygon + SiS + RDC + + Ampere + ARM + Broadcom + Cavium + DEC + Fujitsu + Infineon + Motorola + NVIDIA + AMCC + Qualcomm + Marvell + + lastVendor +) + +//go:generate stringer -type=FeatureID,Vendor + +// FeatureID is the ID of a specific cpu feature. +type FeatureID int + +const ( + // Keep index -1 as unknown + UNKNOWN = -1 + + // Add features + ADX FeatureID = iota // Intel ADX (Multi-Precision Add-Carry Instruction Extensions) + AESNI // Advanced Encryption Standard New Instructions + AMD3DNOW // AMD 3DNOW + AMD3DNOWEXT // AMD 3DNowExt + AMXBF16 // Tile computational operations on BFLOAT16 numbers + AMXINT8 // Tile computational operations on 8-bit integers + AMXTILE // Tile architecture + AVX // AVX functions + AVX2 // AVX2 functions + AVX512BF16 // AVX-512 BFLOAT16 Instructions + AVX512BITALG // AVX-512 Bit Algorithms + AVX512BW // AVX-512 Byte and Word Instructions + AVX512CD // AVX-512 Conflict Detection Instructions + AVX512DQ // AVX-512 Doubleword and Quadword Instructions + AVX512ER // AVX-512 Exponential and Reciprocal Instructions + AVX512F // AVX-512 Foundation + AVX512FP16 // AVX-512 FP16 Instructions + AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions + AVX512PF // AVX-512 Prefetch Instructions + AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions + AVX512VBMI2 // AVX-512 Vector Bit Manipulation Instructions, Version 2 + AVX512VL // AVX-512 Vector Length Extensions + AVX512VNNI // AVX-512 Vector Neural Network Instructions + AVX512VP2INTERSECT // AVX-512 Intersect for D/Q + AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword + AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one + AVXVNNI // AVX (VEX encoded) VNNI neural network instructions + BMI1 // Bit Manipulation Instruction Set 1 + BMI2 // Bit Manipulation Instruction Set 2 + CETIBT // Intel CET Indirect Branch Tracking + CETSS // Intel CET Shadow Stack + CLDEMOTE // Cache Line Demote + CLMUL // Carry-less Multiplication + CLZERO // CLZERO instruction supported + CMOV // i686 CMOV + CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB + CMPXCHG8 // CMPXCHG8 instruction + CPBOOST // Core Performance Boost + CX16 // CMPXCHG16B Instruction + ENQCMD // Enqueue Command + ERMS // Enhanced REP MOVSB/STOSB + F16C // Half-precision floating-point conversion + FMA3 // Intel FMA 3. Does not imply AVX. + FMA4 // Bulldozer FMA4 functions + FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9 + FXSROPT // FXSAVE/FXRSTOR optimizations + GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. + HLE // Hardware Lock Elision + HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR + HTT // Hyperthreading (enabled) + HWA // Hardware assert supported. Indicates support for MSRC001_10 + HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors + IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) + IBS // Instruction Based Sampling (AMD) + IBSBRNTRGT // Instruction Based Sampling Feature (AMD) + IBSFETCHSAM // Instruction Based Sampling Feature (AMD) + IBSFFV // Instruction Based Sampling Feature (AMD) + IBSOPCNT // Instruction Based Sampling Feature (AMD) + IBSOPCNTEXT // Instruction Based Sampling Feature (AMD) + IBSOPSAM // Instruction Based Sampling Feature (AMD) + IBSRDWROPCNT // Instruction Based Sampling Feature (AMD) + IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD) + IBS_PREVENTHOST // Disallowing IBS use by the host supported + INT_WBINVD // WBINVD/WBNOINVD are interruptible. + INVLPGB // NVLPGB and TLBSYNC instruction supported + LAHF // LAHF/SAHF in long mode + LAM // If set, CPU supports Linear Address Masking + LBRVIRT // LBR virtualization + LZCNT // LZCNT instruction + MCAOVERFLOW // MCA overflow recovery support. + MCOMMIT // MCOMMIT instruction supported + MMX // standard MMX + MMXEXT // SSE integer functions or AMD MMX ext + MOVBE // MOVBE instruction (big-endian) + MOVDIR64B // Move 64 Bytes as Direct Store + MOVDIRI // Move Doubleword as Direct Store + MOVSB_ZL // Fast Zero-Length MOVSB + MPX // Intel MPX (Memory Protection Extensions) + MSRIRC // Instruction Retired Counter MSR available + MSR_PAGEFLUSH // Page Flush MSR available + NRIPS // Indicates support for NRIP save on VMEXIT + NX // NX (No-Execute) bit + OSXSAVE // XSAVE enabled by OS + PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption + POPCNT // POPCNT instruction + RDPRU // RDPRU instruction supported + RDRAND // RDRAND instruction is available + RDSEED // RDSEED instruction is available + RDTSCP // RDTSCP Instruction + RTM // Restricted Transactional Memory + RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort. + SERIALIZE // Serialize Instruction Execution + SEV // AMD Secure Encrypted Virtualization supported + SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host + SEV_ALTERNATIVE // AMD SEV Alternate Injection supported + SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests + SEV_ES // AMD SEV Encrypted State supported + SEV_RESTRICTED // AMD SEV Restricted Injection supported + SEV_SNP // AMD SEV Secure Nested Paging supported + SGX // Software Guard Extensions + SGXLC // Software Guard Extensions Launch Control + SHA // Intel SHA Extensions + SME // AMD Secure Memory Encryption supported + SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced + SSE // SSE functions + SSE2 // P4 SSE functions + SSE3 // Prescott SSE3 functions + SSE4 // Penryn SSE4.1 functions + SSE42 // Nehalem SSE4.2 functions + SSE4A // AMD Barcelona microarchitecture SSE4a instructions + SSSE3 // Conroe SSSE3 functions + STIBP // Single Thread Indirect Branch Predictors + STOSB_SHORT // Fast short STOSB + SUCCOR // Software uncorrectable error containment and recovery capability. + SVM // AMD Secure Virtual Machine + SVMDA // Indicates support for the SVM decode assists. + SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control + SVML // AMD SVM lock. Indicates support for SVM-Lock. + SVMNP // AMD SVM nested paging + SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter + SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold + SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions. + SYSEE // SYSENTER and SYSEXIT instructions + TBM // AMD Trailing Bit Manipulation + TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. + TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. + TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 + TSXLDTRK // Intel TSX Suspend Load Address Tracking + VAES // Vector AES. AVX(512) versions requires additional checks. + VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits. + VMPL // AMD VM Permission Levels supported + VMSA_REGPROT // AMD VMSA Register Protection supported + VMX // Virtual Machine Extensions + VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. + VTE // AMD Virtual Transparent Encryption supported + WAITPKG // TPAUSE, UMONITOR, UMWAIT + WBNOINVD // Write Back and Do Not Invalidate Cache + X87 // FPU + XGETBV1 // Supports XGETBV with ECX = 1 + XOP // Bulldozer XOP functions + XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV + XSAVEC // Supports XSAVEC and the compacted form of XRSTOR. + XSAVEOPT // XSAVEOPT available + XSAVES // Supports XSAVES/XRSTORS and IA32_XSS + + // ARM features: + AESARM // AES instructions + ARMCPUID // Some CPU ID registers readable at user-level + ASIMD // Advanced SIMD + ASIMDDP // SIMD Dot Product + ASIMDHP // Advanced SIMD half-precision floating point + ASIMDRDM // Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) + ATOMICS // Large System Extensions (LSE) + CRC32 // CRC32/CRC32C instructions + DCPOP // Data cache clean to Point of Persistence (DC CVAP) + EVTSTRM // Generic timer + FCMA // Floatin point complex number addition and multiplication + FP // Single-precision and double-precision floating point + FPHP // Half-precision floating point + GPA // Generic Pointer Authentication + JSCVT // Javascript-style double->int convert (FJCVTZS) + LRCPC // Weaker release consistency (LDAPR, etc) + PMULL // Polynomial Multiply instructions (PMULL/PMULL2) + SHA1 // SHA-1 instructions (SHA1C, etc) + SHA2 // SHA-2 instructions (SHA256H, etc) + SHA3 // SHA-3 instructions (EOR3, RAXI, XAR, BCAX) + SHA512 // SHA512 instructions + SM3 // SM3 instructions + SM4 // SM4 instructions + SVE // Scalable Vector Extension + // Keep it last. It automatically defines the size of []flagSet + lastID + + firstID FeatureID = UNKNOWN + 1 +) + +// CPUInfo contains information about the detected system CPU. +type CPUInfo struct { + BrandName string // Brand name reported by the CPU + VendorID Vendor // Comparable CPU vendor ID + VendorString string // Raw vendor string. + featureSet flagSet // Features of the CPU + PhysicalCores int // Number of physical processor cores in your CPU. Will be 0 if undetectable. + ThreadsPerCore int // Number of threads per physical core. Will be 1 if undetectable. + LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable. + Family int // CPU family number + Model int // CPU model number + Stepping int // CPU stepping info + CacheLine int // Cache line size in bytes. Will be 0 if undetectable. + Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed. + BoostFreq int64 // Max clock speed, if known, 0 otherwise + Cache struct { + L1I int // L1 Instruction Cache (per core or shared). Will be -1 if undetected + L1D int // L1 Data Cache (per core or shared). Will be -1 if undetected + L2 int // L2 Cache (per core or shared). Will be -1 if undetected + L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected + } + SGX SGXSupport + maxFunc uint32 + maxExFunc uint32 +} + +var cpuid func(op uint32) (eax, ebx, ecx, edx uint32) +var cpuidex func(op, op2 uint32) (eax, ebx, ecx, edx uint32) +var xgetbv func(index uint32) (eax, edx uint32) +var rdtscpAsm func() (eax, ebx, ecx, edx uint32) +var darwinHasAVX512 = func() bool { return false } + +// CPU contains information about the CPU as detected on startup, +// or when Detect last was called. +// +// Use this as the primary entry point to you data. +var CPU CPUInfo + +func init() { + initCPU() + Detect() +} + +// Detect will re-detect current CPU info. +// This will replace the content of the exported CPU variable. +// +// Unless you expect the CPU to change while you are running your program +// you should not need to call this function. +// If you call this, you must ensure that no other goroutine is accessing the +// exported CPU variable. +func Detect() { + // Set defaults + CPU.ThreadsPerCore = 1 + CPU.Cache.L1I = -1 + CPU.Cache.L1D = -1 + CPU.Cache.L2 = -1 + CPU.Cache.L3 = -1 + safe := true + if detectArmFlag != nil { + safe = !*detectArmFlag + } + addInfo(&CPU, safe) + if displayFeats != nil && *displayFeats { + fmt.Println("cpu features:", strings.Join(CPU.FeatureSet(), ",")) + // Exit with non-zero so tests will print value. + os.Exit(1) + } + if disableFlag != nil { + s := strings.Split(*disableFlag, ",") + for _, feat := range s { + feat := ParseFeature(strings.TrimSpace(feat)) + if feat != UNKNOWN { + CPU.featureSet.unset(feat) + } + } + } +} + +// DetectARM will detect ARM64 features. +// This is NOT done automatically since it can potentially crash +// if the OS does not handle the command. +// If in the future this can be done safely this function may not +// do anything. +func DetectARM() { + addInfo(&CPU, false) +} + +var detectArmFlag *bool +var displayFeats *bool +var disableFlag *string + +// Flags will enable flags. +// This must be called *before* flag.Parse AND +// Detect must be called after the flags have been parsed. +// Note that this means that any detection used in init() functions +// will not contain these flags. +func Flags() { + disableFlag = flag.String("cpu.disable", "", "disable cpu features; comma separated list") + displayFeats = flag.Bool("cpu.features", false, "lists cpu features and exits") + detectArmFlag = flag.Bool("cpu.arm", false, "allow ARM features to be detected; can potentially crash") +} + +// Supports returns whether the CPU supports all of the requested features. +func (c CPUInfo) Supports(ids ...FeatureID) bool { + for _, id := range ids { + if !c.featureSet.inSet(id) { + return false + } + } + return true +} + +// Has allows for checking a single feature. +// Should be inlined by the compiler. +func (c CPUInfo) Has(id FeatureID) bool { + return c.featureSet.inSet(id) +} + +// AnyOf returns whether the CPU supports one or more of the requested features. +func (c CPUInfo) AnyOf(ids ...FeatureID) bool { + for _, id := range ids { + if c.featureSet.inSet(id) { + return true + } + } + return false +} + +// https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels +var level1Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2) +var level2Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3) +var level3Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE) +var level4Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE, AVX512F, AVX512BW, AVX512CD, AVX512DQ, AVX512VL) + +// X64Level returns the microarchitecture level detected on the CPU. +// If features are lacking or non x64 mode, 0 is returned. +// See https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels +func (c CPUInfo) X64Level() int { + if c.featureSet.hasSet(level4Features) { + return 4 + } + if c.featureSet.hasSet(level3Features) { + return 3 + } + if c.featureSet.hasSet(level2Features) { + return 2 + } + if c.featureSet.hasSet(level1Features) { + return 1 + } + return 0 +} + +// Disable will disable one or several features. +func (c *CPUInfo) Disable(ids ...FeatureID) bool { + for _, id := range ids { + c.featureSet.unset(id) + } + return true +} + +// Enable will disable one or several features even if they were undetected. +// This is of course not recommended for obvious reasons. +func (c *CPUInfo) Enable(ids ...FeatureID) bool { + for _, id := range ids { + c.featureSet.set(id) + } + return true +} + +// IsVendor returns true if vendor is recognized as Intel +func (c CPUInfo) IsVendor(v Vendor) bool { + return c.VendorID == v +} + +// FeatureSet returns all available features as strings. +func (c CPUInfo) FeatureSet() []string { + s := make([]string, 0, c.featureSet.nEnabled()) + s = append(s, c.featureSet.Strings()...) + return s +} + +// RTCounter returns the 64-bit time-stamp counter +// Uses the RDTSCP instruction. The value 0 is returned +// if the CPU does not support the instruction. +func (c CPUInfo) RTCounter() uint64 { + if !c.Supports(RDTSCP) { + return 0 + } + a, _, _, d := rdtscpAsm() + return uint64(a) | (uint64(d) << 32) +} + +// Ia32TscAux returns the IA32_TSC_AUX part of the RDTSCP. +// This variable is OS dependent, but on Linux contains information +// about the current cpu/core the code is running on. +// If the RDTSCP instruction isn't supported on the CPU, the value 0 is returned. +func (c CPUInfo) Ia32TscAux() uint32 { + if !c.Supports(RDTSCP) { + return 0 + } + _, _, ecx, _ := rdtscpAsm() + return ecx +} + +// LogicalCPU will return the Logical CPU the code is currently executing on. +// This is likely to change when the OS re-schedules the running thread +// to another CPU. +// If the current core cannot be detected, -1 will be returned. +func (c CPUInfo) LogicalCPU() int { + if c.maxFunc < 1 { + return -1 + } + _, ebx, _, _ := cpuid(1) + return int(ebx >> 24) +} + +// frequencies tries to compute the clock speed of the CPU. If leaf 15 is +// supported, use it, otherwise parse the brand string. Yes, really. +func (c *CPUInfo) frequencies() { + c.Hz, c.BoostFreq = 0, 0 + mfi := maxFunctionID() + if mfi >= 0x15 { + eax, ebx, ecx, _ := cpuid(0x15) + if eax != 0 && ebx != 0 && ecx != 0 { + c.Hz = (int64(ecx) * int64(ebx)) / int64(eax) + } + } + if mfi >= 0x16 { + a, b, _, _ := cpuid(0x16) + // Base... + if a&0xffff > 0 { + c.Hz = int64(a&0xffff) * 1_000_000 + } + // Boost... + if b&0xffff > 0 { + c.BoostFreq = int64(b&0xffff) * 1_000_000 + } + } + if c.Hz > 0 { + return + } + + // computeHz determines the official rated speed of a CPU from its brand + // string. This insanity is *actually the official documented way to do + // this according to Intel*, prior to leaf 0x15 existing. The official + // documentation only shows this working for exactly `x.xx` or `xxxx` + // cases, e.g., `2.50GHz` or `1300MHz`; this parser will accept other + // sizes. + model := c.BrandName + hz := strings.LastIndex(model, "Hz") + if hz < 3 { + return + } + var multiplier int64 + switch model[hz-1] { + case 'M': + multiplier = 1000 * 1000 + case 'G': + multiplier = 1000 * 1000 * 1000 + case 'T': + multiplier = 1000 * 1000 * 1000 * 1000 + } + if multiplier == 0 { + return + } + freq := int64(0) + divisor := int64(0) + decimalShift := int64(1) + var i int + for i = hz - 2; i >= 0 && model[i] != ' '; i-- { + if model[i] >= '0' && model[i] <= '9' { + freq += int64(model[i]-'0') * decimalShift + decimalShift *= 10 + } else if model[i] == '.' { + if divisor != 0 { + return + } + divisor = decimalShift + } else { + return + } + } + // we didn't find a space + if i < 0 { + return + } + if divisor != 0 { + c.Hz = (freq * multiplier) / divisor + return + } + c.Hz = freq * multiplier +} + +// VM Will return true if the cpu id indicates we are in +// a virtual machine. +func (c CPUInfo) VM() bool { + return CPU.featureSet.inSet(HYPERVISOR) +} + +// flags contains detected cpu features and characteristics +type flags uint64 + +// log2(bits_in_uint64) +const flagBitsLog2 = 6 +const flagBits = 1 << flagBitsLog2 +const flagMask = flagBits - 1 + +// flagSet contains detected cpu features and characteristics in an array of flags +type flagSet [(lastID + flagMask) / flagBits]flags + +func (s flagSet) inSet(feat FeatureID) bool { + return s[feat>>flagBitsLog2]&(1<<(feat&flagMask)) != 0 +} + +func (s *flagSet) set(feat FeatureID) { + s[feat>>flagBitsLog2] |= 1 << (feat & flagMask) +} + +// setIf will set a feature if boolean is true. +func (s *flagSet) setIf(cond bool, features ...FeatureID) { + if cond { + for _, offset := range features { + s[offset>>flagBitsLog2] |= 1 << (offset & flagMask) + } + } +} + +func (s *flagSet) unset(offset FeatureID) { + bit := flags(1 << (offset & flagMask)) + s[offset>>flagBitsLog2] = s[offset>>flagBitsLog2] & ^bit +} + +// or with another flagset. +func (s *flagSet) or(other flagSet) { + for i, v := range other[:] { + s[i] |= v + } +} + +// hasSet returns whether all features are present. +func (s flagSet) hasSet(other flagSet) bool { + for i, v := range other[:] { + if s[i]&v != v { + return false + } + } + return true +} + +// nEnabled will return the number of enabled flags. +func (s flagSet) nEnabled() (n int) { + for _, v := range s[:] { + n += bits.OnesCount64(uint64(v)) + } + return n +} + +func flagSetWith(feat ...FeatureID) flagSet { + var res flagSet + for _, f := range feat { + res.set(f) + } + return res +} + +// ParseFeature will parse the string and return the ID of the matching feature. +// Will return UNKNOWN if not found. +func ParseFeature(s string) FeatureID { + s = strings.ToUpper(s) + for i := firstID; i < lastID; i++ { + if i.String() == s { + return i + } + } + return UNKNOWN +} + +// Strings returns an array of the detected features for FlagsSet. +func (s flagSet) Strings() []string { + if len(s) == 0 { + return []string{""} + } + r := make([]string, 0) + for i := firstID; i < lastID; i++ { + if s.inSet(i) { + r = append(r, i.String()) + } + } + return r +} + +func maxExtendedFunction() uint32 { + eax, _, _, _ := cpuid(0x80000000) + return eax +} + +func maxFunctionID() uint32 { + a, _, _, _ := cpuid(0) + return a +} + +func brandName() string { + if maxExtendedFunction() >= 0x80000004 { + v := make([]uint32, 0, 48) + for i := uint32(0); i < 3; i++ { + a, b, c, d := cpuid(0x80000002 + i) + v = append(v, a, b, c, d) + } + return strings.Trim(string(valAsString(v...)), " ") + } + return "unknown" +} + +func threadsPerCore() int { + mfi := maxFunctionID() + vend, _ := vendorID() + + if mfi < 0x4 || (vend != Intel && vend != AMD) { + return 1 + } + + if mfi < 0xb { + if vend != Intel { + return 1 + } + _, b, _, d := cpuid(1) + if (d & (1 << 28)) != 0 { + // v will contain logical core count + v := (b >> 16) & 255 + if v > 1 { + a4, _, _, _ := cpuid(4) + // physical cores + v2 := (a4 >> 26) + 1 + if v2 > 0 { + return int(v) / int(v2) + } + } + } + return 1 + } + _, b, _, _ := cpuidex(0xb, 0) + if b&0xffff == 0 { + if vend == AMD { + // Workaround for AMD returning 0, assume 2 if >= Zen 2 + // It will be more correct than not. + fam, _, _ := familyModel() + _, _, _, d := cpuid(1) + if (d&(1<<28)) != 0 && fam >= 23 { + return 2 + } + } + return 1 + } + return int(b & 0xffff) +} + +func logicalCores() int { + mfi := maxFunctionID() + v, _ := vendorID() + switch v { + case Intel: + // Use this on old Intel processors + if mfi < 0xb { + if mfi < 1 { + return 0 + } + // CPUID.1:EBX[23:16] represents the maximum number of addressable IDs (initial APIC ID) + // that can be assigned to logical processors in a physical package. + // The value may not be the same as the number of logical processors that are present in the hardware of a physical package. + _, ebx, _, _ := cpuid(1) + logical := (ebx >> 16) & 0xff + return int(logical) + } + _, b, _, _ := cpuidex(0xb, 1) + return int(b & 0xffff) + case AMD, Hygon: + _, b, _, _ := cpuid(1) + return int((b >> 16) & 0xff) + default: + return 0 + } +} + +func familyModel() (family, model, stepping int) { + if maxFunctionID() < 0x1 { + return 0, 0, 0 + } + eax, _, _, _ := cpuid(1) + // If BaseFamily[3:0] is less than Fh then ExtendedFamily[7:0] is reserved and Family is equal to BaseFamily[3:0]. + family = int((eax >> 8) & 0xf) + extFam := family == 0x6 // Intel is 0x6, needs extended model. + if family == 0xf { + // Add ExtFamily + family += int((eax >> 20) & 0xff) + extFam = true + } + // If BaseFamily[3:0] is less than 0Fh then ExtendedModel[3:0] is reserved and Model is equal to BaseModel[3:0]. + model = int((eax >> 4) & 0xf) + if extFam { + // Add ExtModel + model += int((eax >> 12) & 0xf0) + } + stepping = int(eax & 0xf) + return family, model, stepping +} + +func physicalCores() int { + v, _ := vendorID() + switch v { + case Intel: + return logicalCores() / threadsPerCore() + case AMD, Hygon: + lc := logicalCores() + tpc := threadsPerCore() + if lc > 0 && tpc > 0 { + return lc / tpc + } + + // The following is inaccurate on AMD EPYC 7742 64-Core Processor + if maxExtendedFunction() >= 0x80000008 { + _, _, c, _ := cpuid(0x80000008) + if c&0xff > 0 { + return int(c&0xff) + 1 + } + } + } + return 0 +} + +// Except from http://en.wikipedia.org/wiki/CPUID#EAX.3D0:_Get_vendor_ID +var vendorMapping = map[string]Vendor{ + "AMDisbetter!": AMD, + "AuthenticAMD": AMD, + "CentaurHauls": VIA, + "GenuineIntel": Intel, + "TransmetaCPU": Transmeta, + "GenuineTMx86": Transmeta, + "Geode by NSC": NSC, + "VIA VIA VIA ": VIA, + "KVMKVMKVMKVM": KVM, + "Microsoft Hv": MSVM, + "VMwareVMware": VMware, + "XenVMMXenVMM": XenHVM, + "bhyve bhyve ": Bhyve, + "HygonGenuine": Hygon, + "Vortex86 SoC": SiS, + "SiS SiS SiS ": SiS, + "RiseRiseRise": SiS, + "Genuine RDC": RDC, +} + +func vendorID() (Vendor, string) { + _, b, c, d := cpuid(0) + v := string(valAsString(b, d, c)) + vend, ok := vendorMapping[v] + if !ok { + return VendorUnknown, v + } + return vend, v +} + +func cacheLine() int { + if maxFunctionID() < 0x1 { + return 0 + } + + _, ebx, _, _ := cpuid(1) + cache := (ebx & 0xff00) >> 5 // cflush size + if cache == 0 && maxExtendedFunction() >= 0x80000006 { + _, _, ecx, _ := cpuid(0x80000006) + cache = ecx & 0xff // cacheline size + } + // TODO: Read from Cache and TLB Information + return int(cache) +} + +func (c *CPUInfo) cacheSize() { + c.Cache.L1D = -1 + c.Cache.L1I = -1 + c.Cache.L2 = -1 + c.Cache.L3 = -1 + vendor, _ := vendorID() + switch vendor { + case Intel: + if maxFunctionID() < 4 { + return + } + c.Cache.L1I, c.Cache.L1D, c.Cache.L2, c.Cache.L3 = 0, 0, 0, 0 + for i := uint32(0); ; i++ { + eax, ebx, ecx, _ := cpuidex(4, i) + cacheType := eax & 15 + if cacheType == 0 { + break + } + cacheLevel := (eax >> 5) & 7 + coherency := int(ebx&0xfff) + 1 + partitions := int((ebx>>12)&0x3ff) + 1 + associativity := int((ebx>>22)&0x3ff) + 1 + sets := int(ecx) + 1 + size := associativity * partitions * coherency * sets + switch cacheLevel { + case 1: + if cacheType == 1 { + // 1 = Data Cache + c.Cache.L1D = size + } else if cacheType == 2 { + // 2 = Instruction Cache + c.Cache.L1I = size + } else { + if c.Cache.L1D < 0 { + c.Cache.L1I = size + } + if c.Cache.L1I < 0 { + c.Cache.L1I = size + } + } + case 2: + c.Cache.L2 = size + case 3: + c.Cache.L3 = size + } + } + case AMD, Hygon: + // Untested. + if maxExtendedFunction() < 0x80000005 { + return + } + _, _, ecx, edx := cpuid(0x80000005) + c.Cache.L1D = int(((ecx >> 24) & 0xFF) * 1024) + c.Cache.L1I = int(((edx >> 24) & 0xFF) * 1024) + + if maxExtendedFunction() < 0x80000006 { + return + } + _, _, ecx, _ = cpuid(0x80000006) + c.Cache.L2 = int(((ecx >> 16) & 0xFFFF) * 1024) + + // CPUID Fn8000_001D_EAX_x[N:0] Cache Properties + if maxExtendedFunction() < 0x8000001D || !c.Has(TOPEXT) { + return + } + + // Xen Hypervisor is buggy and returns the same entry no matter ECX value. + // Hack: When we encounter the same entry 100 times we break. + nSame := 0 + var last uint32 + for i := uint32(0); i < math.MaxUint32; i++ { + eax, ebx, ecx, _ := cpuidex(0x8000001D, i) + + level := (eax >> 5) & 7 + cacheNumSets := ecx + 1 + cacheLineSize := 1 + (ebx & 2047) + cachePhysPartitions := 1 + ((ebx >> 12) & 511) + cacheNumWays := 1 + ((ebx >> 22) & 511) + + typ := eax & 15 + size := int(cacheNumSets * cacheLineSize * cachePhysPartitions * cacheNumWays) + if typ == 0 { + return + } + + // Check for the same value repeated. + comb := eax ^ ebx ^ ecx + if comb == last { + nSame++ + if nSame == 100 { + return + } + } + last = comb + + switch level { + case 1: + switch typ { + case 1: + // Data cache + c.Cache.L1D = size + case 2: + // Inst cache + c.Cache.L1I = size + default: + if c.Cache.L1D < 0 { + c.Cache.L1I = size + } + if c.Cache.L1I < 0 { + c.Cache.L1I = size + } + } + case 2: + c.Cache.L2 = size + case 3: + c.Cache.L3 = size + } + } + } +} + +type SGXEPCSection struct { + BaseAddress uint64 + EPCSize uint64 +} + +type SGXSupport struct { + Available bool + LaunchControl bool + SGX1Supported bool + SGX2Supported bool + MaxEnclaveSizeNot64 int64 + MaxEnclaveSize64 int64 + EPCSections []SGXEPCSection +} + +func hasSGX(available, lc bool) (rval SGXSupport) { + rval.Available = available + + if !available { + return + } + + rval.LaunchControl = lc + + a, _, _, d := cpuidex(0x12, 0) + rval.SGX1Supported = a&0x01 != 0 + rval.SGX2Supported = a&0x02 != 0 + rval.MaxEnclaveSizeNot64 = 1 << (d & 0xFF) // pow 2 + rval.MaxEnclaveSize64 = 1 << ((d >> 8) & 0xFF) // pow 2 + rval.EPCSections = make([]SGXEPCSection, 0) + + for subleaf := uint32(2); subleaf < 2+8; subleaf++ { + eax, ebx, ecx, edx := cpuidex(0x12, subleaf) + leafType := eax & 0xf + + if leafType == 0 { + // Invalid subleaf, stop iterating + break + } else if leafType == 1 { + // EPC Section subleaf + baseAddress := uint64(eax&0xfffff000) + (uint64(ebx&0x000fffff) << 32) + size := uint64(ecx&0xfffff000) + (uint64(edx&0x000fffff) << 32) + + section := SGXEPCSection{BaseAddress: baseAddress, EPCSize: size} + rval.EPCSections = append(rval.EPCSections, section) + } + } + + return +} + +func support() flagSet { + var fs flagSet + mfi := maxFunctionID() + vend, _ := vendorID() + if mfi < 0x1 { + return fs + } + family, model, _ := familyModel() + + _, _, c, d := cpuid(1) + fs.setIf((d&(1<<0)) != 0, X87) + fs.setIf((d&(1<<8)) != 0, CMPXCHG8) + fs.setIf((d&(1<<11)) != 0, SYSEE) + fs.setIf((d&(1<<15)) != 0, CMOV) + fs.setIf((d&(1<<23)) != 0, MMX) + fs.setIf((d&(1<<24)) != 0, FXSR) + fs.setIf((d&(1<<25)) != 0, FXSROPT) + fs.setIf((d&(1<<25)) != 0, SSE) + fs.setIf((d&(1<<26)) != 0, SSE2) + fs.setIf((c&1) != 0, SSE3) + fs.setIf((c&(1<<5)) != 0, VMX) + fs.setIf((c&(1<<9)) != 0, SSSE3) + fs.setIf((c&(1<<19)) != 0, SSE4) + fs.setIf((c&(1<<20)) != 0, SSE42) + fs.setIf((c&(1<<25)) != 0, AESNI) + fs.setIf((c&(1<<1)) != 0, CLMUL) + fs.setIf(c&(1<<22) != 0, MOVBE) + fs.setIf(c&(1<<23) != 0, POPCNT) + fs.setIf(c&(1<<30) != 0, RDRAND) + + // This bit has been reserved by Intel & AMD for use by hypervisors, + // and indicates the presence of a hypervisor. + fs.setIf(c&(1<<31) != 0, HYPERVISOR) + fs.setIf(c&(1<<29) != 0, F16C) + fs.setIf(c&(1<<13) != 0, CX16) + + if vend == Intel && (d&(1<<28)) != 0 && mfi >= 4 { + fs.setIf(threadsPerCore() > 1, HTT) + } + if vend == AMD && (d&(1<<28)) != 0 && mfi >= 4 { + fs.setIf(threadsPerCore() > 1, HTT) + } + fs.setIf(c&1<<26 != 0, XSAVE) + fs.setIf(c&1<<27 != 0, OSXSAVE) + // Check XGETBV/XSAVE (26), OXSAVE (27) and AVX (28) bits + const avxCheck = 1<<26 | 1<<27 | 1<<28 + if c&avxCheck == avxCheck { + // Check for OS support + eax, _ := xgetbv(0) + if (eax & 0x6) == 0x6 { + fs.set(AVX) + switch vend { + case Intel: + // Older than Haswell. + fs.setIf(family == 6 && model < 60, AVXSLOW) + case AMD: + // Older than Zen 2 + fs.setIf(family < 23 || (family == 23 && model < 49), AVXSLOW) + } + } + } + // FMA3 can be used with SSE registers, so no OS support is strictly needed. + // fma3 and OSXSAVE needed. + const fma3Check = 1<<12 | 1<<27 + fs.setIf(c&fma3Check == fma3Check, FMA3) + + // Check AVX2, AVX2 requires OS support, but BMI1/2 don't. + if mfi >= 7 { + _, ebx, ecx, edx := cpuidex(7, 0) + if fs.inSet(AVX) && (ebx&0x00000020) != 0 { + fs.set(AVX2) + } + // CPUID.(EAX=7, ECX=0).EBX + if (ebx & 0x00000008) != 0 { + fs.set(BMI1) + fs.setIf((ebx&0x00000100) != 0, BMI2) + } + fs.setIf(ebx&(1<<2) != 0, SGX) + fs.setIf(ebx&(1<<4) != 0, HLE) + fs.setIf(ebx&(1<<9) != 0, ERMS) + fs.setIf(ebx&(1<<11) != 0, RTM) + fs.setIf(ebx&(1<<14) != 0, MPX) + fs.setIf(ebx&(1<<18) != 0, RDSEED) + fs.setIf(ebx&(1<<19) != 0, ADX) + fs.setIf(ebx&(1<<29) != 0, SHA) + + // CPUID.(EAX=7, ECX=0).ECX + fs.setIf(ecx&(1<<5) != 0, WAITPKG) + fs.setIf(ecx&(1<<7) != 0, CETSS) + fs.setIf(ecx&(1<<8) != 0, GFNI) + fs.setIf(ecx&(1<<9) != 0, VAES) + fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ) + fs.setIf(ecx&(1<<13) != 0, TME) + fs.setIf(ecx&(1<<25) != 0, CLDEMOTE) + fs.setIf(ecx&(1<<27) != 0, MOVDIRI) + fs.setIf(ecx&(1<<28) != 0, MOVDIR64B) + fs.setIf(ecx&(1<<29) != 0, ENQCMD) + fs.setIf(ecx&(1<<30) != 0, SGXLC) + + // CPUID.(EAX=7, ECX=0).EDX + fs.setIf(edx&(1<<11) != 0, RTM_ALWAYS_ABORT) + fs.setIf(edx&(1<<14) != 0, SERIALIZE) + fs.setIf(edx&(1<<16) != 0, TSXLDTRK) + fs.setIf(edx&(1<<18) != 0, PCONFIG) + fs.setIf(edx&(1<<20) != 0, CETIBT) + fs.setIf(edx&(1<<26) != 0, IBPB) + fs.setIf(edx&(1<<27) != 0, STIBP) + + // CPUID.(EAX=7, ECX=1) + eax1, _, _, _ := cpuidex(7, 1) + fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI) + fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL) + fs.setIf(eax1&(1<<11) != 0, STOSB_SHORT) + fs.setIf(eax1&(1<<12) != 0, CMPSB_SCADBS_SHORT) + fs.setIf(eax1&(1<<22) != 0, HRESET) + fs.setIf(eax1&(1<<26) != 0, LAM) + + // Only detect AVX-512 features if XGETBV is supported + if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) { + // Check for OS support + eax, _ := xgetbv(0) + + // Verify that XCR0[7:5] = ‘111b’ (OPMASK state, upper 256-bit of ZMM0-ZMM15 and + // ZMM16-ZMM31 state are enabled by OS) + /// and that XCR0[2:1] = ‘11b’ (XMM state and YMM state are enabled by OS). + hasAVX512 := (eax>>5)&7 == 7 && (eax>>1)&3 == 3 + if runtime.GOOS == "darwin" { + hasAVX512 = fs.inSet(AVX) && darwinHasAVX512() + } + if hasAVX512 { + fs.setIf(ebx&(1<<16) != 0, AVX512F) + fs.setIf(ebx&(1<<17) != 0, AVX512DQ) + fs.setIf(ebx&(1<<21) != 0, AVX512IFMA) + fs.setIf(ebx&(1<<26) != 0, AVX512PF) + fs.setIf(ebx&(1<<27) != 0, AVX512ER) + fs.setIf(ebx&(1<<28) != 0, AVX512CD) + fs.setIf(ebx&(1<<30) != 0, AVX512BW) + fs.setIf(ebx&(1<<31) != 0, AVX512VL) + // ecx + fs.setIf(ecx&(1<<1) != 0, AVX512VBMI) + fs.setIf(ecx&(1<<6) != 0, AVX512VBMI2) + fs.setIf(ecx&(1<<11) != 0, AVX512VNNI) + fs.setIf(ecx&(1<<12) != 0, AVX512BITALG) + fs.setIf(ecx&(1<<14) != 0, AVX512VPOPCNTDQ) + // edx + fs.setIf(edx&(1<<8) != 0, AVX512VP2INTERSECT) + fs.setIf(edx&(1<<22) != 0, AMXBF16) + fs.setIf(edx&(1<<23) != 0, AVX512FP16) + fs.setIf(edx&(1<<24) != 0, AMXTILE) + fs.setIf(edx&(1<<25) != 0, AMXINT8) + // eax1 = CPUID.(EAX=7, ECX=1).EAX + fs.setIf(eax1&(1<<5) != 0, AVX512BF16) + } + } + } + // Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1) + // EAX + // Bit 00: XSAVEOPT is available. + // Bit 01: Supports XSAVEC and the compacted form of XRSTOR if set. + // Bit 02: Supports XGETBV with ECX = 1 if set. + // Bit 03: Supports XSAVES/XRSTORS and IA32_XSS if set. + // Bits 31 - 04: Reserved. + // EBX + // Bits 31 - 00: The size in bytes of the XSAVE area containing all states enabled by XCRO | IA32_XSS. + // ECX + // Bits 31 - 00: Reports the supported bits of the lower 32 bits of the IA32_XSS MSR. IA32_XSS[n] can be set to 1 only if ECX[n] is 1. + // EDX? + // Bits 07 - 00: Used for XCR0. Bit 08: PT state. Bit 09: Used for XCR0. Bits 12 - 10: Reserved. Bit 13: HWP state. Bits 31 - 14: Reserved. + if mfi >= 0xd { + if fs.inSet(XSAVE) { + eax, _, _, _ := cpuidex(0xd, 1) + fs.setIf(eax&(1<<0) != 0, XSAVEOPT) + fs.setIf(eax&(1<<1) != 0, XSAVEC) + fs.setIf(eax&(1<<2) != 0, XGETBV1) + fs.setIf(eax&(1<<3) != 0, XSAVES) + } + } + if maxExtendedFunction() >= 0x80000001 { + _, _, c, d := cpuid(0x80000001) + if (c & (1 << 5)) != 0 { + fs.set(LZCNT) + fs.set(POPCNT) + } + // ECX + fs.setIf((c&(1<<0)) != 0, LAHF) + fs.setIf((c&(1<<2)) != 0, SVM) + fs.setIf((c&(1<<6)) != 0, SSE4A) + fs.setIf((c&(1<<10)) != 0, IBS) + fs.setIf((c&(1<<22)) != 0, TOPEXT) + + // EDX + fs.setIf(d&(1<<11) != 0, SYSCALL) + fs.setIf(d&(1<<20) != 0, NX) + fs.setIf(d&(1<<22) != 0, MMXEXT) + fs.setIf(d&(1<<23) != 0, MMX) + fs.setIf(d&(1<<24) != 0, FXSR) + fs.setIf(d&(1<<25) != 0, FXSROPT) + fs.setIf(d&(1<<27) != 0, RDTSCP) + fs.setIf(d&(1<<30) != 0, AMD3DNOWEXT) + fs.setIf(d&(1<<31) != 0, AMD3DNOW) + + /* XOP and FMA4 use the AVX instruction coding scheme, so they can't be + * used unless the OS has AVX support. */ + if fs.inSet(AVX) { + fs.setIf((c&(1<<11)) != 0, XOP) + fs.setIf((c&(1<<16)) != 0, FMA4) + } + + } + if maxExtendedFunction() >= 0x80000007 { + _, b, _, d := cpuid(0x80000007) + fs.setIf((b&(1<<0)) != 0, MCAOVERFLOW) + fs.setIf((b&(1<<1)) != 0, SUCCOR) + fs.setIf((b&(1<<2)) != 0, HWA) + fs.setIf((d&(1<<9)) != 0, CPBOOST) + } + + if maxExtendedFunction() >= 0x80000008 { + _, b, _, _ := cpuid(0x80000008) + fs.setIf((b&(1<<9)) != 0, WBNOINVD) + fs.setIf((b&(1<<8)) != 0, MCOMMIT) + fs.setIf((b&(1<<13)) != 0, INT_WBINVD) + fs.setIf((b&(1<<4)) != 0, RDPRU) + fs.setIf((b&(1<<3)) != 0, INVLPGB) + fs.setIf((b&(1<<1)) != 0, MSRIRC) + fs.setIf((b&(1<<0)) != 0, CLZERO) + } + + if fs.inSet(SVM) && maxExtendedFunction() >= 0x8000000A { + _, _, _, edx := cpuid(0x8000000A) + fs.setIf((edx>>0)&1 == 1, SVMNP) + fs.setIf((edx>>1)&1 == 1, LBRVIRT) + fs.setIf((edx>>2)&1 == 1, SVML) + fs.setIf((edx>>3)&1 == 1, NRIPS) + fs.setIf((edx>>4)&1 == 1, TSCRATEMSR) + fs.setIf((edx>>5)&1 == 1, VMCBCLEAN) + fs.setIf((edx>>6)&1 == 1, SVMFBASID) + fs.setIf((edx>>7)&1 == 1, SVMDA) + fs.setIf((edx>>10)&1 == 1, SVMPF) + fs.setIf((edx>>12)&1 == 1, SVMPFT) + } + + if maxExtendedFunction() >= 0x8000001b && fs.inSet(IBS) { + eax, _, _, _ := cpuid(0x8000001b) + fs.setIf((eax>>0)&1 == 1, IBSFFV) + fs.setIf((eax>>1)&1 == 1, IBSFETCHSAM) + fs.setIf((eax>>2)&1 == 1, IBSOPSAM) + fs.setIf((eax>>3)&1 == 1, IBSRDWROPCNT) + fs.setIf((eax>>4)&1 == 1, IBSOPCNT) + fs.setIf((eax>>5)&1 == 1, IBSBRNTRGT) + fs.setIf((eax>>6)&1 == 1, IBSOPCNTEXT) + fs.setIf((eax>>7)&1 == 1, IBSRIPINVALIDCHK) + } + + if maxExtendedFunction() >= 0x8000001f && vend == AMD { + a, _, _, _ := cpuid(0x8000001f) + fs.setIf((a>>0)&1 == 1, SME) + fs.setIf((a>>1)&1 == 1, SEV) + fs.setIf((a>>2)&1 == 1, MSR_PAGEFLUSH) + fs.setIf((a>>3)&1 == 1, SEV_ES) + fs.setIf((a>>4)&1 == 1, SEV_SNP) + fs.setIf((a>>5)&1 == 1, VMPL) + fs.setIf((a>>10)&1 == 1, SME_COHERENT) + fs.setIf((a>>11)&1 == 1, SEV_64BIT) + fs.setIf((a>>12)&1 == 1, SEV_RESTRICTED) + fs.setIf((a>>13)&1 == 1, SEV_ALTERNATIVE) + fs.setIf((a>>14)&1 == 1, SEV_DEBUGSWAP) + fs.setIf((a>>15)&1 == 1, IBS_PREVENTHOST) + fs.setIf((a>>16)&1 == 1, VTE) + fs.setIf((a>>24)&1 == 1, VMSA_REGPROT) + } + + return fs +} + +func valAsString(values ...uint32) []byte { + r := make([]byte, 4*len(values)) + for i, v := range values { + dst := r[i*4:] + dst[0] = byte(v & 0xff) + dst[1] = byte((v >> 8) & 0xff) + dst[2] = byte((v >> 16) & 0xff) + dst[3] = byte((v >> 24) & 0xff) + switch { + case dst[0] == 0: + return r[:i*4] + case dst[1] == 0: + return r[:i*4+1] + case dst[2] == 0: + return r[:i*4+2] + case dst[3] == 0: + return r[:i*4+3] + } + } + return r +} diff --git a/vendor/github.com/klauspost/cpuid/cpuid_386.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_386.s index 089638f51..8587c3a1f 100644 --- a/vendor/github.com/klauspost/cpuid/cpuid_386.s +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid_386.s @@ -40,3 +40,8 @@ TEXT ·asmRdtscpAsm(SB), 7, $0 MOVL CX, ecx+8(FP) MOVL DX, edx+12(FP) RET + +// func asmDarwinHasAVX512() bool +TEXT ·asmDarwinHasAVX512(SB), 7, $0 + MOVL $0, eax+0(FP) + RET diff --git a/vendor/github.com/klauspost/cpuid/cpuid_amd64.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s index 3ba0559e9..bc11f8942 100644 --- a/vendor/github.com/klauspost/cpuid/cpuid_amd64.s +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s @@ -40,3 +40,33 @@ TEXT ·asmRdtscpAsm(SB), 7, $0 MOVL CX, ecx+8(FP) MOVL DX, edx+12(FP) RET + +// From https://go-review.googlesource.com/c/sys/+/285572/ +// func asmDarwinHasAVX512() bool +TEXT ·asmDarwinHasAVX512(SB), 7, $0-1 + MOVB $0, ret+0(FP) // default to false + +#ifdef GOOS_darwin // return if not darwin +#ifdef GOARCH_amd64 // return if not amd64 +// These values from: +// https://github.com/apple/darwin-xnu/blob/xnu-4570.1.46/osfmk/i386/cpu_capabilities.h +#define commpage64_base_address 0x00007fffffe00000 +#define commpage64_cpu_capabilities64 (commpage64_base_address+0x010) +#define commpage64_version (commpage64_base_address+0x01E) +#define hasAVX512F 0x0000004000000000 + MOVQ $commpage64_version, BX + MOVW (BX), AX + CMPW AX, $13 // versions < 13 do not support AVX512 + JL no_avx512 + MOVQ $commpage64_cpu_capabilities64, BX + MOVQ (BX), AX + MOVQ $hasAVX512F, CX + ANDQ CX, AX + JZ no_avx512 + MOVB $1, ret+0(FP) + +no_avx512: +#endif +#endif + RET + diff --git a/vendor/github.com/klauspost/cpuid/cpuid_arm64.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s index 8975ee8db..b31d6aec4 100644 --- a/vendor/github.com/klauspost/cpuid/cpuid_arm64.s +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s @@ -1,6 +1,6 @@ // Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. -//+build arm64,!gccgo +//+build arm64,!gccgo,!noasm,!appengine // See https://www.kernel.org/doc/Documentation/arm64/cpu-feature-registers.txt diff --git a/vendor/github.com/klauspost/cpuid/detect_arm64.go b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go index 923a82618..9a53504a0 100644 --- a/vendor/github.com/klauspost/cpuid/detect_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go @@ -1,9 +1,12 @@ // Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. -//+build arm64,!gccgo,!noasm,!appengine +//go:build arm64 && !gccgo && !noasm && !appengine +// +build arm64,!gccgo,!noasm,!appengine package cpuid +import "runtime" + func getMidr() (midr uint64) func getProcFeatures() (procFeatures uint64) func getInstAttributes() (instAttrReg0, instAttrReg1 uint64) @@ -15,14 +18,19 @@ func initCPU() { rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 } } -func addInfo(c *CPUInfo) { - // ARM64 disabled for now. - if true { +func addInfo(c *CPUInfo, safe bool) { + // Seems to be safe to assume on ARM64 + c.CacheLine = 64 + detectOS(c) + + // ARM64 disabled since it may crash if interrupt is not intercepted by OS. + if safe && !c.Supports(ARMCPUID) && runtime.GOOS != "freebsd" { return } - // midr := getMidr() + midr := getMidr() // MIDR_EL1 - Main ID Register + // https://developer.arm.com/docs/ddi0595/h/aarch64-system-registers/midr_el1 // x--------------------------------------------------x // | Name | bits | visible | // |--------------------------------------------------| @@ -37,11 +45,70 @@ func addInfo(c *CPUInfo) { // | Revision | [3-0] | y | // x--------------------------------------------------x - // fmt.Printf(" implementer: 0x%02x\n", (midr>>24)&0xff) - // fmt.Printf(" variant: 0x%01x\n", (midr>>20)&0xf) - // fmt.Printf("architecture: 0x%01x\n", (midr>>16)&0xf) - // fmt.Printf(" part num: 0x%03x\n", (midr>>4)&0xfff) - // fmt.Printf(" revision: 0x%01x\n", (midr>>0)&0xf) + switch (midr >> 24) & 0xff { + case 0xC0: + c.VendorString = "Ampere Computing" + c.VendorID = Ampere + case 0x41: + c.VendorString = "Arm Limited" + c.VendorID = ARM + case 0x42: + c.VendorString = "Broadcom Corporation" + c.VendorID = Broadcom + case 0x43: + c.VendorString = "Cavium Inc" + c.VendorID = Cavium + case 0x44: + c.VendorString = "Digital Equipment Corporation" + c.VendorID = DEC + case 0x46: + c.VendorString = "Fujitsu Ltd" + c.VendorID = Fujitsu + case 0x49: + c.VendorString = "Infineon Technologies AG" + c.VendorID = Infineon + case 0x4D: + c.VendorString = "Motorola or Freescale Semiconductor Inc" + c.VendorID = Motorola + case 0x4E: + c.VendorString = "NVIDIA Corporation" + c.VendorID = NVIDIA + case 0x50: + c.VendorString = "Applied Micro Circuits Corporation" + c.VendorID = AMCC + case 0x51: + c.VendorString = "Qualcomm Inc" + c.VendorID = Qualcomm + case 0x56: + c.VendorString = "Marvell International Ltd" + c.VendorID = Marvell + case 0x69: + c.VendorString = "Intel Corporation" + c.VendorID = Intel + } + + // Lower 4 bits: Architecture + // Architecture Meaning + // 0b0001 Armv4. + // 0b0010 Armv4T. + // 0b0011 Armv5 (obsolete). + // 0b0100 Armv5T. + // 0b0101 Armv5TE. + // 0b0110 Armv5TEJ. + // 0b0111 Armv6. + // 0b1111 Architectural features are individually identified in the ID_* registers, see 'ID registers'. + // Upper 4 bit: Variant + // An IMPLEMENTATION DEFINED variant number. + // Typically, this field is used to distinguish between different product variants, or major revisions of a product. + c.Family = int(midr>>16) & 0xff + + // PartNum, bits [15:4] + // An IMPLEMENTATION DEFINED primary part number for the device. + // On processors implemented by Arm, if the top four bits of the primary + // part number are 0x0 or 0x7, the variant and architecture are encoded differently. + // Revision, bits [3:0] + // An IMPLEMENTATION DEFINED revision number for the device. + c.Model = int(midr) & 0xffff procFeatures := getProcFeatures() @@ -68,25 +135,18 @@ func addInfo(c *CPUInfo) { // | EL0 | [3-0] | n | // x--------------------------------------------------x - var f ArmFlags + var f flagSet // if procFeatures&(0xf<<48) != 0 { // fmt.Println("DIT") // } - if procFeatures&(0xf<<32) != 0 { - f |= SVE - } + f.setIf(procFeatures&(0xf<<32) != 0, SVE) if procFeatures&(0xf<<20) != 15<<20 { - f |= ASIMD - if procFeatures&(0xf<<20) == 1<<20 { - // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64pfr0_el1 - // 0b0001 --> As for 0b0000, and also includes support for half-precision floating-point arithmetic. - f |= FPHP - f |= ASIMDHP - } - } - if procFeatures&(0xf<<16) != 0 { - f |= FP + f.set(ASIMD) + // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64pfr0_el1 + // 0b0001 --> As for 0b0000, and also includes support for half-precision floating-point arithmetic. + f.setIf(procFeatures&(0xf<<20) == 1<<20, FPHP, ASIMDHP) } + f.setIf(procFeatures&(0xf<<16) != 0, FP) instAttrReg0, instAttrReg1 := getInstAttributes() @@ -127,46 +187,22 @@ func addInfo(c *CPUInfo) { // if instAttrReg0&(0xf<<48) != 0 { // fmt.Println("FHM") // } - if instAttrReg0&(0xf<<44) != 0 { - f |= ASIMDDP - } - if instAttrReg0&(0xf<<40) != 0 { - f |= SM4 - } - if instAttrReg0&(0xf<<36) != 0 { - f |= SM3 - } - if instAttrReg0&(0xf<<32) != 0 { - f |= SHA3 - } - if instAttrReg0&(0xf<<28) != 0 { - f |= ASIMDRDM - } - if instAttrReg0&(0xf<<20) != 0 { - f |= ATOMICS - } - if instAttrReg0&(0xf<<16) != 0 { - f |= CRC32 - } - if instAttrReg0&(0xf<<12) != 0 { - f |= SHA2 - } - if instAttrReg0&(0xf<<12) == 2<<12 { - // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1 - // 0b0010 --> As 0b0001, plus SHA512H, SHA512H2, SHA512SU0, and SHA512SU1 instructions implemented. - f |= SHA512 - } - if instAttrReg0&(0xf<<8) != 0 { - f |= SHA1 - } - if instAttrReg0&(0xf<<4) != 0 { - f |= AES - } - if instAttrReg0&(0xf<<4) == 2<<4 { - // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1 - // 0b0010 --> As for 0b0001, plus PMULL/PMULL2 instructions operating on 64-bit data quantities. - f |= PMULL - } + f.setIf(instAttrReg0&(0xf<<44) != 0, ASIMDDP) + f.setIf(instAttrReg0&(0xf<<40) != 0, SM4) + f.setIf(instAttrReg0&(0xf<<36) != 0, SM3) + f.setIf(instAttrReg0&(0xf<<32) != 0, SHA3) + f.setIf(instAttrReg0&(0xf<<28) != 0, ASIMDRDM) + f.setIf(instAttrReg0&(0xf<<20) != 0, ATOMICS) + f.setIf(instAttrReg0&(0xf<<16) != 0, CRC32) + f.setIf(instAttrReg0&(0xf<<12) != 0, SHA2) + // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1 + // 0b0010 --> As 0b0001, plus SHA512H, SHA512H2, SHA512SU0, and SHA512SU1 instructions implemented. + f.setIf(instAttrReg0&(0xf<<12) == 2<<12, SHA512) + f.setIf(instAttrReg0&(0xf<<8) != 0, SHA1) + f.setIf(instAttrReg0&(0xf<<4) != 0, AESARM) + // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1 + // 0b0010 --> As for 0b0001, plus PMULL/PMULL2 instructions operating on 64-bit data quantities. + f.setIf(instAttrReg0&(0xf<<4) == 2<<4, PMULL) // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar1_el1 // @@ -194,26 +230,18 @@ func addInfo(c *CPUInfo) { // if instAttrReg1&(0xf<<28) != 0 { // fmt.Println("GPI") // } - if instAttrReg1&(0xf<<28) != 24 { - f |= GPA - } - if instAttrReg1&(0xf<<20) != 0 { - f |= LRCPC - } - if instAttrReg1&(0xf<<16) != 0 { - f |= FCMA - } - if instAttrReg1&(0xf<<12) != 0 { - f |= JSCVT - } + f.setIf(instAttrReg1&(0xf<<28) != 24, GPA) + f.setIf(instAttrReg1&(0xf<<20) != 0, LRCPC) + f.setIf(instAttrReg1&(0xf<<16) != 0, FCMA) + f.setIf(instAttrReg1&(0xf<<12) != 0, JSCVT) // if instAttrReg1&(0xf<<8) != 0 { // fmt.Println("API") // } // if instAttrReg1&(0xf<<4) != 0 { // fmt.Println("APA") // } - if instAttrReg1&(0xf<<0) != 0 { - f |= DCPOP - } - c.Arm = f + f.setIf(instAttrReg1&(0xf<<0) != 0, DCPOP) + + // Store + c.featureSet.or(f) } diff --git a/vendor/github.com/klauspost/cpuid/detect_ref.go b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go index 970ff3d22..9636c2bc1 100644 --- a/vendor/github.com/klauspost/cpuid/detect_ref.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go @@ -1,6 +1,7 @@ // Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. -//+build !amd64,!386,!arm64 gccgo noasm appengine +//go:build (!amd64 && !386 && !arm64) || gccgo || noasm || appengine +// +build !amd64,!386,!arm64 gccgo noasm appengine package cpuid @@ -11,4 +12,4 @@ func initCPU() { rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 } } -func addInfo(info *CPUInfo) {} +func addInfo(info *CPUInfo, safe bool) {} diff --git a/vendor/github.com/klauspost/cpuid/detect_intel.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go index 363951b3b..c946824ec 100644 --- a/vendor/github.com/klauspost/cpuid/detect_intel.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -1,6 +1,7 @@ // Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. -//+build 386,!gccgo,!noasm amd64,!gccgo,!noasm,!appengine +//go:build (386 && !gccgo && !noasm && !appengine) || (amd64 && !gccgo && !noasm && !appengine) +// +build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine package cpuid @@ -8,26 +9,28 @@ func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32) func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32) func asmXgetbv(index uint32) (eax, edx uint32) func asmRdtscpAsm() (eax, ebx, ecx, edx uint32) +func asmDarwinHasAVX512() bool func initCPU() { cpuid = asmCpuid cpuidex = asmCpuidex xgetbv = asmXgetbv rdtscpAsm = asmRdtscpAsm + darwinHasAVX512 = asmDarwinHasAVX512 } -func addInfo(c *CPUInfo) { +func addInfo(c *CPUInfo, safe bool) { c.maxFunc = maxFunctionID() c.maxExFunc = maxExtendedFunction() c.BrandName = brandName() c.CacheLine = cacheLine() - c.Family, c.Model = familyModel() - c.Features = support() - c.SGX = hasSGX(c.Features&SGX != 0, c.Features&SGXLC != 0) + c.Family, c.Model, c.Stepping = familyModel() + c.featureSet = support() + c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC)) c.ThreadsPerCore = threadsPerCore() c.LogicalCores = logicalCores() c.PhysicalCores = physicalCores() c.VendorID, c.VendorString = vendorID() - c.Hz = hertz(c.BrandName) c.cacheSize() + c.frequencies() } diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go new file mode 100644 index 000000000..d12e547c4 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -0,0 +1,235 @@ +// Code generated by "stringer -type=FeatureID,Vendor"; DO NOT EDIT. + +package cpuid + +import "strconv" + +func _() { + // An "invalid array index" compiler error signifies that the constant values have changed. + // Re-run the stringer command to generate them again. + var x [1]struct{} + _ = x[ADX-1] + _ = x[AESNI-2] + _ = x[AMD3DNOW-3] + _ = x[AMD3DNOWEXT-4] + _ = x[AMXBF16-5] + _ = x[AMXINT8-6] + _ = x[AMXTILE-7] + _ = x[AVX-8] + _ = x[AVX2-9] + _ = x[AVX512BF16-10] + _ = x[AVX512BITALG-11] + _ = x[AVX512BW-12] + _ = x[AVX512CD-13] + _ = x[AVX512DQ-14] + _ = x[AVX512ER-15] + _ = x[AVX512F-16] + _ = x[AVX512FP16-17] + _ = x[AVX512IFMA-18] + _ = x[AVX512PF-19] + _ = x[AVX512VBMI-20] + _ = x[AVX512VBMI2-21] + _ = x[AVX512VL-22] + _ = x[AVX512VNNI-23] + _ = x[AVX512VP2INTERSECT-24] + _ = x[AVX512VPOPCNTDQ-25] + _ = x[AVXSLOW-26] + _ = x[AVXVNNI-27] + _ = x[BMI1-28] + _ = x[BMI2-29] + _ = x[CETIBT-30] + _ = x[CETSS-31] + _ = x[CLDEMOTE-32] + _ = x[CLMUL-33] + _ = x[CLZERO-34] + _ = x[CMOV-35] + _ = x[CMPSB_SCADBS_SHORT-36] + _ = x[CMPXCHG8-37] + _ = x[CPBOOST-38] + _ = x[CX16-39] + _ = x[ENQCMD-40] + _ = x[ERMS-41] + _ = x[F16C-42] + _ = x[FMA3-43] + _ = x[FMA4-44] + _ = x[FXSR-45] + _ = x[FXSROPT-46] + _ = x[GFNI-47] + _ = x[HLE-48] + _ = x[HRESET-49] + _ = x[HTT-50] + _ = x[HWA-51] + _ = x[HYPERVISOR-52] + _ = x[IBPB-53] + _ = x[IBS-54] + _ = x[IBSBRNTRGT-55] + _ = x[IBSFETCHSAM-56] + _ = x[IBSFFV-57] + _ = x[IBSOPCNT-58] + _ = x[IBSOPCNTEXT-59] + _ = x[IBSOPSAM-60] + _ = x[IBSRDWROPCNT-61] + _ = x[IBSRIPINVALIDCHK-62] + _ = x[IBS_PREVENTHOST-63] + _ = x[INT_WBINVD-64] + _ = x[INVLPGB-65] + _ = x[LAHF-66] + _ = x[LAM-67] + _ = x[LBRVIRT-68] + _ = x[LZCNT-69] + _ = x[MCAOVERFLOW-70] + _ = x[MCOMMIT-71] + _ = x[MMX-72] + _ = x[MMXEXT-73] + _ = x[MOVBE-74] + _ = x[MOVDIR64B-75] + _ = x[MOVDIRI-76] + _ = x[MOVSB_ZL-77] + _ = x[MPX-78] + _ = x[MSRIRC-79] + _ = x[MSR_PAGEFLUSH-80] + _ = x[NRIPS-81] + _ = x[NX-82] + _ = x[OSXSAVE-83] + _ = x[PCONFIG-84] + _ = x[POPCNT-85] + _ = x[RDPRU-86] + _ = x[RDRAND-87] + _ = x[RDSEED-88] + _ = x[RDTSCP-89] + _ = x[RTM-90] + _ = x[RTM_ALWAYS_ABORT-91] + _ = x[SERIALIZE-92] + _ = x[SEV-93] + _ = x[SEV_64BIT-94] + _ = x[SEV_ALTERNATIVE-95] + _ = x[SEV_DEBUGSWAP-96] + _ = x[SEV_ES-97] + _ = x[SEV_RESTRICTED-98] + _ = x[SEV_SNP-99] + _ = x[SGX-100] + _ = x[SGXLC-101] + _ = x[SHA-102] + _ = x[SME-103] + _ = x[SME_COHERENT-104] + _ = x[SSE-105] + _ = x[SSE2-106] + _ = x[SSE3-107] + _ = x[SSE4-108] + _ = x[SSE42-109] + _ = x[SSE4A-110] + _ = x[SSSE3-111] + _ = x[STIBP-112] + _ = x[STOSB_SHORT-113] + _ = x[SUCCOR-114] + _ = x[SVM-115] + _ = x[SVMDA-116] + _ = x[SVMFBASID-117] + _ = x[SVML-118] + _ = x[SVMNP-119] + _ = x[SVMPF-120] + _ = x[SVMPFT-121] + _ = x[SYSCALL-122] + _ = x[SYSEE-123] + _ = x[TBM-124] + _ = x[TOPEXT-125] + _ = x[TME-126] + _ = x[TSCRATEMSR-127] + _ = x[TSXLDTRK-128] + _ = x[VAES-129] + _ = x[VMCBCLEAN-130] + _ = x[VMPL-131] + _ = x[VMSA_REGPROT-132] + _ = x[VMX-133] + _ = x[VPCLMULQDQ-134] + _ = x[VTE-135] + _ = x[WAITPKG-136] + _ = x[WBNOINVD-137] + _ = x[X87-138] + _ = x[XGETBV1-139] + _ = x[XOP-140] + _ = x[XSAVE-141] + _ = x[XSAVEC-142] + _ = x[XSAVEOPT-143] + _ = x[XSAVES-144] + _ = x[AESARM-145] + _ = x[ARMCPUID-146] + _ = x[ASIMD-147] + _ = x[ASIMDDP-148] + _ = x[ASIMDHP-149] + _ = x[ASIMDRDM-150] + _ = x[ATOMICS-151] + _ = x[CRC32-152] + _ = x[DCPOP-153] + _ = x[EVTSTRM-154] + _ = x[FCMA-155] + _ = x[FP-156] + _ = x[FPHP-157] + _ = x[GPA-158] + _ = x[JSCVT-159] + _ = x[LRCPC-160] + _ = x[PMULL-161] + _ = x[SHA1-162] + _ = x[SHA2-163] + _ = x[SHA3-164] + _ = x[SHA512-165] + _ = x[SM3-166] + _ = x[SM4-167] + _ = x[SVE-168] + _ = x[lastID-169] + _ = x[firstID-0] +} + +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXSLOWAVXVNNIBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCX16ENQCMDERMSF16CFMA3FMA4FXSRFXSROPTGFNIHLEHRESETHTTHWAHYPERVISORIBPBIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_PREVENTHOSTINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCOMMITMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMPXMSRIRCMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTRDPRURDRANDRDSEEDRDTSCPRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTOPEXTTMETSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" + +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 58, 62, 72, 84, 92, 100, 108, 116, 123, 133, 143, 151, 161, 172, 180, 190, 208, 223, 230, 237, 241, 245, 251, 256, 264, 269, 275, 279, 297, 305, 312, 316, 322, 326, 330, 334, 338, 342, 349, 353, 356, 362, 365, 368, 378, 382, 385, 395, 406, 412, 420, 431, 439, 451, 467, 482, 492, 499, 503, 506, 513, 518, 529, 536, 539, 545, 550, 559, 566, 574, 577, 583, 596, 601, 603, 610, 617, 623, 628, 634, 640, 646, 649, 665, 674, 677, 686, 701, 714, 720, 734, 741, 744, 749, 752, 755, 767, 770, 774, 778, 782, 787, 792, 797, 802, 813, 819, 822, 827, 836, 840, 845, 850, 856, 863, 868, 871, 877, 880, 890, 898, 902, 911, 915, 927, 930, 940, 943, 950, 958, 961, 968, 971, 976, 982, 990, 996, 1002, 1010, 1015, 1022, 1029, 1037, 1044, 1049, 1054, 1061, 1065, 1067, 1071, 1074, 1079, 1084, 1089, 1093, 1097, 1101, 1107, 1110, 1113, 1116, 1122} + +func (i FeatureID) String() string { + if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { + return "FeatureID(" + strconv.FormatInt(int64(i), 10) + ")" + } + return _FeatureID_name[_FeatureID_index[i]:_FeatureID_index[i+1]] +} +func _() { + // An "invalid array index" compiler error signifies that the constant values have changed. + // Re-run the stringer command to generate them again. + var x [1]struct{} + _ = x[VendorUnknown-0] + _ = x[Intel-1] + _ = x[AMD-2] + _ = x[VIA-3] + _ = x[Transmeta-4] + _ = x[NSC-5] + _ = x[KVM-6] + _ = x[MSVM-7] + _ = x[VMware-8] + _ = x[XenHVM-9] + _ = x[Bhyve-10] + _ = x[Hygon-11] + _ = x[SiS-12] + _ = x[RDC-13] + _ = x[Ampere-14] + _ = x[ARM-15] + _ = x[Broadcom-16] + _ = x[Cavium-17] + _ = x[DEC-18] + _ = x[Fujitsu-19] + _ = x[Infineon-20] + _ = x[Motorola-21] + _ = x[NVIDIA-22] + _ = x[AMCC-23] + _ = x[Qualcomm-24] + _ = x[Marvell-25] + _ = x[lastVendor-26] +} + +const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvelllastVendor" + +var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 155} + +func (i Vendor) String() string { + if i < 0 || i >= Vendor(len(_Vendor_index)-1) { + return "Vendor(" + strconv.FormatInt(int64(i), 10) + ")" + } + return _Vendor_name[_Vendor_index[i]:_Vendor_index[i+1]] +} diff --git a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go new file mode 100644 index 000000000..d91d02109 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go @@ -0,0 +1,121 @@ +// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file. + +package cpuid + +import ( + "runtime" + "strings" + + "golang.org/x/sys/unix" +) + +func detectOS(c *CPUInfo) bool { + if runtime.GOOS != "ios" { + tryToFillCPUInfoFomSysctl(c) + } + // There are no hw.optional sysctl values for the below features on Mac OS 11.0 + // to detect their supported state dynamically. Assume the CPU features that + // Apple Silicon M1 supports to be available as a minimal set of features + // to all Go programs running on darwin/arm64. + // TODO: Add more if we know them. + c.featureSet.setIf(runtime.GOOS != "ios", AESARM, PMULL, SHA1, SHA2) + + return true +} + +func sysctlGetBool(name string) bool { + value, err := unix.SysctlUint32(name) + if err != nil { + return false + } + return value != 0 +} + +func sysctlGetString(name string) string { + value, err := unix.Sysctl(name) + if err != nil { + return "" + } + return value +} + +func sysctlGetInt(unknown int, names ...string) int { + for _, name := range names { + value, err := unix.SysctlUint32(name) + if err != nil { + continue + } + if value != 0 { + return int(value) + } + } + return unknown +} + +func sysctlGetInt64(unknown int, names ...string) int { + for _, name := range names { + value64, err := unix.SysctlUint64(name) + if err != nil { + continue + } + if int(value64) != unknown { + return int(value64) + } + } + return unknown +} + +func setFeature(c *CPUInfo, name string, feature FeatureID) { + c.featureSet.setIf(sysctlGetBool(name), feature) +} +func tryToFillCPUInfoFomSysctl(c *CPUInfo) { + c.BrandName = sysctlGetString("machdep.cpu.brand_string") + + if len(c.BrandName) != 0 { + c.VendorString = strings.Fields(c.BrandName)[0] + } + + c.PhysicalCores = sysctlGetInt(runtime.NumCPU(), "hw.physicalcpu") + c.ThreadsPerCore = sysctlGetInt(1, "machdep.cpu.thread_count", "kern.num_threads") / + sysctlGetInt(1, "hw.physicalcpu") + c.LogicalCores = sysctlGetInt(runtime.NumCPU(), "machdep.cpu.core_count") + c.Family = sysctlGetInt(0, "machdep.cpu.family", "hw.cpufamily") + c.Model = sysctlGetInt(0, "machdep.cpu.model") + c.CacheLine = sysctlGetInt64(0, "hw.cachelinesize") + c.Cache.L1I = sysctlGetInt64(-1, "hw.l1icachesize") + c.Cache.L1D = sysctlGetInt64(-1, "hw.l1icachesize") + c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize") + c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize") + + // from https://developer.arm.com/downloads/-/exploration-tools/feature-names-for-a-profile + setFeature(c, "hw.optional.arm.FEAT_AES", AESARM) + setFeature(c, "hw.optional.AdvSIMD", ASIMD) + setFeature(c, "hw.optional.arm.FEAT_DotProd", ASIMDDP) + setFeature(c, "hw.optional.arm.FEAT_RDM", ASIMDRDM) + setFeature(c, "hw.optional.FEAT_CRC32", CRC32) + setFeature(c, "hw.optional.arm.FEAT_DPB", DCPOP) + // setFeature(c, "", EVTSTRM) + setFeature(c, "hw.optional.arm.FEAT_FCMA", FCMA) + setFeature(c, "hw.optional.arm.FEAT_FP", FP) + setFeature(c, "hw.optional.arm.FEAT_FP16", FPHP) + setFeature(c, "hw.optional.arm.FEAT_PAuth", GPA) + setFeature(c, "hw.optional.arm.FEAT_JSCVT", JSCVT) + setFeature(c, "hw.optional.arm.FEAT_LRCPC", LRCPC) + setFeature(c, "hw.optional.arm.FEAT_PMULL", PMULL) + setFeature(c, "hw.optional.arm.FEAT_SHA1", SHA1) + setFeature(c, "hw.optional.arm.FEAT_SHA256", SHA2) + setFeature(c, "hw.optional.arm.FEAT_SHA3", SHA3) + setFeature(c, "hw.optional.arm.FEAT_SHA512", SHA512) + // setFeature(c, "", SM3) + // setFeature(c, "", SM4) + setFeature(c, "hw.optional.arm.FEAT_SVE", SVE) + + // from empirical observation + setFeature(c, "hw.optional.AdvSIMD_HPFPCvt", ASIMDHP) + setFeature(c, "hw.optional.armv8_1_atomics", ATOMICS) + setFeature(c, "hw.optional.floatingpoint", FP) + setFeature(c, "hw.optional.armv8_2_sha3", SHA3) + setFeature(c, "hw.optional.armv8_2_sha512", SHA512) + setFeature(c, "hw.optional.armv8_3_compnum", FCMA) + setFeature(c, "hw.optional.armv8_crc32", CRC32) +} diff --git a/vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go new file mode 100644 index 000000000..ee278b9e4 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go @@ -0,0 +1,130 @@ +// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file. + +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file located +// here https://github.com/golang/sys/blob/master/LICENSE + +package cpuid + +import ( + "encoding/binary" + "io/ioutil" + "runtime" +) + +// HWCAP bits. +const ( + hwcap_FP = 1 << 0 + hwcap_ASIMD = 1 << 1 + hwcap_EVTSTRM = 1 << 2 + hwcap_AES = 1 << 3 + hwcap_PMULL = 1 << 4 + hwcap_SHA1 = 1 << 5 + hwcap_SHA2 = 1 << 6 + hwcap_CRC32 = 1 << 7 + hwcap_ATOMICS = 1 << 8 + hwcap_FPHP = 1 << 9 + hwcap_ASIMDHP = 1 << 10 + hwcap_CPUID = 1 << 11 + hwcap_ASIMDRDM = 1 << 12 + hwcap_JSCVT = 1 << 13 + hwcap_FCMA = 1 << 14 + hwcap_LRCPC = 1 << 15 + hwcap_DCPOP = 1 << 16 + hwcap_SHA3 = 1 << 17 + hwcap_SM3 = 1 << 18 + hwcap_SM4 = 1 << 19 + hwcap_ASIMDDP = 1 << 20 + hwcap_SHA512 = 1 << 21 + hwcap_SVE = 1 << 22 + hwcap_ASIMDFHM = 1 << 23 +) + +func detectOS(c *CPUInfo) bool { + // For now assuming no hyperthreading is reasonable. + c.LogicalCores = runtime.NumCPU() + c.PhysicalCores = c.LogicalCores + c.ThreadsPerCore = 1 + if hwcap == 0 { + // We did not get values from the runtime. + // Try reading /proc/self/auxv + + // From https://github.com/golang/sys + const ( + _AT_HWCAP = 16 + _AT_HWCAP2 = 26 + + uintSize = int(32 << (^uint(0) >> 63)) + ) + + buf, err := ioutil.ReadFile("/proc/self/auxv") + if err != nil { + // e.g. on android /proc/self/auxv is not accessible, so silently + // ignore the error and leave Initialized = false. On some + // architectures (e.g. arm64) doinit() implements a fallback + // readout and will set Initialized = true again. + return false + } + bo := binary.LittleEndian + for len(buf) >= 2*(uintSize/8) { + var tag, val uint + switch uintSize { + case 32: + tag = uint(bo.Uint32(buf[0:])) + val = uint(bo.Uint32(buf[4:])) + buf = buf[8:] + case 64: + tag = uint(bo.Uint64(buf[0:])) + val = uint(bo.Uint64(buf[8:])) + buf = buf[16:] + } + switch tag { + case _AT_HWCAP: + hwcap = val + case _AT_HWCAP2: + // Not used + } + } + if hwcap == 0 { + return false + } + } + + // HWCap was populated by the runtime from the auxiliary vector. + // Use HWCap information since reading aarch64 system registers + // is not supported in user space on older linux kernels. + c.featureSet.setIf(isSet(hwcap, hwcap_AES), AESARM) + c.featureSet.setIf(isSet(hwcap, hwcap_ASIMD), ASIMD) + c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDDP), ASIMDDP) + c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDHP), ASIMDHP) + c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDRDM), ASIMDRDM) + c.featureSet.setIf(isSet(hwcap, hwcap_CPUID), ARMCPUID) + c.featureSet.setIf(isSet(hwcap, hwcap_CRC32), CRC32) + c.featureSet.setIf(isSet(hwcap, hwcap_DCPOP), DCPOP) + c.featureSet.setIf(isSet(hwcap, hwcap_EVTSTRM), EVTSTRM) + c.featureSet.setIf(isSet(hwcap, hwcap_FCMA), FCMA) + c.featureSet.setIf(isSet(hwcap, hwcap_FP), FP) + c.featureSet.setIf(isSet(hwcap, hwcap_FPHP), FPHP) + c.featureSet.setIf(isSet(hwcap, hwcap_JSCVT), JSCVT) + c.featureSet.setIf(isSet(hwcap, hwcap_LRCPC), LRCPC) + c.featureSet.setIf(isSet(hwcap, hwcap_PMULL), PMULL) + c.featureSet.setIf(isSet(hwcap, hwcap_SHA1), SHA1) + c.featureSet.setIf(isSet(hwcap, hwcap_SHA2), SHA2) + c.featureSet.setIf(isSet(hwcap, hwcap_SHA3), SHA3) + c.featureSet.setIf(isSet(hwcap, hwcap_SHA512), SHA512) + c.featureSet.setIf(isSet(hwcap, hwcap_SM3), SM3) + c.featureSet.setIf(isSet(hwcap, hwcap_SM4), SM4) + c.featureSet.setIf(isSet(hwcap, hwcap_SVE), SVE) + + // The Samsung S9+ kernel reports support for atomics, but not all cores + // actually support them, resulting in SIGILL. See issue #28431. + // TODO(elias.naur): Only disable the optimization on bad chipsets on android. + c.featureSet.setIf(isSet(hwcap, hwcap_ATOMICS) && runtime.GOOS != "android", ATOMICS) + + return true +} + +func isSet(hwc uint, value uint) bool { + return hwc&value != 0 +} diff --git a/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go new file mode 100644 index 000000000..8733ba343 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go @@ -0,0 +1,16 @@ +// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file. + +//go:build arm64 && !linux && !darwin +// +build arm64,!linux,!darwin + +package cpuid + +import "runtime" + +func detectOS(c *CPUInfo) bool { + c.PhysicalCores = runtime.NumCPU() + // For now assuming 1 thread per core... + c.ThreadsPerCore = 1 + c.LogicalCores = c.PhysicalCores + return false +} diff --git a/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go new file mode 100644 index 000000000..f8f201b5f --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go @@ -0,0 +1,8 @@ +// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file. + +//go:build nounsafe +// +build nounsafe + +package cpuid + +var hwcap uint diff --git a/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go new file mode 100644 index 000000000..92af622eb --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go @@ -0,0 +1,11 @@ +// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file. + +//go:build !nounsafe +// +build !nounsafe + +package cpuid + +import _ "unsafe" // needed for go:linkname + +//go:linkname hwcap internal/cpu.HWCap +var hwcap uint diff --git a/vendor/github.com/klauspost/cpuid/v2/test-architectures.sh b/vendor/github.com/klauspost/cpuid/v2/test-architectures.sh new file mode 100644 index 000000000..471d986d2 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/test-architectures.sh @@ -0,0 +1,15 @@ +#!/bin/sh + +set -e + +go tool dist list | while IFS=/ read os arch; do + echo "Checking $os/$arch..." + echo " normal" + GOARCH=$arch GOOS=$os go build -o /dev/null . + echo " noasm" + GOARCH=$arch GOOS=$os go build -tags noasm -o /dev/null . + echo " appengine" + GOARCH=$arch GOOS=$os go build -tags appengine -o /dev/null . + echo " noasm,appengine" + GOARCH=$arch GOOS=$os go build -tags 'appengine noasm' -o /dev/null . +done diff --git a/vendor/github.com/microcosm-cc/bluemonday/LICENSE.md b/vendor/github.com/microcosm-cc/bluemonday/LICENSE.md index f822458ed..2e6c493ba 100644 --- a/vendor/github.com/microcosm-cc/bluemonday/LICENSE.md +++ b/vendor/github.com/microcosm-cc/bluemonday/LICENSE.md @@ -1,3 +1,6 @@ +SPDX short identifier: BSD-3-Clause +https://opensource.org/licenses/BSD-3-Clause + Copyright (c) 2014, David Kitchen <david@buro9.com> All rights reserved. diff --git a/vendor/github.com/microcosm-cc/bluemonday/README.md b/vendor/github.com/microcosm-cc/bluemonday/README.md index d20debf0e..8e658fea7 100644 --- a/vendor/github.com/microcosm-cc/bluemonday/README.md +++ b/vendor/github.com/microcosm-cc/bluemonday/README.md @@ -1,4 +1,4 @@ -# bluemonday [](https://travis-ci.org/microcosm-cc/bluemonday) [](https://godoc.org/github.com/microcosm-cc/bluemonday) [](https://sourcegraph.com/github.com/microcosm-cc/bluemonday?badge) +# bluemonday [](https://godoc.org/github.com/microcosm-cc/bluemonday) [](https://sourcegraph.com/github.com/microcosm-cc/bluemonday?badge) bluemonday is a HTML sanitizer implemented in Go. It is fast and highly configurable. diff --git a/vendor/github.com/microcosm-cc/bluemonday/css/handlers.go b/vendor/github.com/microcosm-cc/bluemonday/css/handlers.go index 200a6729a..e0429cf25 100644 --- a/vendor/github.com/microcosm-cc/bluemonday/css/handlers.go +++ b/vendor/github.com/microcosm-cc/bluemonday/css/handlers.go @@ -280,6 +280,49 @@ var ( "slategray", "slategrey", "snow", "springgreen", "steelblue", "tan", "teal", "thistle", "tomato", "turquoise", "violet", "wheat", "white", "whitesmoke", "yellow", "yellowgreen"} + + Alpha = regexp.MustCompile(`^[a-z]+$`) + Blur = regexp.MustCompile(`^blur\([0-9]+px\)$`) + BrightnessCont = regexp.MustCompile(`^(brightness|contrast)\([0-9]+\%\)$`) + Count = regexp.MustCompile(`^[0-9]+[\.]?[0-9]*$`) + CubicBezier = regexp.MustCompile(`^cubic-bezier\(([ ]*(0(.[0-9]+)?|1(.0)?),){3}[ ]*(0(.[0-9]+)?|1)\)$`) + Digits = regexp.MustCompile(`^digits [2-4]$`) + DropShadow = regexp.MustCompile(`drop-shadow\(([-]?[0-9]+px) ([-]?[0-9]+px)( [-]?[0-9]+px)?( ([-]?[0-9]+px))?`) + Font = regexp.MustCompile(`^('[a-z \-]+'|[a-z \-]+)$`) + Grayscale = regexp.MustCompile(`^grayscale\(([0-9]{1,2}|100)%\)$`) + GridTemplateAreas = regexp.MustCompile(`^['"]?[a-z ]+['"]?$`) + HexRGB = regexp.MustCompile(`^#([0-9a-f]{3}|[0-9a-f]{6}|[0-9a-f]{8})$`) + HSL = regexp.MustCompile(`^hsl\([ ]*([012]?[0-9]{1,2}|3[0-5][0-9]|360),[ ]*([0-9]{0,2}|100)\%,[ ]*([0-9]{0,2}|100)\%\)$`) + HSLA = regexp.MustCompile(`^hsla\(([ ]*[012]?[0-9]{1,2}|3[0-5][0-9]|360),[ ]*([0-9]{0,2}|100)\%,[ ]*([0-9]{0,2}|100)\%,[ ]*(1|1\.0|0|(0\.[0-9]+))\)$`) + HueRotate = regexp.MustCompile(`^hue-rotate\(([12]?[0-9]{1,2}|3[0-5][0-9]|360)?\)$`) + Invert = regexp.MustCompile(`^invert\(([0-9]{1,2}|100)%\)$`) + Length = regexp.MustCompile(`^[\-]?([0-9]+|[0-9]*[\.][0-9]+)(%|cm|mm|in|px|pt|pc|em|ex|ch|rem|vw|vh|vmin|vmax|deg|rad|turn)?$`) + Matrix = regexp.MustCompile(`^matrix\(([ ]*[0-9]+[\.]?[0-9]*,){5}([ ]*[0-9]+[\.]?[0-9]*)\)$`) + Matrix3D = regexp.MustCompile(`^matrix3d\(([ ]*[0-9]+[\.]?[0-9]*,){15}([ ]*[0-9]+[\.]?[0-9]*)\)$`) + NegTime = regexp.MustCompile(`^[\-]?[0-9]+[\.]?[0-9]*(s|ms)?$`) + Numeric = regexp.MustCompile(`^[0-9]+$`) + NumericDecimal = regexp.MustCompile(`^[0-9\.]+$`) + Opactiy = regexp.MustCompile(`^opacity\(([0-9]{1,2}|100)%\)$`) + Perspective = regexp.MustCompile(`perspective\(`) + Position = regexp.MustCompile(`^[\-]*[0-9]+[cm|mm|in|px|pt|pc\%]* [[\-]*[0-9]+[cm|mm|in|px|pt|pc\%]*]*$`) + Opacity = regexp.MustCompile(`^(0[.]?[0-9]*)|(1.0)$`) + QuotedAlpha = regexp.MustCompile(`^["'][a-z]+["']$`) + Quotes = regexp.MustCompile(`^([ ]*["'][\x{0022}\x{0027}\x{2039}\x{2039}\x{203A}\x{00AB}\x{00BB}\x{2018}\x{2019}\x{201C}-\x{201E}]["'] ["'][\x{0022}\x{0027}\x{2039}\x{2039}\x{203A}\x{00AB}\x{00BB}\x{2018}\x{2019}\x{201C}-\x{201E}]["'])+$`) + Rect = regexp.MustCompile(`^rect\([0-9]+px,[ ]*[0-9]+px,[ ]*[0-9]+px,[ ]*[0-9]+px\)$`) + RGB = regexp.MustCompile(`^rgb\(([ ]*((([0-9]{1,2}|100)\%)|(([01]?[0-9]{1,2})|(2[0-4][0-9])|(25[0-5]))),){2}([ ]*((([0-9]{1,2}|100)\%)|(([01]?[0-9]{1,2})|(2[0-4][0-9])|(25[0-5]))))\)$`) + RGBA = regexp.MustCompile(`^rgba\(([ ]*((([0-9]{1,2}|100)\%)|(([01]?[0-9]{1,2})|(2[0-4][0-9])|(25[0-5]))),){3}[ ]*(1(\.0)?|0|(0\.[0-9]+))\)$`) + Rotate = regexp.MustCompile(`^rotate(x|y|z)?\(([12]?|3[0-5][0-9]|360)\)$`) + Rotate3D = regexp.MustCompile(`^rotate3d\(([ ]?(1(\.0)?|0\.[0-9]+),){3}([12]?|3[0-5][0-9]|360)\)$`) + Saturate = regexp.MustCompile(`^saturate\([0-9]+%\)$`) + Sepia = regexp.MustCompile(`^sepia\(([0-9]{1,2}|100)%\)$`) + Skew = regexp.MustCompile(`skew(x|y)?\(`) + Span = regexp.MustCompile(`^span [0-9]+$`) + Steps = regexp.MustCompile(`^steps\([ ]*[0-9]+([ ]*,[ ]*(start|end)?)\)$`) + Time = regexp.MustCompile(`^[0-9]+[\.]?[0-9]*(s|ms)?$`) + TransitionProp = regexp.MustCompile(`^([a-zA-Z]+,[ ]?)*[a-zA-Z]+$`) + TranslateScale = regexp.MustCompile(`(translate|translate3d|translatex|translatey|translatez|scale|scale3d|scalex|scaley|scalez)\(`) + URL = regexp.MustCompile(`^url\([\"\']?((https|http)[a-z0-9\.\\/_:]+[\"\']?)\)$`) + ZIndex = regexp.MustCompile(`^[\-]?[0-9]+$`) ) func multiSplit(value string, seps ...string) []string { @@ -388,9 +431,7 @@ func AnimationHandler(value string) bool { } func AnimationDelayHandler(value string) bool { - reg := regexp.MustCompile(`[\-]?[0-9]+[\.]?[0-9]*[s|ms]?`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if NegTime.MatchString(value) { return true } values := []string{"initial", "inherit"} @@ -405,9 +446,7 @@ func AnimationDirectionHandler(value string) bool { } func AnimationDurationHandler(value string) bool { - reg := regexp.MustCompile(`[0-9]+[\.]?[0-9]*[s|ms]?`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if Time.MatchString(value) { return true } values := []string{"initial", "inherit"} @@ -422,9 +461,7 @@ func AnimationFillModeHandler(value string) bool { } func AnimationIterationCountHandler(value string) bool { - reg := regexp.MustCompile(`[0-9]+[\.]?[0-9]*`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if Count.MatchString(value) { return true } values := []string{"infinite", "initial", "inherit"} @@ -433,9 +470,7 @@ func AnimationIterationCountHandler(value string) bool { } func AnimationNameHandler(value string) bool { - reg := regexp.MustCompile(`[a-z]+`) - reg.Longest() - return reg.FindString(value) == value && value != "" + return Alpha.MatchString(value) } func AnimationPlayStateHandler(value string) bool { @@ -450,14 +485,10 @@ func TimingFunctionHandler(value string) bool { if in(splitVals, values) { return true } - reg := regexp.MustCompile(`cubic-bezier\(([ ]*(0(.[0-9]+)?|1(.0)?),){3}[ ]*(0(.[0-9]+)?|1)\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if CubicBezier.MatchString(value) { return true } - reg = regexp.MustCompile(`steps\([ ]*[0-9]+([ ]*,[ ]*(start|end)?)\)`) - reg.Longest() - return reg.FindString(value) == value && value != "" + return Steps.MatchString(value) } func BackfaceVisibilityHandler(value string) bool { @@ -518,9 +549,7 @@ func ImageHandler(value string) bool { if in(splitVals, values) { return true } - reg := regexp.MustCompile(`url\([\"\']?((https|http)[a-z0-9\.\\/_:]+[\"\']?)\)`) - reg.Longest() - return reg.FindString(value) == value && value != "" + return URL.MatchString(value) } func BackgroundOriginHandler(value string) bool { @@ -535,12 +564,7 @@ func BackgroundPositionHandler(value string) bool { if in(splitVals, values) { return true } - reg := regexp.MustCompile(`[\-]*[0-9]+[cm|mm|in|px|pt|pc\%]* [[\-]*[0-9]+[cm|mm|in|px|pt|pc\%]*]*`) - reg.Longest() - if reg.FindString(value) == value && value != "" { - return true - } - return false + return Position.MatchString(value) } func BackgroundRepeatHandler(value string) bool { @@ -816,31 +840,19 @@ func CaretColorHandler(value string) bool { if in(splitVals, colorValues) { return true } - reg := regexp.MustCompile(`#[0-9abcdef]{6}`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if HexRGB.MatchString(value) { return true } - reg = regexp.MustCompile(`rgb\(([ ]*((([0-9]{1,2}|100)\%)|(([01]?[0-9]{1,2})|(2[0-4][0-9])|(25[0-5]))),){2}([ ]*((([0-9]{1,2}|100)\%)|(([01]?[0-9]{1,2})|(2[0-4][0-9])|(25[0-5]))))\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if RGB.MatchString(value) { return true } - reg = regexp.MustCompile(`rgba\(([ ]*((([0-9]{1,2}|100)\%)|(([01]?[0-9]{1,2})|(2[0-4][0-9])|(25[0-5]))),){3}[ ]*(1(\.0)?|0|(0\.[0-9]+))\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if RGBA.MatchString(value) { return true } - reg = regexp.MustCompile(`hsl\([ ]*([012]?[0-9]{1,2}|3[0-5][0-9]|360),[ ]*([0-9]{0,2}|100)\%,[ ]*([0-9]{0,2}|100)\%\)`) - if reg.FindString(value) == value && value != "" { + if HSL.MatchString(value) { return true } - reg = regexp.MustCompile(`hsla\(([ ]*[012]?[0-9]{1,2}|3[0-5][0-9]|360),[ ]*([0-9]{0,2}|100)\%,[ ]*([0-9]{0,2}|100)\%,[ ]*(1|1\.0|0|(0\.[0-9]+))\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { - return true - } - return false + return HSLA.MatchString(value) } func ClearHandler(value string) bool { @@ -850,9 +862,7 @@ func ClearHandler(value string) bool { } func ClipHandler(value string) bool { - reg := regexp.MustCompile(`rect\([0-9]+px,[ ]*[0-9]+px,[ ]*[0-9]+px,[ ]*[0-9]+px\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if Rect.MatchString(value) { return true } values := []string{"auto", "initial", "inherit"} @@ -865,38 +875,23 @@ func ColorHandler(value string) bool { if in(splitVals, colorValues) { return true } - reg := regexp.MustCompile(`#[0-9abcdef]{6}`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if HexRGB.MatchString(value) { return true } - reg = regexp.MustCompile(`rgb\(([ ]*((([0-9]{1,2}|100)\%)|(([01]?[0-9]{1,2})|(2[0-4][0-9])|(25[0-5]))),){2}([ ]*((([0-9]{1,2}|100)\%)|(([01]?[0-9]{1,2})|(2[0-4][0-9])|(25[0-5]))))\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if RGB.MatchString(value) { return true } - reg = regexp.MustCompile(`rgba\(([ ]*((([0-9]{1,2}|100)\%)|(([01]?[0-9]{1,2})|(2[0-4][0-9])|(25[0-5]))),){3}[ ]*(1(\.0)?|0|(0\.[0-9]+))\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if RGBA.MatchString(value) { return true } - reg = regexp.MustCompile(`hsl\([ ]*([012]?[0-9]{1,2}|3[0-5][0-9]|360),[ ]*([0-9]{0,2}|100)\%,[ ]*([0-9]{0,2}|100)\%\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if HSL.MatchString(value) { return true } - reg = regexp.MustCompile(`hsla\(([ ]*[012]?[0-9]{1,2}|3[0-5][0-9]|360),[ ]*([0-9]{0,2}|100)\%,[ ]*([0-9]{0,2}|100)\%,[ ]*(1|1\.0|0|(0\.[0-9]+))\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { - return true - } - return false + return HSLA.MatchString(value) } func ColumnCountHandler(value string) bool { - reg := regexp.MustCompile(`[0-9]+`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if Numeric.MatchString(value) { return true } values := []string{"auto", "initial", "inherit"} @@ -1000,54 +995,35 @@ func FilterHandler(value string) bool { if in(splitVals, values) { return true } - reg := regexp.MustCompile(`blur\([0-9]+px\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if Blur.MatchString(value) { return true } - reg = regexp.MustCompile(`(brightness|contrast)\([0-9]+\%\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if BrightnessCont.MatchString(value) { return true } - reg = regexp.MustCompile(`drop-shadow\(([-]?[0-9]+px) ([-]?[0-9]+px)( [-]?[0-9]+px)?( ([-]?[0-9]+px))?`) - reg.Longest() - colorValue := strings.TrimSuffix(string(reg.ReplaceAll([]byte(value), []byte{})), ")") - if ColorHandler(colorValue) { + if DropShadow.MatchString(value) { return true } - reg = regexp.MustCompile(`grayscale\(([0-9]{1,2}|100)%\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + colorValue := strings.TrimSuffix(string(DropShadow.ReplaceAll([]byte(value), []byte{})), ")") + if ColorHandler(colorValue) { return true } - reg = regexp.MustCompile(`hue-rotate\(([12]?[0-9]{1,2}|3[0-5][0-9]|360)?\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if Grayscale.MatchString(value) { return true } - reg = regexp.MustCompile(`invert\(([0-9]{1,2}|100)%\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if HueRotate.MatchString(value) { return true } - reg = regexp.MustCompile(`opacity\(([0-9]{1,2}|100)%\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if Invert.MatchString(value) { return true } - reg = regexp.MustCompile(`saturate\([0-9]+%\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if Opacity.MatchString(value) { return true } - reg = regexp.MustCompile(`sepia\(([0-9]{1,2}|100)%\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if Saturate.MatchString(value) { return true } - //Not allowing URLs - return false + return Sepia.MatchString(value) } func FlexHandler(value string) bool { @@ -1092,9 +1068,7 @@ func FlexFlowHandler(value string) bool { } func FlexGrowHandler(value string) bool { - reg := regexp.MustCompile(`[0-9\.]+`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if NumericDecimal.MatchString(value) { return true } splitVals := strings.Split(value, ";") @@ -1144,11 +1118,9 @@ func FontFamilyHandler(value string) bool { if in(splitVals, values) { return true } - reg := regexp.MustCompile(`('[a-z \-]+'|[a-z \-]+)`) - reg.Longest() for _, i := range splitVals { i = strings.TrimSpace(i) - if reg.FindString(i) != i { + if Font.FindString(i) != i { return false } } @@ -1162,9 +1134,7 @@ func FontKerningHandler(value string) bool { } func FontLanguageOverrideHandler(value string) bool { - reg := regexp.MustCompile(`[a-z]+`) - reg.Longest() - return reg.FindString(value) == value && value != "" + return Alpha.MatchString(value) } func FontSizeHandler(value string) bool { @@ -1177,9 +1147,7 @@ func FontSizeHandler(value string) bool { } func FontSizeAdjustHandler(value string) bool { - reg := regexp.MustCompile(`[0-9]+[\.]?[0-9]*`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if Count.MatchString(value) { return true } values := []string{"auto", "initial", "inherit"} @@ -1298,9 +1266,7 @@ func GridColumnGapHandler(value string) bool { } func LengthHandler(value string) bool { - reg := regexp.MustCompile(`[\-]?[0-9]+[\.]?[0-9]*(%|cm|mm|in|px|pt|pc|em|ex|ch|rem|vw|vh|vmin|vmax|deg|rad|turn)?`) - reg.Longest() - return reg.FindString(value) == value && value != "" + return Length.MatchString(value) } func LineBreakHandler(value string) bool { @@ -1310,12 +1276,10 @@ func LineBreakHandler(value string) bool { } func GridAxisStartEndHandler(value string) bool { - reg := regexp.MustCompile(`[0-9]+`) - if reg.FindString(value) == value && value != "" { + if Numeric.MatchString(value) { return true } - reg = regexp.MustCompile(`span [0-9]+`) - if reg.FindString(value) == value && value != "" { + if Span.MatchString(value) { return true } values := []string{"auto"} @@ -1366,9 +1330,7 @@ func GridTemplateAreasHandler(value string) bool { if in([]string{value}, values) { return true } - reg := regexp.MustCompile(`['"]?[a-z ]+['"]?`) - reg.Longest() - return reg.FindString(value) == value && value != "" + return GridTemplateAreas.MatchString(value) } func GridTemplateColumnsHandler(value string) bool { @@ -1551,9 +1513,7 @@ func ObjectPositionHandler(value string) bool { } func OpacityHandler(value string) bool { - reg := regexp.MustCompile("(0[.]?[0-9]*)|(1.0)") - reg.Longest() - if reg.FindString(value) == value && value != "" { + if Opacity.MatchString(value) { return true } values := []string{"initial", "inherit"} @@ -1562,9 +1522,7 @@ func OpacityHandler(value string) bool { } func OrderHandler(value string) bool { - reg := regexp.MustCompile("[0-9]+") - reg.Longest() - if reg.FindString(value) == value && value != "" { + if Numeric.MatchString(value) { return true } values := []string{"initial", "inherit"} @@ -1629,9 +1587,7 @@ func OverflowWrapHandler(value string) bool { } func OrphansHandler(value string) bool { - reg := regexp.MustCompile(`[0-9]+`) - reg.Longest() - return reg.FindString(value) == value && value != "" + return Numeric.MatchString(value) } func PaddingHandler(value string) bool { @@ -1716,9 +1672,7 @@ func QuotesHandler(value string) bool { if in(splitVals, values) { return true } - reg := regexp.MustCompile(`([ ]*["'][\x{0022}\x{0027}\x{2039}\x{2039}\x{203A}\x{00AB}\x{00BB}\x{2018}\x{2019}\x{201C}-\x{201E}]["'] ["'][\x{0022}\x{0027}\x{2039}\x{2039}\x{203A}\x{00AB}\x{00BB}\x{2018}\x{2019}\x{201C}-\x{201E}]["'])+`) - reg.Longest() - return reg.FindString(value) == value && value != "" + return Quotes.MatchString(value) } func ResizeHandler(value string) bool { @@ -1766,9 +1720,7 @@ func TextCombineUprightHandler(value string) bool { if in(splitVals, values) { return true } - reg := regexp.MustCompile(`digits [2-4]`) - reg.Longest() - return reg.FindString(value) == value && value != "" + return Digits.MatchString(value) } func TextDecorationHandler(value string) bool { @@ -1813,9 +1765,7 @@ func TextJustifyHandler(value string) bool { } func TextOverflowHandler(value string) bool { - reg := regexp.MustCompile("[\"'][a-z]+[\"']") - reg.Longest() - if reg.FindString(value) == value && value != "" { + if QuotedAlpha.MatchString(value) { return true } values := []string{"clip", "ellipsis", "initial", "inherit"} @@ -1868,18 +1818,13 @@ func TransformHandler(value string) bool { if in([]string{value}, values) { return true } - reg := regexp.MustCompile(`matrix\(([ ]*[0-9]+[\.]?[0-9]*,){5}([ ]*[0-9]+[\.]?[0-9]*)\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if Matrix.MatchString(value) { return true } - reg = regexp.MustCompile(`matrix3d\(([ ]*[0-9]+[\.]?[0-9]*,){15}([ ]*[0-9]+[\.]?[0-9]*)\)`) - if reg.FindString(value) == value && value != "" { + if Matrix3D.MatchString(value) { return true } - reg = regexp.MustCompile(`(translate|translate3d|translatex|translatey|translatez|scale|scale3d|scalex|scaley|scalez)\(`) - reg.Longest() - subValue := string(reg.ReplaceAll([]byte(value), []byte{})) + subValue := string(TranslateScale.ReplaceAll([]byte(value), []byte{})) trimValue := strings.Split(strings.TrimSuffix(subValue, ")"), ",") valid := true for _, i := range trimValue { @@ -1891,19 +1836,13 @@ func TransformHandler(value string) bool { if valid && trimValue != nil { return true } - reg = regexp.MustCompile(`rotate(x|y|z)?\(([12]?|3[0-5][0-9]|360)\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if Rotate.MatchString(value) { return true } - reg = regexp.MustCompile(`rotate3d\(([ ]?(1(\.0)?|0\.[0-9]+),){3}([12]?|3[0-5][0-9]|360)\)`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if Rotate3D.MatchString(value) { return true } - reg = regexp.MustCompile(`skew(x|y)?\(`) - reg.Longest() - subValue = string(reg.ReplaceAll([]byte(value), []byte{})) + subValue = string(Skew.ReplaceAll([]byte(value), []byte{})) subValue = strings.TrimSuffix(subValue, ")") trimValue = strings.Split(subValue, ",") valid = true @@ -1916,9 +1855,7 @@ func TransformHandler(value string) bool { if valid { return true } - reg = regexp.MustCompile(`perspective\(`) - reg.Longest() - subValue = string(reg.ReplaceAll([]byte(value), []byte{})) + subValue = string(Perspective.ReplaceAll([]byte(value), []byte{})) subValue = strings.TrimSuffix(subValue, ")") return LengthHandler(subValue) } @@ -1973,9 +1910,7 @@ func TransitionHandler(value string) bool { } func TransitionDelayHandler(value string) bool { - reg := regexp.MustCompile("[0-9]+[.]?[0-9]*(s|ms)?") - reg.Longest() - if reg.FindString(value) == value && value != "" { + if Time.MatchString(value) { return true } values := []string{"initial", "inherit"} @@ -1984,9 +1919,7 @@ func TransitionDelayHandler(value string) bool { } func TransitionDurationHandler(value string) bool { - reg := regexp.MustCompile("[0-9]+[.]?[0-9]*(s|ms)?") - reg.Longest() - if reg.FindString(value) == value && value != "" { + if Time.MatchString(value) { return true } values := []string{"initial", "inherit"} @@ -1995,9 +1928,7 @@ func TransitionDurationHandler(value string) bool { } func TransitionPropertyHandler(value string) bool { - reg := regexp.MustCompile("([a-zA-Z]+,[ ]?)*[a-zA-Z]+") - reg.Longest() - if reg.FindString(value) == value && value != "" { + if TransitionProp.MatchString(value) { return true } values := []string{"none", "all", "initial", "inherit"} @@ -2075,9 +2006,7 @@ func WritingModeHandler(value string) bool { } func ZIndexHandler(value string) bool { - reg := regexp.MustCompile(`[\-]?[0-9]+`) - reg.Longest() - if reg.FindString(value) == value && value != "" { + if ZIndex.MatchString(value) { return true } values := []string{"auto", "initial", "inherit"} diff --git a/vendor/github.com/microcosm-cc/bluemonday/helpers.go b/vendor/github.com/microcosm-cc/bluemonday/helpers.go index 4e31fb6fb..d4039492e 100644 --- a/vendor/github.com/microcosm-cc/bluemonday/helpers.go +++ b/vendor/github.com/microcosm-cc/bluemonday/helpers.go @@ -117,7 +117,7 @@ var ( // This is not exported as it's not useful by itself, and only has value // within the AllowDataURIImages func dataURIImagePrefix = regexp.MustCompile( - `^image/(gif|jpeg|png|webp);base64,`, + `^image/(gif|jpeg|png|svg\+xml|webp);base64,`, ) ) diff --git a/vendor/github.com/microcosm-cc/bluemonday/sanitize.go b/vendor/github.com/microcosm-cc/bluemonday/sanitize.go index 9bd91ab37..904ee82e1 100644 --- a/vendor/github.com/microcosm-cc/bluemonday/sanitize.go +++ b/vendor/github.com/microcosm-cc/bluemonday/sanitize.go @@ -322,9 +322,7 @@ func (p *Policy) sanitize(r io.Reader, w io.Writer) error { aps = aa } if len(token.Attr) != 0 { - token.Attr = escapeAttributes( - p.sanitizeAttrs(token.Data, token.Attr, aps), - ) + token.Attr = p.sanitizeAttrs(token.Data, token.Attr, aps) } if len(token.Attr) == 0 { @@ -434,7 +432,7 @@ func (p *Policy) sanitize(r io.Reader, w io.Writer) error { } if len(token.Attr) != 0 { - token.Attr = escapeAttributes(p.sanitizeAttrs(token.Data, token.Attr, aps)) + token.Attr = p.sanitizeAttrs(token.Data, token.Attr, aps) } if len(token.Attr) == 0 && !p.allowNoAttrs(token.Data) { @@ -565,11 +563,9 @@ attrsLoop: for _, ap := range apl { if ap.regexp != nil { if ap.regexp.MatchString(htmlAttr.Val) { - htmlAttr.Val = escapeAttribute(htmlAttr.Val) cleanAttrs = append(cleanAttrs, htmlAttr) } } else { - htmlAttr.Val = escapeAttribute(htmlAttr.Val) cleanAttrs = append(cleanAttrs, htmlAttr) } } @@ -1112,18 +1108,3 @@ func normaliseElementName(str string) string { `"`, ) } - -func escapeAttributes(attrs []html.Attribute) []html.Attribute { - escapedAttrs := []html.Attribute{} - for _, attr := range attrs { - attr.Val = escapeAttribute(attr.Val) - escapedAttrs = append(escapedAttrs, attr) - } - return escapedAttrs -} - -func escapeAttribute(val string) string { - val = strings.Replace(val, string([]rune{'\u00A0'}), ` `, -1) - val = strings.Replace(val, `"`, `"`, -1) - return val -} diff --git a/vendor/github.com/miekg/dns/client.go b/vendor/github.com/miekg/dns/client.go index 31bf5759d..9aa658530 100644 --- a/vendor/github.com/miekg/dns/client.go +++ b/vendor/github.com/miekg/dns/client.go @@ -24,7 +24,7 @@ func isPacketConn(c net.Conn) bool { } if ua, ok := c.LocalAddr().(*net.UnixAddr); ok { - return ua.Net == "unixgram" + return ua.Net == "unixgram" || ua.Net == "unixpacket" } return true @@ -280,7 +280,7 @@ func (co *Conn) ReadMsg() (*Msg, error) { } if t := m.IsTsig(); t != nil { // Need to work on the original message p, as that was used to calculate the tsig. - err = tsigVerifyProvider(p, co.tsigProvider(), co.tsigRequestMAC, false) + err = TsigVerifyWithProvider(p, co.tsigProvider(), co.tsigRequestMAC, false) } return m, err } @@ -358,7 +358,7 @@ func (co *Conn) WriteMsg(m *Msg) (err error) { var out []byte if t := m.IsTsig(); t != nil { // Set tsigRequestMAC for the next read, although only used in zone transfers. - out, co.tsigRequestMAC, err = tsigGenerateProvider(m, co.tsigProvider(), co.tsigRequestMAC, false) + out, co.tsigRequestMAC, err = TsigGenerateWithProvider(m, co.tsigProvider(), co.tsigRequestMAC, false) } else { out, err = m.Pack() } diff --git a/vendor/github.com/miekg/dns/defaults.go b/vendor/github.com/miekg/dns/defaults.go index d47b0b1f2..f2cdbf430 100644 --- a/vendor/github.com/miekg/dns/defaults.go +++ b/vendor/github.com/miekg/dns/defaults.go @@ -218,6 +218,11 @@ func IsDomainName(s string) (labels int, ok bool) { wasDot = false case '.': + if i == 0 && len(s) > 1 { + // leading dots are not legal except for the root zone + return labels, false + } + if wasDot { // two dots back to back is not legal return labels, false diff --git a/vendor/github.com/miekg/dns/msg.go b/vendor/github.com/miekg/dns/msg.go index 60a2e8c3d..89ebb64ab 100644 --- a/vendor/github.com/miekg/dns/msg.go +++ b/vendor/github.com/miekg/dns/msg.go @@ -265,6 +265,11 @@ loop: wasDot = false case '.': + if i == 0 && len(s) > 1 { + // leading dots are not legal except for the root zone + return len(msg), ErrRdata + } + if wasDot { // two dots back to back is not legal return len(msg), ErrRdata diff --git a/vendor/github.com/miekg/dns/msg_helpers.go b/vendor/github.com/miekg/dns/msg_helpers.go index b049028b7..ea2035cd2 100644 --- a/vendor/github.com/miekg/dns/msg_helpers.go +++ b/vendor/github.com/miekg/dns/msg_helpers.go @@ -476,7 +476,7 @@ func unpackDataNsec(msg []byte, off int) ([]uint16, int, error) { length, window, lastwindow := 0, 0, -1 for off < len(msg) { if off+2 > len(msg) { - return nsec, len(msg), &Error{err: "overflow unpacking nsecx"} + return nsec, len(msg), &Error{err: "overflow unpacking NSEC(3)"} } window = int(msg[off]) length = int(msg[off+1]) @@ -484,17 +484,17 @@ func unpackDataNsec(msg []byte, off int) ([]uint16, int, error) { if window <= lastwindow { // RFC 4034: Blocks are present in the NSEC RR RDATA in // increasing numerical order. - return nsec, len(msg), &Error{err: "out of order NSEC block"} + return nsec, len(msg), &Error{err: "out of order NSEC(3) block in type bitmap"} } if length == 0 { // RFC 4034: Blocks with no types present MUST NOT be included. - return nsec, len(msg), &Error{err: "empty NSEC block"} + return nsec, len(msg), &Error{err: "empty NSEC(3) block in type bitmap"} } if length > 32 { - return nsec, len(msg), &Error{err: "NSEC block too long"} + return nsec, len(msg), &Error{err: "NSEC(3) block too long in type bitmap"} } if off+length > len(msg) { - return nsec, len(msg), &Error{err: "overflowing NSEC block"} + return nsec, len(msg), &Error{err: "overflowing NSEC(3) block in type bitmap"} } // Walk the bytes in the window and extract the type bits diff --git a/vendor/github.com/miekg/dns/server.go b/vendor/github.com/miekg/dns/server.go index b962e6f35..4e5a9aa8a 100644 --- a/vendor/github.com/miekg/dns/server.go +++ b/vendor/github.com/miekg/dns/server.go @@ -646,7 +646,7 @@ func (srv *Server) serveDNS(m []byte, w *response) { w.tsigStatus = nil if w.tsigProvider != nil { if t := req.IsTsig(); t != nil { - w.tsigStatus = tsigVerifyProvider(m, w.tsigProvider, "", false) + w.tsigStatus = TsigVerifyWithProvider(m, w.tsigProvider, "", false) w.tsigTimersOnly = false w.tsigRequestMAC = t.MAC } @@ -728,7 +728,7 @@ func (w *response) WriteMsg(m *Msg) (err error) { var data []byte if w.tsigProvider != nil { // if no provider, dont check for the tsig (which is a longer check) if t := m.IsTsig(); t != nil { - data, w.tsigRequestMAC, err = tsigGenerateProvider(m, w.tsigProvider, w.tsigRequestMAC, w.tsigTimersOnly) + data, w.tsigRequestMAC, err = TsigGenerateWithProvider(m, w.tsigProvider, w.tsigRequestMAC, w.tsigTimersOnly) if err != nil { return err } diff --git a/vendor/github.com/miekg/dns/tsig.go b/vendor/github.com/miekg/dns/tsig.go index 8b37cc841..debfe2dd9 100644 --- a/vendor/github.com/miekg/dns/tsig.go +++ b/vendor/github.com/miekg/dns/tsig.go @@ -158,18 +158,17 @@ type timerWireFmt struct { } // TsigGenerate fills out the TSIG record attached to the message. -// The message should contain -// a "stub" TSIG RR with the algorithm, key name (owner name of the RR), -// time fudge (defaults to 300 seconds) and the current time -// The TSIG MAC is saved in that Tsig RR. -// When TsigGenerate is called for the first time requestMAC is set to the empty string and -// timersOnly is false. -// If something goes wrong an error is returned, otherwise it is nil. +// The message should contain a "stub" TSIG RR with the algorithm, key name +// (owner name of the RR), time fudge (defaults to 300 seconds) and the current +// time The TSIG MAC is saved in that Tsig RR. When TsigGenerate is called for +// the first time requestMAC should be set to the empty string and timersOnly to +// false. func TsigGenerate(m *Msg, secret, requestMAC string, timersOnly bool) ([]byte, string, error) { - return tsigGenerateProvider(m, tsigHMACProvider(secret), requestMAC, timersOnly) + return TsigGenerateWithProvider(m, tsigHMACProvider(secret), requestMAC, timersOnly) } -func tsigGenerateProvider(m *Msg, provider TsigProvider, requestMAC string, timersOnly bool) ([]byte, string, error) { +// TsigGenerateWithProvider is similar to TsigGenerate, but allows for a custom TsigProvider. +func TsigGenerateWithProvider(m *Msg, provider TsigProvider, requestMAC string, timersOnly bool) ([]byte, string, error) { if m.IsTsig() == nil { panic("dns: TSIG not last RR in additional") } @@ -216,14 +215,15 @@ func tsigGenerateProvider(m *Msg, provider TsigProvider, requestMAC string, time return mbuf, t.MAC, nil } -// TsigVerify verifies the TSIG on a message. -// If the signature does not validate err contains the -// error, otherwise it is nil. +// TsigVerify verifies the TSIG on a message. If the signature does not +// validate the returned error contains the cause. If the signature is OK, the +// error is nil. func TsigVerify(msg []byte, secret, requestMAC string, timersOnly bool) error { return tsigVerify(msg, tsigHMACProvider(secret), requestMAC, timersOnly, uint64(time.Now().Unix())) } -func tsigVerifyProvider(msg []byte, provider TsigProvider, requestMAC string, timersOnly bool) error { +// TsigVerifyWithProvider is similar to TsigVerify, but allows for a custom TsigProvider. +func TsigVerifyWithProvider(msg []byte, provider TsigProvider, requestMAC string, timersOnly bool) error { return tsigVerify(msg, provider, requestMAC, timersOnly, uint64(time.Now().Unix())) } diff --git a/vendor/github.com/miekg/dns/version.go b/vendor/github.com/miekg/dns/version.go index 971a27199..b1a872bd5 100644 --- a/vendor/github.com/miekg/dns/version.go +++ b/vendor/github.com/miekg/dns/version.go @@ -3,7 +3,7 @@ package dns import "fmt" // Version is current version of this library. -var Version = v{1, 1, 49} +var Version = v{1, 1, 50} // v holds the version of this library. type v struct { diff --git a/vendor/github.com/miekg/dns/xfr.go b/vendor/github.com/miekg/dns/xfr.go index f0dcf61d4..1917e91c8 100644 --- a/vendor/github.com/miekg/dns/xfr.go +++ b/vendor/github.com/miekg/dns/xfr.go @@ -237,7 +237,7 @@ func (t *Transfer) ReadMsg() (*Msg, error) { } if ts, tp := m.IsTsig(), t.tsigProvider(); ts != nil && tp != nil { // Need to work on the original message p, as that was used to calculate the tsig. - err = tsigVerifyProvider(p, tp, t.tsigRequestMAC, t.tsigTimersOnly) + err = TsigVerifyWithProvider(p, tp, t.tsigRequestMAC, t.tsigTimersOnly) t.tsigRequestMAC = ts.MAC } return m, err @@ -247,7 +247,7 @@ func (t *Transfer) ReadMsg() (*Msg, error) { func (t *Transfer) WriteMsg(m *Msg) (err error) { var out []byte if ts, tp := m.IsTsig(), t.tsigProvider(); ts != nil && tp != nil { - out, t.tsigRequestMAC, err = tsigGenerateProvider(m, tp, t.tsigRequestMAC, t.tsigTimersOnly) + out, t.tsigRequestMAC, err = TsigGenerateWithProvider(m, tp, t.tsigRequestMAC, t.tsigTimersOnly) } else { out, err = m.Pack() } diff --git a/vendor/github.com/minio/md5-simd/LICENSE.Golang b/vendor/github.com/minio/md5-simd/LICENSE.Golang new file mode 100644 index 000000000..6a66aea5e --- /dev/null +++ b/vendor/github.com/minio/md5-simd/LICENSE.Golang @@ -0,0 +1,27 @@ +Copyright (c) 2009 The Go Authors. All rights reserved. + +Redistribution and use in source and binary forms, with or without +modification, are permitted provided that the following conditions are +met: + + * Redistributions of source code must retain the above copyright +notice, this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the following disclaimer +in the documentation and/or other materials provided with the +distribution. + * Neither the name of Google Inc. nor the names of its +contributors may be used to endorse or promote products derived from +this software without specific prior written permission. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/github.com/minio/md5-simd/README.md b/vendor/github.com/minio/md5-simd/README.md index 374214d1a..fa6fce1a4 100644 --- a/vendor/github.com/minio/md5-simd/README.md +++ b/vendor/github.com/minio/md5-simd/README.md @@ -116,6 +116,8 @@ BenchmarkParallel/8MB-4 2182.48 17252.88 7.91x These measurements were performed on AWS EC2 instance of type `c5.xlarge` equipped with a Xeon Platinum 8124M CPU at 3.0 GHz. +If only one or two inputs are available the scalar calculation method will be used for the +optimal speed in these cases. ## Operation diff --git a/vendor/github.com/minio/md5-simd/block-generic.go b/vendor/github.com/minio/md5-simd/block-generic.go deleted file mode 100644 index eb333b93f..000000000 --- a/vendor/github.com/minio/md5-simd/block-generic.go +++ /dev/null @@ -1,132 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Code generated by go run gen.go -output md5block.go; DO NOT EDIT. - -package md5simd - -import ( - "encoding/binary" - "math/bits" -) - -type digest struct { - s [4]uint32 - x [BlockSize]byte - nx int - len uint64 -} - -func blockGeneric(dig *digest, p []byte) { - // load state - a, b, c, d := dig.s[0], dig.s[1], dig.s[2], dig.s[3] - - for i := 0; i <= len(p)-BlockSize; i += BlockSize { - // eliminate bounds checks on p - q := p[i:] - q = q[:BlockSize:BlockSize] - - // save current state - aa, bb, cc, dd := a, b, c, d - - // load input block - x0 := binary.LittleEndian.Uint32(q[4*0x0:]) - x1 := binary.LittleEndian.Uint32(q[4*0x1:]) - x2 := binary.LittleEndian.Uint32(q[4*0x2:]) - x3 := binary.LittleEndian.Uint32(q[4*0x3:]) - x4 := binary.LittleEndian.Uint32(q[4*0x4:]) - x5 := binary.LittleEndian.Uint32(q[4*0x5:]) - x6 := binary.LittleEndian.Uint32(q[4*0x6:]) - x7 := binary.LittleEndian.Uint32(q[4*0x7:]) - x8 := binary.LittleEndian.Uint32(q[4*0x8:]) - x9 := binary.LittleEndian.Uint32(q[4*0x9:]) - xa := binary.LittleEndian.Uint32(q[4*0xa:]) - xb := binary.LittleEndian.Uint32(q[4*0xb:]) - xc := binary.LittleEndian.Uint32(q[4*0xc:]) - xd := binary.LittleEndian.Uint32(q[4*0xd:]) - xe := binary.LittleEndian.Uint32(q[4*0xe:]) - xf := binary.LittleEndian.Uint32(q[4*0xf:]) - - // round 1 - a = b + bits.RotateLeft32((((c^d)&b)^d)+a+x0+0xd76aa478, 7) - d = a + bits.RotateLeft32((((b^c)&a)^c)+d+x1+0xe8c7b756, 12) - c = d + bits.RotateLeft32((((a^b)&d)^b)+c+x2+0x242070db, 17) - b = c + bits.RotateLeft32((((d^a)&c)^a)+b+x3+0xc1bdceee, 22) - a = b + bits.RotateLeft32((((c^d)&b)^d)+a+x4+0xf57c0faf, 7) - d = a + bits.RotateLeft32((((b^c)&a)^c)+d+x5+0x4787c62a, 12) - c = d + bits.RotateLeft32((((a^b)&d)^b)+c+x6+0xa8304613, 17) - b = c + bits.RotateLeft32((((d^a)&c)^a)+b+x7+0xfd469501, 22) - a = b + bits.RotateLeft32((((c^d)&b)^d)+a+x8+0x698098d8, 7) - d = a + bits.RotateLeft32((((b^c)&a)^c)+d+x9+0x8b44f7af, 12) - c = d + bits.RotateLeft32((((a^b)&d)^b)+c+xa+0xffff5bb1, 17) - b = c + bits.RotateLeft32((((d^a)&c)^a)+b+xb+0x895cd7be, 22) - a = b + bits.RotateLeft32((((c^d)&b)^d)+a+xc+0x6b901122, 7) - d = a + bits.RotateLeft32((((b^c)&a)^c)+d+xd+0xfd987193, 12) - c = d + bits.RotateLeft32((((a^b)&d)^b)+c+xe+0xa679438e, 17) - b = c + bits.RotateLeft32((((d^a)&c)^a)+b+xf+0x49b40821, 22) - - // round 2 - a = b + bits.RotateLeft32((((b^c)&d)^c)+a+x1+0xf61e2562, 5) - d = a + bits.RotateLeft32((((a^b)&c)^b)+d+x6+0xc040b340, 9) - c = d + bits.RotateLeft32((((d^a)&b)^a)+c+xb+0x265e5a51, 14) - b = c + bits.RotateLeft32((((c^d)&a)^d)+b+x0+0xe9b6c7aa, 20) - a = b + bits.RotateLeft32((((b^c)&d)^c)+a+x5+0xd62f105d, 5) - d = a + bits.RotateLeft32((((a^b)&c)^b)+d+xa+0x02441453, 9) - c = d + bits.RotateLeft32((((d^a)&b)^a)+c+xf+0xd8a1e681, 14) - b = c + bits.RotateLeft32((((c^d)&a)^d)+b+x4+0xe7d3fbc8, 20) - a = b + bits.RotateLeft32((((b^c)&d)^c)+a+x9+0x21e1cde6, 5) - d = a + bits.RotateLeft32((((a^b)&c)^b)+d+xe+0xc33707d6, 9) - c = d + bits.RotateLeft32((((d^a)&b)^a)+c+x3+0xf4d50d87, 14) - b = c + bits.RotateLeft32((((c^d)&a)^d)+b+x8+0x455a14ed, 20) - a = b + bits.RotateLeft32((((b^c)&d)^c)+a+xd+0xa9e3e905, 5) - d = a + bits.RotateLeft32((((a^b)&c)^b)+d+x2+0xfcefa3f8, 9) - c = d + bits.RotateLeft32((((d^a)&b)^a)+c+x7+0x676f02d9, 14) - b = c + bits.RotateLeft32((((c^d)&a)^d)+b+xc+0x8d2a4c8a, 20) - - // round 3 - a = b + bits.RotateLeft32((b^c^d)+a+x5+0xfffa3942, 4) - d = a + bits.RotateLeft32((a^b^c)+d+x8+0x8771f681, 11) - c = d + bits.RotateLeft32((d^a^b)+c+xb+0x6d9d6122, 16) - b = c + bits.RotateLeft32((c^d^a)+b+xe+0xfde5380c, 23) - a = b + bits.RotateLeft32((b^c^d)+a+x1+0xa4beea44, 4) - d = a + bits.RotateLeft32((a^b^c)+d+x4+0x4bdecfa9, 11) - c = d + bits.RotateLeft32((d^a^b)+c+x7+0xf6bb4b60, 16) - b = c + bits.RotateLeft32((c^d^a)+b+xa+0xbebfbc70, 23) - a = b + bits.RotateLeft32((b^c^d)+a+xd+0x289b7ec6, 4) - d = a + bits.RotateLeft32((a^b^c)+d+x0+0xeaa127fa, 11) - c = d + bits.RotateLeft32((d^a^b)+c+x3+0xd4ef3085, 16) - b = c + bits.RotateLeft32((c^d^a)+b+x6+0x04881d05, 23) - a = b + bits.RotateLeft32((b^c^d)+a+x9+0xd9d4d039, 4) - d = a + bits.RotateLeft32((a^b^c)+d+xc+0xe6db99e5, 11) - c = d + bits.RotateLeft32((d^a^b)+c+xf+0x1fa27cf8, 16) - b = c + bits.RotateLeft32((c^d^a)+b+x2+0xc4ac5665, 23) - - // round 4 - a = b + bits.RotateLeft32((c^(b|^d))+a+x0+0xf4292244, 6) - d = a + bits.RotateLeft32((b^(a|^c))+d+x7+0x432aff97, 10) - c = d + bits.RotateLeft32((a^(d|^b))+c+xe+0xab9423a7, 15) - b = c + bits.RotateLeft32((d^(c|^a))+b+x5+0xfc93a039, 21) - a = b + bits.RotateLeft32((c^(b|^d))+a+xc+0x655b59c3, 6) - d = a + bits.RotateLeft32((b^(a|^c))+d+x3+0x8f0ccc92, 10) - c = d + bits.RotateLeft32((a^(d|^b))+c+xa+0xffeff47d, 15) - b = c + bits.RotateLeft32((d^(c|^a))+b+x1+0x85845dd1, 21) - a = b + bits.RotateLeft32((c^(b|^d))+a+x8+0x6fa87e4f, 6) - d = a + bits.RotateLeft32((b^(a|^c))+d+xf+0xfe2ce6e0, 10) - c = d + bits.RotateLeft32((a^(d|^b))+c+x6+0xa3014314, 15) - b = c + bits.RotateLeft32((d^(c|^a))+b+xd+0x4e0811a1, 21) - a = b + bits.RotateLeft32((c^(b|^d))+a+x4+0xf7537e82, 6) - d = a + bits.RotateLeft32((b^(a|^c))+d+xb+0xbd3af235, 10) - c = d + bits.RotateLeft32((a^(d|^b))+c+x2+0x2ad7d2bb, 15) - b = c + bits.RotateLeft32((d^(c|^a))+b+x9+0xeb86d391, 21) - - // add saved state - a += aa - b += bb - c += cc - d += dd - } - - // save state - dig.s[0], dig.s[1], dig.s[2], dig.s[3] = a, b, c, d -} diff --git a/vendor/github.com/minio/md5-simd/block16_amd64.s b/vendor/github.com/minio/md5-simd/block16_amd64.s index d32c12200..be0a43a3b 100644 --- a/vendor/github.com/minio/md5-simd/block16_amd64.s +++ b/vendor/github.com/minio/md5-simd/block16_amd64.s @@ -2,70 +2,72 @@ // Use of this source code is governed by a license that can be // found in the LICENSE file. +//+build !noasm,!appengine,gc + // This is the AVX512 implementation of the MD5 block function (16-way parallel) #define prep(index) \ - KMOVQ kmask, ktmp \ + KMOVQ kmask, ktmp \ VPGATHERDD index*4(base)(ptrs*1), ktmp, mem #define ROUND1(a, b, c, d, index, const, shift) \ - VXORPS c, tmp, tmp \ - VPADDD 64*const(consts), a, a \ - VPADDD mem, a, a \ - VPTERNLOGD $0x6C, b, d, tmp \ - prep(index) \ - VPADDD tmp, a, a \ - VPROLD $shift, a, a \ - VMOVAPD c, tmp \ - VPADDD b, a, a + VPXORQ c, tmp, tmp \ + VPADDD 64*const(consts), a, a \ + VPADDD mem, a, a \ + VPTERNLOGD $0x6C, b, d, tmp \ + prep(index) \ + VPADDD tmp, a, a \ + VPROLD $shift, a, a \ + VMOVAPD c, tmp \ + VPADDD b, a, a #define ROUND1noload(a, b, c, d, const, shift) \ - VXORPS c, tmp, tmp \ - VPADDD 64*const(consts), a, a \ - VPADDD mem, a, a \ - VPTERNLOGD $0x6C, b, d, tmp \ - VPADDD tmp, a, a \ - VPROLD $shift, a, a \ - VMOVAPD c, tmp \ - VPADDD b, a, a + VPXORQ c, tmp, tmp \ + VPADDD 64*const(consts), a, a \ + VPADDD mem, a, a \ + VPTERNLOGD $0x6C, b, d, tmp \ + VPADDD tmp, a, a \ + VPROLD $shift, a, a \ + VMOVAPD c, tmp \ + VPADDD b, a, a #define ROUND2(a, b, c, d, zreg, const, shift) \ - VPADDD 64*const(consts), a, a \ - VPADDD zreg, a, a \ - VANDNPS c, tmp, tmp \ - VPTERNLOGD $0xEC, b, tmp, tmp2 \ - VMOVAPD c, tmp \ - VPADDD tmp2, a, a \ - VMOVAPD c, tmp2 \ - VPROLD $shift, a, a \ - VPADDD b, a, a + VPADDD 64*const(consts), a, a \ + VPADDD zreg, a, a \ + VANDNPD c, tmp, tmp \ + VPTERNLOGD $0xEC, b, tmp, tmp2 \ + VMOVAPD c, tmp \ + VPADDD tmp2, a, a \ + VMOVAPD c, tmp2 \ + VPROLD $shift, a, a \ + VPADDD b, a, a #define ROUND3(a, b, c, d, zreg, const, shift) \ - VPADDD 64*const(consts), a, a \ - VPADDD zreg, a, a \ - VPTERNLOGD $0x96, b, d, tmp \ - VPADDD tmp, a, a \ - VPROLD $shift, a, a \ - VMOVAPD b, tmp \ - VPADDD b, a, a + VPADDD 64*const(consts), a, a \ + VPADDD zreg, a, a \ + VPTERNLOGD $0x96, b, d, tmp \ + VPADDD tmp, a, a \ + VPROLD $shift, a, a \ + VMOVAPD b, tmp \ + VPADDD b, a, a #define ROUND4(a, b, c, d, zreg, const, shift) \ - VPADDD 64*const(consts), a, a \ - VPADDD zreg, a, a \ - VPTERNLOGD $0x36, b, c, tmp \ - VPADDD tmp, a, a \ - VPROLD $shift, a, a \ - VXORPS c, ones, tmp \ - VPADDD b, a, a - -TEXT ·block16(SB),4,$0-40 - - MOVQ state+0(FP), BX - MOVQ base+8(FP), SI - MOVQ ptrs+16(FP), AX - KMOVQ mask+24(FP), K1 - MOVQ n+32(FP), DX - MOVQ ·avx512md5consts+0(SB), DI + VPADDD 64*const(consts), a, a \ + VPADDD zreg, a, a \ + VPTERNLOGD $0x36, b, c, tmp \ + VPADDD tmp, a, a \ + VPROLD $shift, a, a \ + VPXORQ c, ones, tmp \ + VPADDD b, a, a + +TEXT ·block16(SB), 4, $0-40 + + MOVQ state+0(FP), BX + MOVQ base+8(FP), SI + MOVQ ptrs+16(FP), AX + KMOVQ mask+24(FP), K1 + MOVQ n+32(FP), DX + MOVQ ·avx512md5consts+0(SB), DI #define a Z0 #define b Z1 @@ -90,7 +92,6 @@ TEXT ·block16(SB),4,$0-40 // Registers Z16 through to Z31 are used for caching purposes // ---------------------------------------------------------- - #define dig BX #define count DX #define base SI @@ -105,7 +106,7 @@ TEXT ·block16(SB),4,$0-40 // load source pointers VMOVUPD 0x00(AX), ptrs - MOVQ $-1, AX + MOVQ $-1, AX VPBROADCASTQ AX, ones loop: @@ -190,7 +191,7 @@ loop: ROUND3(c,d,a,b, Z31,0x2e,16) ROUND3(b,c,d,a, Z18,0x2f,23) - VXORPS d, ones, tmp + VPXORQ d, ones, tmp ROUND4(a,b,c,d, Z16,0x30, 6) ROUND4(d,a,b,c, Z23,0x31,10) diff --git a/vendor/github.com/minio/md5-simd/block8_amd64.s b/vendor/github.com/minio/md5-simd/block8_amd64.s index f5f1d9cab..f57db17aa 100644 --- a/vendor/github.com/minio/md5-simd/block8_amd64.s +++ b/vendor/github.com/minio/md5-simd/block8_amd64.s @@ -1,3 +1,5 @@ +//+build !noasm,!appengine,gc + // Copyright (c) 2018 Igneous Systems // MIT License // @@ -70,7 +72,7 @@ TEXT ·block8(SB), 4, $0-40 #define consts DI #define prepmask \ - VXORPS mask, mask, mask \ + VPXOR mask, mask, mask \ VPCMPGTD mask, off, mask #define prep(index) \ @@ -86,14 +88,14 @@ TEXT ·block8(SB), 4, $0-40 #define roll(shift, a) \ VPSLLD $shift, a, rtmp1 \ VPSRLD $32-shift, a, a \ - VORPS rtmp1, a, a + VPOR rtmp1, a, a #define ROUND1(a, b, c, d, index, const, shift) \ - VXORPS c, tmp, tmp \ + VPXOR c, tmp, tmp \ VPADDD 32*const(consts), a, a \ VPADDD mem, a, a \ - VANDPS b, tmp, tmp \ - VXORPS d, tmp, tmp \ + VPAND b, tmp, tmp \ + VPXOR d, tmp, tmp \ prep(index) \ VPADDD tmp, a, a \ roll(shift,a) \ @@ -101,11 +103,11 @@ TEXT ·block8(SB), 4, $0-40 VPADDD b, a, a #define ROUND1load(a, b, c, d, index, const, shift) \ - VXORPS c, tmp, tmp \ + VXORPD c, tmp, tmp \ VPADDD 32*const(consts), a, a \ VPADDD mem, a, a \ - VANDPS b, tmp, tmp \ - VXORPS d, tmp, tmp \ + VPAND b, tmp, tmp \ + VPXOR d, tmp, tmp \ load(index) \ VPADDD tmp, a, a \ roll(shift,a) \ @@ -115,10 +117,10 @@ TEXT ·block8(SB), 4, $0-40 #define ROUND2(a, b, c, d, index, const, shift) \ VPADDD 32*const(consts), a, a \ VPADDD mem, a, a \ - VANDPS b, tmp2, tmp2 \ - VANDNPS c, tmp, tmp \ + VPAND b, tmp2, tmp2 \ + VANDNPD c, tmp, tmp \ load(index) \ - VORPS tmp, tmp2, tmp2 \ + VPOR tmp, tmp2, tmp2 \ VMOVAPD c, tmp \ VPADDD tmp2, a, a \ VMOVAPD c, tmp2 \ @@ -129,8 +131,8 @@ TEXT ·block8(SB), 4, $0-40 VPADDD 32*const(consts), a, a \ VPADDD mem, a, a \ load(index) \ - VXORPS d, tmp, tmp \ - VXORPS b, tmp, tmp \ + VPXOR d, tmp, tmp \ + VPXOR b, tmp, tmp \ VPADDD tmp, a, a \ roll(shift,a) \ VMOVAPD b, tmp \ @@ -139,12 +141,12 @@ TEXT ·block8(SB), 4, $0-40 #define ROUND4(a, b, c, d, index, const, shift) \ VPADDD 32*const(consts), a, a \ VPADDD mem, a, a \ - VORPS b, tmp, tmp \ - VXORPS c, tmp, tmp \ + VPOR b, tmp, tmp \ + VPXOR c, tmp, tmp \ VPADDD tmp, a, a \ load(index) \ roll(shift,a) \ - VXORPS c, ones, tmp \ + VPXOR c, ones, tmp \ VPADDD b, a, a // load digest into state registers @@ -242,7 +244,7 @@ loop: ROUND3(b,c,d,a, 0,0x2f,23) load(0) - VXORPS d, ones, tmp + VPXOR d, ones, tmp ROUND4(a,b,c,d, 7,0x30, 6) ROUND4(d,a,b,c,14,0x31,10) diff --git a/vendor/github.com/minio/md5-simd/block_amd64.go b/vendor/github.com/minio/md5-simd/block_amd64.go index 27d6ce00e..16edda268 100644 --- a/vendor/github.com/minio/md5-simd/block_amd64.go +++ b/vendor/github.com/minio/md5-simd/block_amd64.go @@ -9,14 +9,18 @@ package md5simd import ( "fmt" "math" - "sync" "unsafe" - "github.com/klauspost/cpuid" + "github.com/klauspost/cpuid/v2" ) var hasAVX512 bool +func init() { + // VANDNPD requires AVX512DQ. Technically it could be VPTERNLOGQ which is AVX512F. + hasAVX512 = cpuid.CPU.Supports(cpuid.AVX512F, cpuid.AVX512DQ) +} + //go:noescape func block8(state *uint32, base uintptr, bufs *int32, cache *byte, n int) @@ -82,45 +86,52 @@ var avx512md5consts = func(c []uint32) []uint32 { return inf }(md5consts[:]) -func init() { - hasAVX512 = cpuid.CPU.AVX512F() -} - // Interface function to assembly code func (s *md5Server) blockMd5_x16(d *digest16, input [16][]byte, half bool) { if hasAVX512 { blockMd5_avx512(d, input, s.allBufs, &s.maskRounds16) - } else { - d8a, d8b := digest8{}, digest8{} - for i := range d8a.v0 { - j := i + 8 - d8a.v0[i], d8a.v1[i], d8a.v2[i], d8a.v3[i] = d.v0[i], d.v1[i], d.v2[i], d.v3[i] - if !half { - d8b.v0[i], d8b.v1[i], d8b.v2[i], d8b.v3[i] = d.v0[j], d.v1[j], d.v2[j], d.v3[j] - } - } + return + } + + // Preparing data using copy is slower since copies aren't inlined. - i8 := [2][8][]byte{} - for i := range i8[0] { - i8[0][i], i8[1][i] = input[i], input[8+i] + // Calculate on this goroutine + if half { + for i := range s.i8[0][:] { + s.i8[0][i] = input[i] } - if half { - blockMd5_avx2(&d8a, i8[0], s.allBufs, &s.maskRounds8a) - } else { - wg := sync.WaitGroup{} - wg.Add(2) - go func() { blockMd5_avx2(&d8a, i8[0], s.allBufs, &s.maskRounds8a); wg.Done() }() - go func() { blockMd5_avx2(&d8b, i8[1], s.allBufs, &s.maskRounds8b); wg.Done() }() - wg.Wait() + for i := range s.d8a.v0[:] { + s.d8a.v0[i], s.d8a.v1[i], s.d8a.v2[i], s.d8a.v3[i] = d.v0[i], d.v1[i], d.v2[i], d.v3[i] } - - for i := range d8a.v0 { - j := i + 8 - d.v0[i], d.v1[i], d.v2[i], d.v3[i] = d8a.v0[i], d8a.v1[i], d8a.v2[i], d8a.v3[i] - if !half { - d.v0[j], d.v1[j], d.v2[j], d.v3[j] = d8b.v0[i], d8b.v1[i], d8b.v2[i], d8b.v3[i] - } + blockMd5_avx2(&s.d8a, s.i8[0], s.allBufs, &s.maskRounds8a) + for i := range s.d8a.v0[:] { + d.v0[i], d.v1[i], d.v2[i], d.v3[i] = s.d8a.v0[i], s.d8a.v1[i], s.d8a.v2[i], s.d8a.v3[i] } + return + } + + for i := range s.i8[0][:] { + s.i8[0][i], s.i8[1][i] = input[i], input[8+i] + } + + for i := range s.d8a.v0[:] { + j := (i + 8) & 15 + s.d8a.v0[i], s.d8a.v1[i], s.d8a.v2[i], s.d8a.v3[i] = d.v0[i], d.v1[i], d.v2[i], d.v3[i] + s.d8b.v0[i], s.d8b.v1[i], s.d8b.v2[i], s.d8b.v3[i] = d.v0[j], d.v1[j], d.v2[j], d.v3[j] + } + + // Benchmarks appears to be slightly faster when spinning up 2 goroutines instead + // of using the current for one of the blocks. + s.wg.Add(2) + go func() { blockMd5_avx2(&s.d8a, s.i8[0], s.allBufs, &s.maskRounds8a); s.wg.Done() }() + go func() { blockMd5_avx2(&s.d8b, s.i8[1], s.allBufs, &s.maskRounds8b); s.wg.Done() }() + s.wg.Wait() + for i := range s.d8a.v0[:] { + d.v0[i], d.v1[i], d.v2[i], d.v3[i] = s.d8a.v0[i], s.d8a.v1[i], s.d8a.v2[i], s.d8a.v3[i] + } + for i := range s.d8b.v0[:] { + j := (i + 8) & 15 + d.v0[j], d.v1[j], d.v2[j], d.v3[j] = s.d8b.v0[i], s.d8b.v1[i], s.d8b.v2[i], s.d8b.v3[i] } } diff --git a/vendor/github.com/minio/md5-simd/md5-digest_amd64.go b/vendor/github.com/minio/md5-simd/md5-digest_amd64.go index fe10c7531..5ea23a499 100644 --- a/vendor/github.com/minio/md5-simd/md5-digest_amd64.go +++ b/vendor/github.com/minio/md5-simd/md5-digest_amd64.go @@ -10,6 +10,7 @@ import ( "encoding/binary" "errors" "fmt" + "sync" "sync/atomic" ) @@ -121,6 +122,14 @@ func (d *md5Digest) Close() { } } +var sumChPool sync.Pool + +func init() { + sumChPool.New = func() interface{} { + return make(chan sumResult, 1) + } +} + // Sum - Return MD5 sum in bytes func (d *md5Digest) Sum(in []byte) (result []byte) { if d.blocksCh == nil { @@ -148,10 +157,11 @@ func (d *md5Digest) Sum(in []byte) (result []byte) { if len(trail)%BlockSize != 0 { panic(fmt.Errorf("internal error: sum block was not aligned. len=%d, nx=%d", len(trail), d.nx)) } - sumCh := make(chan sumResult, 1) + sumCh := sumChPool.Get().(chan sumResult) d.sendBlock(blockInput{uid: d.uid, msg: trail, sumCh: sumCh}, true) sum := <-sumCh + sumChPool.Put(sumCh) return append(in, sum.digest[:]...) } diff --git a/vendor/github.com/minio/md5-simd/md5-server_amd64.go b/vendor/github.com/minio/md5-simd/md5-server_amd64.go index 461059537..94f741c54 100644 --- a/vendor/github.com/minio/md5-simd/md5-server_amd64.go +++ b/vendor/github.com/minio/md5-simd/md5-server_amd64.go @@ -10,8 +10,9 @@ import ( "encoding/binary" "fmt" "runtime" + "sync" - "github.com/klauspost/cpuid" + "github.com/klauspost/cpuid/v2" ) // MD5 initialization constants @@ -23,6 +24,9 @@ const ( init1 = 0xefcdab89 init2 = 0x98badcfe init3 = 0x10325476 + + // Use scalar routine when below this many lanes + useScalarBelow = 3 ) // md5ServerUID - Does not start at 0 but next multiple of 16 so as to be able to @@ -56,11 +60,15 @@ type md5Server struct { maskRounds8b [8]maskRounds // Pre-allocated static array for max 8 rounds (2nd AVX2 core) allBufs []byte // Preallocated buffer. buffers chan []byte // Preallocated buffers, sliced from allBufs. + + i8 [2][8][]byte // avx2 temporary vars + d8a, d8b digest8 + wg sync.WaitGroup } // NewServer - Create new object for parallel processing handling func NewServer() Server { - if !cpuid.CPU.AVX2() { + if !cpuid.CPU.Supports(cpuid.AVX2) { return &fallbackServer{} } md5srv := &md5Server{} @@ -152,7 +160,7 @@ func (s *md5Server) process(newClients chan newClient) { sum := sumResult{} // Add end block to current digest. - blockGeneric(&dig, block.msg) + blockScalar(&dig.s, block.msg) binary.LittleEndian.PutUint32(sum.digest[0:], dig.s[0]) binary.LittleEndian.PutUint32(sum.digest[4:], dig.s[1]) @@ -262,6 +270,88 @@ func (s *md5Server) Close() { // Invoke assembly and send results back func (s *md5Server) blocks(lanes []blockInput) { + if len(lanes) < useScalarBelow { + // Use scalar routine when below this many lanes + switch len(lanes) { + case 0: + case 1: + lane := lanes[0] + var d digest + a, ok := s.digests[lane.uid] + if ok { + d.s[0] = binary.LittleEndian.Uint32(a[0:4]) + d.s[1] = binary.LittleEndian.Uint32(a[4:8]) + d.s[2] = binary.LittleEndian.Uint32(a[8:12]) + d.s[3] = binary.LittleEndian.Uint32(a[12:16]) + } else { + d.s[0] = init0 + d.s[1] = init1 + d.s[2] = init2 + d.s[3] = init3 + } + if len(lane.msg) > 0 { + // Update... + blockScalar(&d.s, lane.msg) + } + dig := [Size]byte{} + binary.LittleEndian.PutUint32(dig[0:], d.s[0]) + binary.LittleEndian.PutUint32(dig[4:], d.s[1]) + binary.LittleEndian.PutUint32(dig[8:], d.s[2]) + binary.LittleEndian.PutUint32(dig[12:], d.s[3]) + s.digests[lane.uid] = dig + + if lane.msg != nil { + s.buffers <- lane.msg + } + lanes[0] = blockInput{} + + default: + s.wg.Add(len(lanes)) + var results [useScalarBelow]digest + for i := range lanes { + lane := lanes[i] + go func(i int) { + var d digest + defer s.wg.Done() + a, ok := s.digests[lane.uid] + if ok { + d.s[0] = binary.LittleEndian.Uint32(a[0:4]) + d.s[1] = binary.LittleEndian.Uint32(a[4:8]) + d.s[2] = binary.LittleEndian.Uint32(a[8:12]) + d.s[3] = binary.LittleEndian.Uint32(a[12:16]) + } else { + d.s[0] = init0 + d.s[1] = init1 + d.s[2] = init2 + d.s[3] = init3 + } + if len(lane.msg) == 0 { + results[i] = d + return + } + // Update... + blockScalar(&d.s, lane.msg) + results[i] = d + }(i) + } + s.wg.Wait() + for i, lane := range lanes { + dig := [Size]byte{} + binary.LittleEndian.PutUint32(dig[0:], results[i].s[0]) + binary.LittleEndian.PutUint32(dig[4:], results[i].s[1]) + binary.LittleEndian.PutUint32(dig[8:], results[i].s[2]) + binary.LittleEndian.PutUint32(dig[12:], results[i].s[3]) + s.digests[lane.uid] = dig + + if lane.msg != nil { + s.buffers <- lane.msg + } + lanes[i] = blockInput{} + } + } + return + } + inputs := [16][]byte{} for i := range lanes { inputs[i] = lanes[i].msg diff --git a/vendor/github.com/minio/md5-simd/md5-util_amd64.go b/vendor/github.com/minio/md5-simd/md5-util_amd64.go index 32bbae4a0..73981b0eb 100644 --- a/vendor/github.com/minio/md5-simd/md5-util_amd64.go +++ b/vendor/github.com/minio/md5-simd/md5-util_amd64.go @@ -1,19 +1,21 @@ +//+build !noasm,!appengine,gc + // Copyright (c) 2020 MinIO Inc. All rights reserved. // Use of this source code is governed by a license that can be // found in the LICENSE file. package md5simd -import ( - "sort" -) - // Helper struct for sorting blocks based on length type lane struct { len uint pos uint } +type digest struct { + s [4]uint32 +} + // Helper struct for generating number of rounds in combination with mask for valid lanes type maskRounds struct { mask uint64 @@ -23,15 +25,22 @@ type maskRounds struct { func generateMaskAndRounds8(input [8][]byte, mr *[8]maskRounds) (rounds int) { // Sort on blocks length small to large var sorted [8]lane - for c, inpt := range input { + for c, inpt := range input[:] { sorted[c] = lane{uint(len(inpt)), uint(c)} + for i := c - 1; i >= 0; i-- { + // swap so largest is at the end... + if sorted[i].len > sorted[i+1].len { + sorted[i], sorted[i+1] = sorted[i+1], sorted[i] + continue + } + break + } } - sort.Slice(sorted[:], func(i, j int) bool { return sorted[i].len < sorted[j].len }) // Create mask array including 'rounds' (of processing blocks of 64 bytes) between masks m, round := uint64(0xff), uint64(0) - for _, s := range sorted { + for _, s := range sorted[:] { if s.len > 0 { if uint64(s.len)>>6 > round { mr[rounds] = maskRounds{m, (uint64(s.len) >> 6) - round} @@ -45,18 +54,24 @@ func generateMaskAndRounds8(input [8][]byte, mr *[8]maskRounds) (rounds int) { } func generateMaskAndRounds16(input [16][]byte, mr *[16]maskRounds) (rounds int) { - // Sort on blocks length small to large var sorted [16]lane - for c, inpt := range input { + for c, inpt := range input[:] { sorted[c] = lane{uint(len(inpt)), uint(c)} + for i := c - 1; i >= 0; i-- { + // swap so largest is at the end... + if sorted[i].len > sorted[i+1].len { + sorted[i], sorted[i+1] = sorted[i+1], sorted[i] + continue + } + break + } } - sort.Slice(sorted[:], func(i, j int) bool { return sorted[i].len < sorted[j].len }) // Create mask array including 'rounds' (of processing blocks of 64 bytes) between masks m, round := uint64(0xffff), uint64(0) - for _, s := range sorted { + for _, s := range sorted[:] { if s.len > 0 { if uint64(s.len)>>6 > round { mr[rounds] = maskRounds{m, (uint64(s.len) >> 6) - round} diff --git a/vendor/github.com/minio/md5-simd/md5.go b/vendor/github.com/minio/md5-simd/md5.go index 4f56b79d0..11b0cb962 100644 --- a/vendor/github.com/minio/md5-simd/md5.go +++ b/vendor/github.com/minio/md5-simd/md5.go @@ -27,6 +27,12 @@ type Hasher interface { Close() } +// StdlibHasher returns a Hasher that uses the stdlib for hashing. +// Used hashers are stored in a pool for fast reuse. +func StdlibHasher() Hasher { + return &md5Wrapper{Hash: md5Pool.New().(hash.Hash)} +} + // md5Wrapper is a wrapper around the builtin hasher. type md5Wrapper struct { hash.Hash diff --git a/vendor/github.com/minio/md5-simd/md5block_amd64.go b/vendor/github.com/minio/md5-simd/md5block_amd64.go new file mode 100644 index 000000000..4c2793662 --- /dev/null +++ b/vendor/github.com/minio/md5-simd/md5block_amd64.go @@ -0,0 +1,11 @@ +// Code generated by command: go run gen.go -out ../md5block_amd64.s -stubs ../md5block_amd64.go -pkg=md5simd. DO NOT EDIT. + +// +build !appengine +// +build !noasm +// +build gc + +package md5simd + +// Encode p to digest +//go:noescape +func blockScalar(dig *[4]uint32, p []byte) diff --git a/vendor/github.com/minio/md5-simd/md5block_amd64.s b/vendor/github.com/minio/md5-simd/md5block_amd64.s new file mode 100644 index 000000000..fbc4a21f2 --- /dev/null +++ b/vendor/github.com/minio/md5-simd/md5block_amd64.s @@ -0,0 +1,714 @@ +// Code generated by command: go run gen.go -out ../md5block_amd64.s -stubs ../md5block_amd64.go -pkg=md5simd. DO NOT EDIT. + +// +build !appengine +// +build !noasm +// +build gc + +// func blockScalar(dig *[4]uint32, p []byte) +TEXT ·blockScalar(SB), $0-32 + MOVQ p_len+16(FP), AX + MOVQ dig+0(FP), CX + MOVQ p_base+8(FP), DX + SHRQ $0x06, AX + SHLQ $0x06, AX + LEAQ (DX)(AX*1), AX + CMPQ DX, AX + JEQ end + MOVL (CX), BX + MOVL 4(CX), BP + MOVL 8(CX), SI + MOVL 12(CX), CX + MOVL $0xffffffff, DI + +loop: + MOVL (DX), R8 + MOVL CX, R9 + MOVL BX, R10 + MOVL BP, R11 + MOVL SI, R12 + MOVL CX, R13 + + // ROUND1 + XORL SI, R9 + ADDL $0xd76aa478, BX + ADDL R8, BX + ANDL BP, R9 + XORL CX, R9 + MOVL 4(DX), R8 + ADDL R9, BX + ROLL $0x07, BX + MOVL SI, R9 + ADDL BP, BX + XORL BP, R9 + ADDL $0xe8c7b756, CX + ADDL R8, CX + ANDL BX, R9 + XORL SI, R9 + MOVL 8(DX), R8 + ADDL R9, CX + ROLL $0x0c, CX + MOVL BP, R9 + ADDL BX, CX + XORL BX, R9 + ADDL $0x242070db, SI + ADDL R8, SI + ANDL CX, R9 + XORL BP, R9 + MOVL 12(DX), R8 + ADDL R9, SI + ROLL $0x11, SI + MOVL BX, R9 + ADDL CX, SI + XORL CX, R9 + ADDL $0xc1bdceee, BP + ADDL R8, BP + ANDL SI, R9 + XORL BX, R9 + MOVL 16(DX), R8 + ADDL R9, BP + ROLL $0x16, BP + MOVL CX, R9 + ADDL SI, BP + XORL SI, R9 + ADDL $0xf57c0faf, BX + ADDL R8, BX + ANDL BP, R9 + XORL CX, R9 + MOVL 20(DX), R8 + ADDL R9, BX + ROLL $0x07, BX + MOVL SI, R9 + ADDL BP, BX + XORL BP, R9 + ADDL $0x4787c62a, CX + ADDL R8, CX + ANDL BX, R9 + XORL SI, R9 + MOVL 24(DX), R8 + ADDL R9, CX + ROLL $0x0c, CX + MOVL BP, R9 + ADDL BX, CX + XORL BX, R9 + ADDL $0xa8304613, SI + ADDL R8, SI + ANDL CX, R9 + XORL BP, R9 + MOVL 28(DX), R8 + ADDL R9, SI + ROLL $0x11, SI + MOVL BX, R9 + ADDL CX, SI + XORL CX, R9 + ADDL $0xfd469501, BP + ADDL R8, BP + ANDL SI, R9 + XORL BX, R9 + MOVL 32(DX), R8 + ADDL R9, BP + ROLL $0x16, BP + MOVL CX, R9 + ADDL SI, BP + XORL SI, R9 + ADDL $0x698098d8, BX + ADDL R8, BX + ANDL BP, R9 + XORL CX, R9 + MOVL 36(DX), R8 + ADDL R9, BX + ROLL $0x07, BX + MOVL SI, R9 + ADDL BP, BX + XORL BP, R9 + ADDL $0x8b44f7af, CX + ADDL R8, CX + ANDL BX, R9 + XORL SI, R9 + MOVL 40(DX), R8 + ADDL R9, CX + ROLL $0x0c, CX + MOVL BP, R9 + ADDL BX, CX + XORL BX, R9 + ADDL $0xffff5bb1, SI + ADDL R8, SI + ANDL CX, R9 + XORL BP, R9 + MOVL 44(DX), R8 + ADDL R9, SI + ROLL $0x11, SI + MOVL BX, R9 + ADDL CX, SI + XORL CX, R9 + ADDL $0x895cd7be, BP + ADDL R8, BP + ANDL SI, R9 + XORL BX, R9 + MOVL 48(DX), R8 + ADDL R9, BP + ROLL $0x16, BP + MOVL CX, R9 + ADDL SI, BP + XORL SI, R9 + ADDL $0x6b901122, BX + ADDL R8, BX + ANDL BP, R9 + XORL CX, R9 + MOVL 52(DX), R8 + ADDL R9, BX + ROLL $0x07, BX + MOVL SI, R9 + ADDL BP, BX + XORL BP, R9 + ADDL $0xfd987193, CX + ADDL R8, CX + ANDL BX, R9 + XORL SI, R9 + MOVL 56(DX), R8 + ADDL R9, CX + ROLL $0x0c, CX + MOVL BP, R9 + ADDL BX, CX + XORL BX, R9 + ADDL $0xa679438e, SI + ADDL R8, SI + ANDL CX, R9 + XORL BP, R9 + MOVL 60(DX), R8 + ADDL R9, SI + ROLL $0x11, SI + MOVL BX, R9 + ADDL CX, SI + XORL CX, R9 + ADDL $0x49b40821, BP + ADDL R8, BP + ANDL SI, R9 + XORL BX, R9 + MOVL 4(DX), R8 + ADDL R9, BP + ROLL $0x16, BP + MOVL CX, R9 + ADDL SI, BP + + // ROUND2 + MOVL CX, R9 + MOVL CX, R14 + XORL DI, R9 + ADDL $0xf61e2562, BX + ADDL R8, BX + ANDL BP, R14 + ANDL SI, R9 + MOVL 24(DX), R8 + ORL R9, R14 + MOVL SI, R9 + ADDL R14, BX + MOVL SI, R14 + ROLL $0x05, BX + ADDL BP, BX + XORL DI, R9 + ADDL $0xc040b340, CX + ADDL R8, CX + ANDL BX, R14 + ANDL BP, R9 + MOVL 44(DX), R8 + ORL R9, R14 + MOVL BP, R9 + ADDL R14, CX + MOVL BP, R14 + ROLL $0x09, CX + ADDL BX, CX + XORL DI, R9 + ADDL $0x265e5a51, SI + ADDL R8, SI + ANDL CX, R14 + ANDL BX, R9 + MOVL (DX), R8 + ORL R9, R14 + MOVL BX, R9 + ADDL R14, SI + MOVL BX, R14 + ROLL $0x0e, SI + ADDL CX, SI + XORL DI, R9 + ADDL $0xe9b6c7aa, BP + ADDL R8, BP + ANDL SI, R14 + ANDL CX, R9 + MOVL 20(DX), R8 + ORL R9, R14 + MOVL CX, R9 + ADDL R14, BP + MOVL CX, R14 + ROLL $0x14, BP + ADDL SI, BP + XORL DI, R9 + ADDL $0xd62f105d, BX + ADDL R8, BX + ANDL BP, R14 + ANDL SI, R9 + MOVL 40(DX), R8 + ORL R9, R14 + MOVL SI, R9 + ADDL R14, BX + MOVL SI, R14 + ROLL $0x05, BX + ADDL BP, BX + XORL DI, R9 + ADDL $0x02441453, CX + ADDL R8, CX + ANDL BX, R14 + ANDL BP, R9 + MOVL 60(DX), R8 + ORL R9, R14 + MOVL BP, R9 + ADDL R14, CX + MOVL BP, R14 + ROLL $0x09, CX + ADDL BX, CX + XORL DI, R9 + ADDL $0xd8a1e681, SI + ADDL R8, SI + ANDL CX, R14 + ANDL BX, R9 + MOVL 16(DX), R8 + ORL R9, R14 + MOVL BX, R9 + ADDL R14, SI + MOVL BX, R14 + ROLL $0x0e, SI + ADDL CX, SI + XORL DI, R9 + ADDL $0xe7d3fbc8, BP + ADDL R8, BP + ANDL SI, R14 + ANDL CX, R9 + MOVL 36(DX), R8 + ORL R9, R14 + MOVL CX, R9 + ADDL R14, BP + MOVL CX, R14 + ROLL $0x14, BP + ADDL SI, BP + XORL DI, R9 + ADDL $0x21e1cde6, BX + ADDL R8, BX + ANDL BP, R14 + ANDL SI, R9 + MOVL 56(DX), R8 + ORL R9, R14 + MOVL SI, R9 + ADDL R14, BX + MOVL SI, R14 + ROLL $0x05, BX + ADDL BP, BX + XORL DI, R9 + ADDL $0xc33707d6, CX + ADDL R8, CX + ANDL BX, R14 + ANDL BP, R9 + MOVL 12(DX), R8 + ORL R9, R14 + MOVL BP, R9 + ADDL R14, CX + MOVL BP, R14 + ROLL $0x09, CX + ADDL BX, CX + XORL DI, R9 + ADDL $0xf4d50d87, SI + ADDL R8, SI + ANDL CX, R14 + ANDL BX, R9 + MOVL 32(DX), R8 + ORL R9, R14 + MOVL BX, R9 + ADDL R14, SI + MOVL BX, R14 + ROLL $0x0e, SI + ADDL CX, SI + XORL DI, R9 + ADDL $0x455a14ed, BP + ADDL R8, BP + ANDL SI, R14 + ANDL CX, R9 + MOVL 52(DX), R8 + ORL R9, R14 + MOVL CX, R9 + ADDL R14, BP + MOVL CX, R14 + ROLL $0x14, BP + ADDL SI, BP + XORL DI, R9 + ADDL $0xa9e3e905, BX + ADDL R8, BX + ANDL BP, R14 + ANDL SI, R9 + MOVL 8(DX), R8 + ORL R9, R14 + MOVL SI, R9 + ADDL R14, BX + MOVL SI, R14 + ROLL $0x05, BX + ADDL BP, BX + XORL DI, R9 + ADDL $0xfcefa3f8, CX + ADDL R8, CX + ANDL BX, R14 + ANDL BP, R9 + MOVL 28(DX), R8 + ORL R9, R14 + MOVL BP, R9 + ADDL R14, CX + MOVL BP, R14 + ROLL $0x09, CX + ADDL BX, CX + XORL DI, R9 + ADDL $0x676f02d9, SI + ADDL R8, SI + ANDL CX, R14 + ANDL BX, R9 + MOVL 48(DX), R8 + ORL R9, R14 + MOVL BX, R9 + ADDL R14, SI + MOVL BX, R14 + ROLL $0x0e, SI + ADDL CX, SI + XORL DI, R9 + ADDL $0x8d2a4c8a, BP + ADDL R8, BP + ANDL SI, R14 + ANDL CX, R9 + MOVL 20(DX), R8 + ORL R9, R14 + MOVL CX, R9 + ADDL R14, BP + MOVL CX, R14 + ROLL $0x14, BP + ADDL SI, BP + + // ROUND3 + MOVL SI, R9 + ADDL $0xfffa3942, BX + ADDL R8, BX + MOVL 32(DX), R8 + XORL CX, R9 + XORL BP, R9 + ADDL R9, BX + ROLL $0x04, BX + MOVL BP, R9 + ADDL BP, BX + ADDL $0x8771f681, CX + ADDL R8, CX + MOVL 44(DX), R8 + XORL SI, R9 + XORL BX, R9 + ADDL R9, CX + ROLL $0x0b, CX + MOVL BX, R9 + ADDL BX, CX + ADDL $0x6d9d6122, SI + ADDL R8, SI + MOVL 56(DX), R8 + XORL BP, R9 + XORL CX, R9 + ADDL R9, SI + ROLL $0x10, SI + MOVL CX, R9 + ADDL CX, SI + ADDL $0xfde5380c, BP + ADDL R8, BP + MOVL 4(DX), R8 + XORL BX, R9 + XORL SI, R9 + ADDL R9, BP + ROLL $0x17, BP + MOVL SI, R9 + ADDL SI, BP + ADDL $0xa4beea44, BX + ADDL R8, BX + MOVL 16(DX), R8 + XORL CX, R9 + XORL BP, R9 + ADDL R9, BX + ROLL $0x04, BX + MOVL BP, R9 + ADDL BP, BX + ADDL $0x4bdecfa9, CX + ADDL R8, CX + MOVL 28(DX), R8 + XORL SI, R9 + XORL BX, R9 + ADDL R9, CX + ROLL $0x0b, CX + MOVL BX, R9 + ADDL BX, CX + ADDL $0xf6bb4b60, SI + ADDL R8, SI + MOVL 40(DX), R8 + XORL BP, R9 + XORL CX, R9 + ADDL R9, SI + ROLL $0x10, SI + MOVL CX, R9 + ADDL CX, SI + ADDL $0xbebfbc70, BP + ADDL R8, BP + MOVL 52(DX), R8 + XORL BX, R9 + XORL SI, R9 + ADDL R9, BP + ROLL $0x17, BP + MOVL SI, R9 + ADDL SI, BP + ADDL $0x289b7ec6, BX + ADDL R8, BX + MOVL (DX), R8 + XORL CX, R9 + XORL BP, R9 + ADDL R9, BX + ROLL $0x04, BX + MOVL BP, R9 + ADDL BP, BX + ADDL $0xeaa127fa, CX + ADDL R8, CX + MOVL 12(DX), R8 + XORL SI, R9 + XORL BX, R9 + ADDL R9, CX + ROLL $0x0b, CX + MOVL BX, R9 + ADDL BX, CX + ADDL $0xd4ef3085, SI + ADDL R8, SI + MOVL 24(DX), R8 + XORL BP, R9 + XORL CX, R9 + ADDL R9, SI + ROLL $0x10, SI + MOVL CX, R9 + ADDL CX, SI + ADDL $0x04881d05, BP + ADDL R8, BP + MOVL 36(DX), R8 + XORL BX, R9 + XORL SI, R9 + ADDL R9, BP + ROLL $0x17, BP + MOVL SI, R9 + ADDL SI, BP + ADDL $0xd9d4d039, BX + ADDL R8, BX + MOVL 48(DX), R8 + XORL CX, R9 + XORL BP, R9 + ADDL R9, BX + ROLL $0x04, BX + MOVL BP, R9 + ADDL BP, BX + ADDL $0xe6db99e5, CX + ADDL R8, CX + MOVL 60(DX), R8 + XORL SI, R9 + XORL BX, R9 + ADDL R9, CX + ROLL $0x0b, CX + MOVL BX, R9 + ADDL BX, CX + ADDL $0x1fa27cf8, SI + ADDL R8, SI + MOVL 8(DX), R8 + XORL BP, R9 + XORL CX, R9 + ADDL R9, SI + ROLL $0x10, SI + MOVL CX, R9 + ADDL CX, SI + ADDL $0xc4ac5665, BP + ADDL R8, BP + MOVL (DX), R8 + XORL BX, R9 + XORL SI, R9 + ADDL R9, BP + ROLL $0x17, BP + MOVL SI, R9 + ADDL SI, BP + + // ROUND4 + MOVL DI, R9 + XORL CX, R9 + ADDL $0xf4292244, BX + ADDL R8, BX + ORL BP, R9 + XORL SI, R9 + ADDL R9, BX + MOVL 28(DX), R8 + MOVL DI, R9 + ROLL $0x06, BX + XORL SI, R9 + ADDL BP, BX + ADDL $0x432aff97, CX + ADDL R8, CX + ORL BX, R9 + XORL BP, R9 + ADDL R9, CX + MOVL 56(DX), R8 + MOVL DI, R9 + ROLL $0x0a, CX + XORL BP, R9 + ADDL BX, CX + ADDL $0xab9423a7, SI + ADDL R8, SI + ORL CX, R9 + XORL BX, R9 + ADDL R9, SI + MOVL 20(DX), R8 + MOVL DI, R9 + ROLL $0x0f, SI + XORL BX, R9 + ADDL CX, SI + ADDL $0xfc93a039, BP + ADDL R8, BP + ORL SI, R9 + XORL CX, R9 + ADDL R9, BP + MOVL 48(DX), R8 + MOVL DI, R9 + ROLL $0x15, BP + XORL CX, R9 + ADDL SI, BP + ADDL $0x655b59c3, BX + ADDL R8, BX + ORL BP, R9 + XORL SI, R9 + ADDL R9, BX + MOVL 12(DX), R8 + MOVL DI, R9 + ROLL $0x06, BX + XORL SI, R9 + ADDL BP, BX + ADDL $0x8f0ccc92, CX + ADDL R8, CX + ORL BX, R9 + XORL BP, R9 + ADDL R9, CX + MOVL 40(DX), R8 + MOVL DI, R9 + ROLL $0x0a, CX + XORL BP, R9 + ADDL BX, CX + ADDL $0xffeff47d, SI + ADDL R8, SI + ORL CX, R9 + XORL BX, R9 + ADDL R9, SI + MOVL 4(DX), R8 + MOVL DI, R9 + ROLL $0x0f, SI + XORL BX, R9 + ADDL CX, SI + ADDL $0x85845dd1, BP + ADDL R8, BP + ORL SI, R9 + XORL CX, R9 + ADDL R9, BP + MOVL 32(DX), R8 + MOVL DI, R9 + ROLL $0x15, BP + XORL CX, R9 + ADDL SI, BP + ADDL $0x6fa87e4f, BX + ADDL R8, BX + ORL BP, R9 + XORL SI, R9 + ADDL R9, BX + MOVL 60(DX), R8 + MOVL DI, R9 + ROLL $0x06, BX + XORL SI, R9 + ADDL BP, BX + ADDL $0xfe2ce6e0, CX + ADDL R8, CX + ORL BX, R9 + XORL BP, R9 + ADDL R9, CX + MOVL 24(DX), R8 + MOVL DI, R9 + ROLL $0x0a, CX + XORL BP, R9 + ADDL BX, CX + ADDL $0xa3014314, SI + ADDL R8, SI + ORL CX, R9 + XORL BX, R9 + ADDL R9, SI + MOVL 52(DX), R8 + MOVL DI, R9 + ROLL $0x0f, SI + XORL BX, R9 + ADDL CX, SI + ADDL $0x4e0811a1, BP + ADDL R8, BP + ORL SI, R9 + XORL CX, R9 + ADDL R9, BP + MOVL 16(DX), R8 + MOVL DI, R9 + ROLL $0x15, BP + XORL CX, R9 + ADDL SI, BP + ADDL $0xf7537e82, BX + ADDL R8, BX + ORL BP, R9 + XORL SI, R9 + ADDL R9, BX + MOVL 44(DX), R8 + MOVL DI, R9 + ROLL $0x06, BX + XORL SI, R9 + ADDL BP, BX + ADDL $0xbd3af235, CX + ADDL R8, CX + ORL BX, R9 + XORL BP, R9 + ADDL R9, CX + MOVL 8(DX), R8 + MOVL DI, R9 + ROLL $0x0a, CX + XORL BP, R9 + ADDL BX, CX + ADDL $0x2ad7d2bb, SI + ADDL R8, SI + ORL CX, R9 + XORL BX, R9 + ADDL R9, SI + MOVL 36(DX), R8 + MOVL DI, R9 + ROLL $0x0f, SI + XORL BX, R9 + ADDL CX, SI + ADDL $0xeb86d391, BP + ADDL R8, BP + ORL SI, R9 + XORL CX, R9 + ADDL R9, BP + ROLL $0x15, BP + ADDL SI, BP + ADDL R10, BX + ADDL R11, BP + ADDL R12, SI + ADDL R13, CX + + // Prepare next loop + ADDQ $0x40, DX + CMPQ DX, AX + JB loop + + // Write output + MOVQ dig+0(FP), AX + MOVL BX, (AX) + MOVL BP, 4(AX) + MOVL SI, 8(AX) + MOVL CX, 12(AX) + +end: + RET diff --git a/vendor/github.com/minio/minio-go/v7/api-get-object.go b/vendor/github.com/minio/minio-go/v7/api-get-object.go index b9f6ded99..b17f3146b 100644 --- a/vendor/github.com/minio/minio-go/v7/api-get-object.go +++ b/vendor/github.com/minio/minio-go/v7/api-get-object.go @@ -45,9 +45,7 @@ func (c *Client) GetObject(ctx context.Context, bucketName, objectName string, o // Detect if snowball is server location we are talking to. var snowball bool if location, ok := c.bucketLocCache.Get(bucketName); ok { - if location == "snowball" { - snowball = true - } + snowball = location == "snowball" } var ( @@ -64,161 +62,46 @@ func (c *Client) GetObject(ctx context.Context, bucketName, objectName string, o // This routine feeds partial object data as and when the caller reads. go func() { - defer close(reqCh) defer close(resCh) + defer func() { + // Close the http response body before returning. + // This ends the connection with the server. + if httpReader != nil { + httpReader.Close() + } + }() + defer cancel() // Used to verify if etag of object has changed since last read. var etag string - // Loop through the incoming control messages and read data. - for { - select { - // When context is closed exit our routine. - case <-gctx.Done(): - // Close the http response body before returning. - // This ends the connection with the server. - if httpReader != nil { - httpReader.Close() - } - return - - // Gather incoming request. - case req := <-reqCh: - // If this is the first request we may not need to do a getObject request yet. - if req.isFirstReq { - // First request is a Read/ReadAt. - if req.isReadOp { - // Differentiate between wanting the whole object and just a range. - if req.isReadAt { - // If this is a ReadAt request only get the specified range. - // Range is set with respect to the offset and length of the buffer requested. - // Do not set objectInfo from the first readAt request because it will not get - // the whole object. - opts.SetRange(req.Offset, req.Offset+int64(len(req.Buffer))-1) - } else if req.Offset > 0 { - opts.SetRange(req.Offset, 0) - } - httpReader, objectInfo, _, err = c.getObject(gctx, bucketName, objectName, opts) - if err != nil { - resCh <- getResponse{Error: err} - return - } - etag = objectInfo.ETag - // Read at least firstReq.Buffer bytes, if not we have - // reached our EOF. - size, err := readFull(httpReader, req.Buffer) - totalRead += size - if size > 0 && err == io.ErrUnexpectedEOF { - if int64(size) < objectInfo.Size { - // In situations when returned size - // is less than the expected content - // length set by the server, make sure - // we return io.ErrUnexpectedEOF - err = io.ErrUnexpectedEOF - } else { - // If an EOF happens after reading some but not - // all the bytes ReadFull returns ErrUnexpectedEOF - err = io.EOF - } - } else if size == 0 && err == io.EOF && objectInfo.Size > 0 { - // Special cases when server writes more data - // than the content-length, net/http response - // body returns an error, instead of converting - // it to io.EOF - return unexpected EOF. - err = io.ErrUnexpectedEOF - } - // Send back the first response. - resCh <- getResponse{ - objectInfo: objectInfo, - Size: size, - Error: err, - didRead: true, - } - } else { - // First request is a Stat or Seek call. - // Only need to run a StatObject until an actual Read or ReadAt request comes through. - - // Remove range header if already set, for stat Operations to get original file size. - delete(opts.headers, "Range") - objectInfo, err = c.StatObject(gctx, bucketName, objectName, StatObjectOptions(opts)) - if err != nil { - resCh <- getResponse{ - Error: err, - } - // Exit the go-routine. - return - } - etag = objectInfo.ETag - // Send back the first response. - resCh <- getResponse{ - objectInfo: objectInfo, - } + for req := range reqCh { + // If this is the first request we may not need to do a getObject request yet. + if req.isFirstReq { + // First request is a Read/ReadAt. + if req.isReadOp { + // Differentiate between wanting the whole object and just a range. + if req.isReadAt { + // If this is a ReadAt request only get the specified range. + // Range is set with respect to the offset and length of the buffer requested. + // Do not set objectInfo from the first readAt request because it will not get + // the whole object. + opts.SetRange(req.Offset, req.Offset+int64(len(req.Buffer))-1) + } else if req.Offset > 0 { + opts.SetRange(req.Offset, 0) } - } else if req.settingObjectInfo { // Request is just to get objectInfo. - // Remove range header if already set, for stat Operations to get original file size. - delete(opts.headers, "Range") - // Check whether this is snowball - // if yes do not use If-Match feature - // it doesn't work. - if etag != "" && !snowball { - opts.SetMatchETag(etag) - } - objectInfo, err := c.StatObject(gctx, bucketName, objectName, StatObjectOptions(opts)) + httpReader, objectInfo, _, err = c.getObject(gctx, bucketName, objectName, opts) if err != nil { - resCh <- getResponse{ - Error: err, - } - // Exit the goroutine. + resCh <- getResponse{Error: err} return } - // Send back the objectInfo. - resCh <- getResponse{ - objectInfo: objectInfo, - } - } else { - // Offset changes fetch the new object at an Offset. - // Because the httpReader may not be set by the first - // request if it was a stat or seek it must be checked - // if the object has been read or not to only initialize - // new ones when they haven't been already. - // All readAt requests are new requests. - if req.DidOffsetChange || !req.beenRead { - // Check whether this is snowball - // if yes do not use If-Match feature - // it doesn't work. - if etag != "" && !snowball { - opts.SetMatchETag(etag) - } - if httpReader != nil { - // Close previously opened http reader. - httpReader.Close() - } - // If this request is a readAt only get the specified range. - if req.isReadAt { - // Range is set with respect to the offset and length of the buffer requested. - opts.SetRange(req.Offset, req.Offset+int64(len(req.Buffer))-1) - } else if req.Offset > 0 { // Range is set with respect to the offset. - opts.SetRange(req.Offset, 0) - } else { - // Remove range header if already set - delete(opts.headers, "Range") - } - httpReader, objectInfo, _, err = c.getObject(gctx, bucketName, objectName, opts) - if err != nil { - resCh <- getResponse{ - Error: err, - } - return - } - totalRead = 0 - } - - // Read at least req.Buffer bytes, if not we have + etag = objectInfo.ETag + // Read at least firstReq.Buffer bytes, if not we have // reached our EOF. size, err := readFull(httpReader, req.Buffer) totalRead += size if size > 0 && err == io.ErrUnexpectedEOF { - if int64(totalRead) < objectInfo.Size { + if int64(size) < objectInfo.Size { // In situations when returned size // is less than the expected content // length set by the server, make sure @@ -236,15 +119,123 @@ func (c *Client) GetObject(ctx context.Context, bucketName, objectName string, o // it to io.EOF - return unexpected EOF. err = io.ErrUnexpectedEOF } - - // Reply back how much was read. + // Send back the first response. resCh <- getResponse{ + objectInfo: objectInfo, Size: size, Error: err, didRead: true, + } + } else { + // First request is a Stat or Seek call. + // Only need to run a StatObject until an actual Read or ReadAt request comes through. + + // Remove range header if already set, for stat Operations to get original file size. + delete(opts.headers, "Range") + objectInfo, err = c.StatObject(gctx, bucketName, objectName, StatObjectOptions(opts)) + if err != nil { + resCh <- getResponse{ + Error: err, + } + // Exit the go-routine. + return + } + etag = objectInfo.ETag + // Send back the first response. + resCh <- getResponse{ objectInfo: objectInfo, } } + } else if req.settingObjectInfo { // Request is just to get objectInfo. + // Remove range header if already set, for stat Operations to get original file size. + delete(opts.headers, "Range") + // Check whether this is snowball + // if yes do not use If-Match feature + // it doesn't work. + if etag != "" && !snowball { + opts.SetMatchETag(etag) + } + objectInfo, err := c.StatObject(gctx, bucketName, objectName, StatObjectOptions(opts)) + if err != nil { + resCh <- getResponse{ + Error: err, + } + // Exit the goroutine. + return + } + // Send back the objectInfo. + resCh <- getResponse{ + objectInfo: objectInfo, + } + } else { + // Offset changes fetch the new object at an Offset. + // Because the httpReader may not be set by the first + // request if it was a stat or seek it must be checked + // if the object has been read or not to only initialize + // new ones when they haven't been already. + // All readAt requests are new requests. + if req.DidOffsetChange || !req.beenRead { + // Check whether this is snowball + // if yes do not use If-Match feature + // it doesn't work. + if etag != "" && !snowball { + opts.SetMatchETag(etag) + } + if httpReader != nil { + // Close previously opened http reader. + httpReader.Close() + } + // If this request is a readAt only get the specified range. + if req.isReadAt { + // Range is set with respect to the offset and length of the buffer requested. + opts.SetRange(req.Offset, req.Offset+int64(len(req.Buffer))-1) + } else if req.Offset > 0 { // Range is set with respect to the offset. + opts.SetRange(req.Offset, 0) + } else { + // Remove range header if already set + delete(opts.headers, "Range") + } + httpReader, objectInfo, _, err = c.getObject(gctx, bucketName, objectName, opts) + if err != nil { + resCh <- getResponse{ + Error: err, + } + return + } + totalRead = 0 + } + + // Read at least req.Buffer bytes, if not we have + // reached our EOF. + size, err := readFull(httpReader, req.Buffer) + totalRead += size + if size > 0 && err == io.ErrUnexpectedEOF { + if int64(totalRead) < objectInfo.Size { + // In situations when returned size + // is less than the expected content + // length set by the server, make sure + // we return io.ErrUnexpectedEOF + err = io.ErrUnexpectedEOF + } else { + // If an EOF happens after reading some but not + // all the bytes ReadFull returns ErrUnexpectedEOF + err = io.EOF + } + } else if size == 0 && err == io.EOF && objectInfo.Size > 0 { + // Special cases when server writes more data + // than the content-length, net/http response + // body returns an error, instead of converting + // it to io.EOF - return unexpected EOF. + err = io.ErrUnexpectedEOF + } + + // Reply back how much was read. + resCh <- getResponse{ + Size: size, + Error: err, + didRead: true, + objectInfo: objectInfo, + } } } }() @@ -611,6 +602,7 @@ func (o *Object) Close() (err error) { if o == nil { return errInvalidArgument("Object is nil") } + // Locking. o.mutex.Lock() defer o.mutex.Unlock() @@ -623,6 +615,9 @@ func (o *Object) Close() (err error) { // Close successfully. o.cancel() + // Close the request channel to indicate the internal go-routine to exit. + close(o.reqCh) + // Save for future operations. errMsg := "Object is already closed. Bad file descriptor." o.prevErr = errors.New(errMsg) diff --git a/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go b/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go index 342a8dc2b..abcbd2981 100644 --- a/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go +++ b/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go @@ -104,7 +104,7 @@ func (c *Client) putObjectMultipartNoStream(ctx context.Context, bucketName, obj // Choose hash algorithms to be calculated by hashCopyN, // avoid sha256 with non-v4 signature request or // HTTPS connection. - hashAlgos, hashSums := c.hashMaterials(opts.SendContentMd5) + hashAlgos, hashSums := c.hashMaterials(opts.SendContentMd5, !opts.DisableContentSha256) length, rErr := readFull(reader, buf) if rErr == io.EOF && partNumber > 1 { @@ -140,7 +140,9 @@ func (c *Client) putObjectMultipartNoStream(ctx context.Context, bucketName, obj // Proceed to upload the part. objPart, uerr := c.uploadPart(ctx, bucketName, objectName, uploadID, rd, partNumber, - md5Base64, sha256Hex, int64(length), opts.ServerSideEncryption) + md5Base64, sha256Hex, int64(length), + opts.ServerSideEncryption, + !opts.DisableContentSha256) if uerr != nil { return UploadInfo{}, uerr } @@ -241,7 +243,7 @@ func (c *Client) initiateMultipartUpload(ctx context.Context, bucketName, object // uploadPart - Uploads a part in a multipart upload. func (c *Client) uploadPart(ctx context.Context, bucketName, objectName, uploadID string, reader io.Reader, - partNumber int, md5Base64, sha256Hex string, size int64, sse encrypt.ServerSide, + partNumber int, md5Base64, sha256Hex string, size int64, sse encrypt.ServerSide, streamSha256 bool, ) (ObjectPart, error) { // Input validation. if err := s3utils.CheckValidBucketName(bucketName); err != nil { @@ -289,6 +291,7 @@ func (c *Client) uploadPart(ctx context.Context, bucketName, objectName, uploadI contentLength: size, contentMD5Base64: md5Base64, contentSHA256Hex: sha256Hex, + streamSha256: streamSha256, } // Execute PUT on each part. diff --git a/vendor/github.com/minio/minio-go/v7/api-put-object-streaming.go b/vendor/github.com/minio/minio-go/v7/api-put-object-streaming.go index 2497aecf3..11b3a5255 100644 --- a/vendor/github.com/minio/minio-go/v7/api-put-object-streaming.go +++ b/vendor/github.com/minio/minio-go/v7/api-put-object-streaming.go @@ -130,34 +130,44 @@ func (c *Client) putObjectMultipartStreamFromReadAt(ctx context.Context, bucketN var complMultipartUpload completeMultipartUpload // Declare a channel that sends the next part number to be uploaded. - // Buffered to 10000 because thats the maximum number of parts allowed - // by S3. - uploadPartsCh := make(chan uploadPartReq, 10000) + uploadPartsCh := make(chan uploadPartReq) // Declare a channel that sends back the response of a part upload. - // Buffered to 10000 because thats the maximum number of parts allowed - // by S3. - uploadedPartsCh := make(chan uploadedPartRes, 10000) + uploadedPartsCh := make(chan uploadedPartRes) // Used for readability, lastPartNumber is always totalPartsCount. lastPartNumber := totalPartsCount + partitionCtx, partitionCancel := context.WithCancel(ctx) + defer partitionCancel() // Send each part number to the channel to be processed. - for p := 1; p <= totalPartsCount; p++ { - uploadPartsCh <- uploadPartReq{PartNum: p} - } - close(uploadPartsCh) - - partsBuf := make([][]byte, opts.getNumThreads()) - for i := range partsBuf { - partsBuf[i] = make([]byte, 0, partSize) - } + go func() { + defer close(uploadPartsCh) + + for p := 1; p <= totalPartsCount; p++ { + select { + case <-partitionCtx.Done(): + return + case uploadPartsCh <- uploadPartReq{PartNum: p}: + } + } + }() // Receive each part number from the channel allowing three parallel uploads. for w := 1; w <= opts.getNumThreads(); w++ { - go func(w int, partSize int64) { - // Each worker will draw from the part channel and upload in parallel. - for uploadReq := range uploadPartsCh { + go func(partSize int64) { + for { + var uploadReq uploadPartReq + var ok bool + select { + case <-ctx.Done(): + return + case uploadReq, ok = <-uploadPartsCh: + if !ok { + return + } + // Each worker will draw from the part channel and upload in parallel. + } // If partNumber was not uploaded we calculate the missing // part offset and size. For all other part numbers we @@ -171,22 +181,15 @@ func (c *Client) putObjectMultipartStreamFromReadAt(ctx context.Context, bucketN partSize = lastPartSize } - n, rerr := readFull(io.NewSectionReader(reader, readOffset, partSize), partsBuf[w-1][:partSize]) - if rerr != nil && rerr != io.ErrUnexpectedEOF && rerr != io.EOF { - uploadedPartsCh <- uploadedPartRes{ - Error: rerr, - } - // Exit the goroutine. - return - } - - // Get a section reader on a particular offset. - hookReader := newHook(bytes.NewReader(partsBuf[w-1][:n]), opts.Progress) + sectionReader := newHook(io.NewSectionReader(reader, readOffset, partSize), opts.Progress) // Proceed to upload the part. objPart, err := c.uploadPart(ctx, bucketName, objectName, - uploadID, hookReader, uploadReq.PartNum, - "", "", partSize, opts.ServerSideEncryption) + uploadID, sectionReader, uploadReq.PartNum, + "", "", partSize, + opts.ServerSideEncryption, + !opts.DisableContentSha256, + ) if err != nil { uploadedPartsCh <- uploadedPartRes{ Error: err, @@ -205,23 +208,28 @@ func (c *Client) putObjectMultipartStreamFromReadAt(ctx context.Context, bucketN Part: uploadReq.Part, } } - }(w, partSize) + }(partSize) } // Gather the responses as they occur and update any // progress bar. for u := 1; u <= totalPartsCount; u++ { - uploadRes := <-uploadedPartsCh - if uploadRes.Error != nil { - return UploadInfo{}, uploadRes.Error + select { + case <-ctx.Done(): + return UploadInfo{}, ctx.Err() + case uploadRes := <-uploadedPartsCh: + if uploadRes.Error != nil { + + return UploadInfo{}, uploadRes.Error + } + + // Update the totalUploadedSize. + totalUploadedSize += uploadRes.Size + complMultipartUpload.Parts = append(complMultipartUpload.Parts, CompletePart{ + ETag: uploadRes.Part.ETag, + PartNumber: uploadRes.Part.PartNumber, + }) } - // Update the totalUploadedSize. - totalUploadedSize += uploadRes.Size - // Store the parts to be completed in order. - complMultipartUpload.Parts = append(complMultipartUpload.Parts, CompletePart{ - ETag: uploadRes.Part.ETag, - PartNumber: uploadRes.Part.PartNumber, - }) } // Verify if we uploaded all the data. @@ -322,7 +330,10 @@ func (c *Client) putObjectMultipartStreamOptionalChecksum(ctx context.Context, b objPart, uerr := c.uploadPart(ctx, bucketName, objectName, uploadID, io.LimitReader(hookReader, partSize), - partNumber, md5Base64, "", partSize, opts.ServerSideEncryption) + partNumber, md5Base64, "", partSize, + opts.ServerSideEncryption, + !opts.DisableContentSha256, + ) if uerr != nil { return UploadInfo{}, uerr } @@ -452,6 +463,7 @@ func (c *Client) putObjectDo(ctx context.Context, bucketName, objectName string, contentLength: size, contentMD5Base64: md5Base64, contentSHA256Hex: sha256Hex, + streamSha256: !opts.DisableContentSha256, } if opts.Internal.SourceVersionID != "" { if opts.Internal.SourceVersionID != nullVersionID { diff --git a/vendor/github.com/minio/minio-go/v7/api-put-object.go b/vendor/github.com/minio/minio-go/v7/api-put-object.go index 181f1a943..9328fb6c1 100644 --- a/vendor/github.com/minio/minio-go/v7/api-put-object.go +++ b/vendor/github.com/minio/minio-go/v7/api-put-object.go @@ -84,6 +84,7 @@ type PutObjectOptions struct { PartSize uint64 LegalHold LegalHoldStatus SendContentMd5 bool + DisableContentSha256 bool DisableMultipart bool Internal AdvancedPutOptions } @@ -344,7 +345,10 @@ func (c *Client) putObjectMultipartStreamNoLength(ctx context.Context, bucketNam // Proceed to upload the part. objPart, uerr := c.uploadPart(ctx, bucketName, objectName, uploadID, rd, partNumber, - md5Base64, "", int64(length), opts.ServerSideEncryption) + md5Base64, "", int64(length), + opts.ServerSideEncryption, + !opts.DisableContentSha256, + ) if uerr != nil { return UploadInfo{}, uerr } diff --git a/vendor/github.com/minio/minio-go/v7/api.go b/vendor/github.com/minio/minio-go/v7/api.go index c8a565988..2dcfc7978 100644 --- a/vendor/github.com/minio/minio-go/v7/api.go +++ b/vendor/github.com/minio/minio-go/v7/api.go @@ -111,7 +111,7 @@ type Options struct { // Global constants. const ( libraryName = "minio-go" - libraryVersion = "v7.0.29" + libraryVersion = "v7.0.36" ) // User Agent should always following the below style. @@ -315,14 +315,16 @@ func (c *Client) SetS3TransferAccelerate(accelerateEndpoint string) { // - For signature v4 request if the connection is insecure compute only sha256. // - For signature v4 request if the connection is secure compute only md5. // - For anonymous request compute md5. -func (c *Client) hashMaterials(isMd5Requested bool) (hashAlgos map[string]md5simd.Hasher, hashSums map[string][]byte) { +func (c *Client) hashMaterials(isMd5Requested, isSha256Requested bool) (hashAlgos map[string]md5simd.Hasher, hashSums map[string][]byte) { hashSums = make(map[string][]byte) hashAlgos = make(map[string]md5simd.Hasher) if c.overrideSignerType.IsV4() { if c.secure { hashAlgos["md5"] = c.md5Hasher() } else { - hashAlgos["sha256"] = c.sha256Hasher() + if isSha256Requested { + hashAlgos["sha256"] = c.sha256Hasher() + } } } else { if c.overrideSignerType.IsAnonymous() { @@ -377,21 +379,20 @@ func (c *Client) HealthCheck(hcDuration time.Duration) (context.CancelFunc, erro atomic.StoreInt32(&c.healthStatus, unknown) return case <-timer.C: - timer.Reset(duration) // Do health check the first time and ONLY if the connection is marked offline if c.IsOffline() { gctx, gcancel := context.WithTimeout(context.Background(), 3*time.Second) _, err := c.getBucketLocation(gctx, probeBucketName) gcancel() - if IsNetworkOrHostDown(err, false) { - // Still network errors do not need to do anything. - continue - } - switch ToErrorResponse(err).Code { - case "NoSuchBucket", "AccessDenied", "": - atomic.CompareAndSwapInt32(&c.healthStatus, offline, online) + if !IsNetworkOrHostDown(err, false) { + switch ToErrorResponse(err).Code { + case "NoSuchBucket", "AccessDenied", "": + atomic.CompareAndSwapInt32(&c.healthStatus, offline, online) + } } } + + timer.Reset(duration) } } }(hcDuration) @@ -417,6 +418,7 @@ type requestMetadata struct { contentLength int64 contentMD5Base64 string // carries base64 encoded md5sum contentSHA256Hex string // carries hex encoded sha256sum + streamSha256 bool } // dumpHTTP - dump HTTP request and response. @@ -593,12 +595,11 @@ func (c *Client) executeMethod(ctx context.Context, method string, metadata requ // Initiate the request. res, err = c.do(req) if err != nil { - if errors.Is(err, context.Canceled) || errors.Is(err, context.DeadlineExceeded) { - return nil, err + if isRequestErrorRetryable(err) { + // Retry the request + continue } - - // Retry the request - continue + return nil, err } // For any known successful http status, return quickly. @@ -812,7 +813,7 @@ func (c *Client) newRequest(ctx context.Context, method string, metadata request case signerType.IsV2(): // Add signature version '2' authorization header. req = signer.SignV2(*req, accessKeyID, secretAccessKey, isVirtualHost) - case metadata.objectName != "" && metadata.queryValues == nil && method == http.MethodPut && metadata.customHeader.Get("X-Amz-Copy-Source") == "" && !c.secure: + case metadata.streamSha256 && !c.secure: // Streaming signature is used by default for a PUT object request. Additionally we also // look if the initialized client is secure, if yes then we don't need to perform // streaming signature. diff --git a/vendor/github.com/minio/minio-go/v7/core.go b/vendor/github.com/minio/minio-go/v7/core.go index c2a90239f..148671eec 100644 --- a/vendor/github.com/minio/minio-go/v7/core.go +++ b/vendor/github.com/minio/minio-go/v7/core.go @@ -88,7 +88,8 @@ func (c Core) ListMultipartUploads(ctx context.Context, bucket, prefix, keyMarke // PutObjectPart - Upload an object part. func (c Core) PutObjectPart(ctx context.Context, bucket, object, uploadID string, partID int, data io.Reader, size int64, md5Base64, sha256Hex string, sse encrypt.ServerSide) (ObjectPart, error) { - return c.uploadPart(ctx, bucket, object, uploadID, data, partID, md5Base64, sha256Hex, size, sse) + streamSha256 := true + return c.uploadPart(ctx, bucket, object, uploadID, data, partID, md5Base64, sha256Hex, size, sse, streamSha256) } // ListObjectParts - List uploaded parts of an incomplete upload.x diff --git a/vendor/github.com/minio/minio-go/v7/hook-reader.go b/vendor/github.com/minio/minio-go/v7/hook-reader.go index f251c1e95..07bc7dbcf 100644 --- a/vendor/github.com/minio/minio-go/v7/hook-reader.go +++ b/vendor/github.com/minio/minio-go/v7/hook-reader.go @@ -20,6 +20,7 @@ package minio import ( "fmt" "io" + "sync" ) // hookReader hooks additional reader in the source stream. It is @@ -27,6 +28,7 @@ import ( // notified about the exact number of bytes read from the primary // source on each Read operation. type hookReader struct { + mu sync.RWMutex source io.Reader hook io.Reader } @@ -34,6 +36,9 @@ type hookReader struct { // Seek implements io.Seeker. Seeks source first, and if necessary // seeks hook if Seek method is appropriately found. func (hr *hookReader) Seek(offset int64, whence int) (n int64, err error) { + hr.mu.Lock() + defer hr.mu.Unlock() + // Verify for source has embedded Seeker, use it. sourceSeeker, ok := hr.source.(io.Seeker) if ok { @@ -43,18 +48,21 @@ func (hr *hookReader) Seek(offset int64, whence int) (n int64, err error) { } } - // Verify if hook has embedded Seeker, use it. - hookSeeker, ok := hr.hook.(io.Seeker) - if ok { - var m int64 - m, err = hookSeeker.Seek(offset, whence) - if err != nil { - return 0, err - } - if n != m { - return 0, fmt.Errorf("hook seeker seeked %d bytes, expected source %d bytes", m, n) + if hr.hook != nil { + // Verify if hook has embedded Seeker, use it. + hookSeeker, ok := hr.hook.(io.Seeker) + if ok { + var m int64 + m, err = hookSeeker.Seek(offset, whence) + if err != nil { + return 0, err + } + if n != m { + return 0, fmt.Errorf("hook seeker seeked %d bytes, expected source %d bytes", m, n) + } } } + return n, nil } @@ -62,14 +70,19 @@ func (hr *hookReader) Seek(offset int64, whence int) (n int64, err error) { // value 'n' number of bytes are reported through the hook. Returns // error for all non io.EOF conditions. func (hr *hookReader) Read(b []byte) (n int, err error) { + hr.mu.RLock() + defer hr.mu.RUnlock() + n, err = hr.source.Read(b) if err != nil && err != io.EOF { return n, err } - // Progress the hook with the total read bytes from the source. - if _, herr := hr.hook.Read(b[:n]); herr != nil { - if herr != io.EOF { - return n, herr + if hr.hook != nil { + // Progress the hook with the total read bytes from the source. + if _, herr := hr.hook.Read(b[:n]); herr != nil { + if herr != io.EOF { + return n, herr + } } } return n, err @@ -79,7 +92,10 @@ func (hr *hookReader) Read(b []byte) (n int, err error) { // reports the data read from the source to the hook. func newHook(source, hook io.Reader) io.Reader { if hook == nil { - return source + return &hookReader{source: source} + } + return &hookReader{ + source: source, + hook: hook, } - return &hookReader{source, hook} } diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go index ccc8251f4..cbdcfe256 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go @@ -21,7 +21,6 @@ import ( "os" "path/filepath" - homedir "github.com/mitchellh/go-homedir" ini "gopkg.in/ini.v1" ) @@ -62,7 +61,7 @@ func (p *FileAWSCredentials) Retrieve() (Value, error) { if p.Filename == "" { p.Filename = os.Getenv("AWS_SHARED_CREDENTIALS_FILE") if p.Filename == "" { - homeDir, err := homedir.Dir() + homeDir, err := os.UserHomeDir() if err != nil { return Value{}, err } diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_minio_client.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_minio_client.go index dc3f3cc0b..56437edb2 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_minio_client.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_minio_client.go @@ -24,7 +24,6 @@ import ( "runtime" jsoniter "github.com/json-iterator/go" - homedir "github.com/mitchellh/go-homedir" ) // A FileMinioClient retrieves credentials from the current user's home @@ -65,7 +64,7 @@ func (p *FileMinioClient) Retrieve() (Value, error) { if value, ok := os.LookupEnv("MINIO_SHARED_CREDENTIALS_FILE"); ok { p.Filename = value } else { - homeDir, err := homedir.Dir() + homeDir, err := os.UserHomeDir() if err != nil { return Value{}, err } diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go index f7a4af4a2..14369cf10 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go @@ -289,7 +289,10 @@ func getCredentials(client *http.Client, endpoint string) (ec2RoleCredRespBody, } // https://docs.aws.amazon.com/AWSEC2/latest/UserGuide/configuring-instance-metadata-service.html - token, _ := fetchIMDSToken(client, endpoint) + token, err := fetchIMDSToken(client, endpoint) + if err != nil { + return ec2RoleCredRespBody{}, err + } // http://docs.aws.amazon.com/AWSEC2/latest/UserGuide/iam-roles-for-amazon-ec2.html u, err := getIAMRoleURL(endpoint) diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_client_grants.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_client_grants.go index 1f106ef72..34598bd8e 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_client_grants.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_client_grants.go @@ -1,6 +1,6 @@ /* * MinIO Go Library for Amazon S3 Compatible Cloud Storage - * Copyright 2019 MinIO, Inc. + * Copyright 2019-2022 MinIO, Inc. * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. @@ -25,6 +25,7 @@ import ( "io/ioutil" "net/http" "net/url" + "strings" "time" ) @@ -122,12 +123,14 @@ func getClientGrantsCredentials(clnt *http.Client, endpoint string, if err != nil { return AssumeRoleWithClientGrantsResponse{}, err } - u.RawQuery = v.Encode() - req, err := http.NewRequest(http.MethodPost, u.String(), nil) + req, err := http.NewRequest(http.MethodPost, u.String(), strings.NewReader(v.Encode())) if err != nil { return AssumeRoleWithClientGrantsResponse{}, err } + + req.Header.Set("Content-Type", "application/x-www-form-urlencoded") + resp, err := clnt.Do(req) if err != nil { return AssumeRoleWithClientGrantsResponse{}, err diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_custom_identity.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_custom_identity.go index ab588712c..e1f9ce4be 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_custom_identity.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_custom_identity.go @@ -89,12 +89,12 @@ func (c *CustomTokenIdentity) Retrieve() (value Value, err error) { req, err := http.NewRequest(http.MethodPost, u.String(), nil) if err != nil { - return value, stripPassword(err) + return value, err } resp, err := c.Client.Do(req) if err != nil { - return value, stripPassword(err) + return value, err } defer resp.Body.Close() diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_ldap_identity.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_ldap_identity.go index 586995e86..25b45ecb0 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_ldap_identity.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_ldap_identity.go @@ -1,6 +1,6 @@ /* * MinIO Go Library for Amazon S3 Compatible Cloud Storage - * Copyright 2019-2021 MinIO, Inc. + * Copyright 2019-2022 MinIO, Inc. * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. @@ -24,6 +24,7 @@ import ( "io/ioutil" "net/http" "net/url" + "strings" "time" ) @@ -105,22 +106,6 @@ func LDAPIdentityExpiryOpt(d time.Duration) LDAPIdentityOpt { } } -func stripPassword(err error) error { - urlErr, ok := err.(*url.Error) - if ok { - u, _ := url.Parse(urlErr.URL) - if u == nil { - return urlErr - } - values := u.Query() - values.Set("LDAPPassword", "xxxxx") - u.RawQuery = values.Encode() - urlErr.URL = u.String() - return urlErr - } - return err -} - // NewLDAPIdentityWithSessionPolicy returns new credentials object that uses // LDAP Identity with a specified session policy. The `policy` parameter must be // a JSON string specifying the policy document. @@ -156,16 +141,16 @@ func (k *LDAPIdentity) Retrieve() (value Value, err error) { v.Set("DurationSeconds", fmt.Sprintf("%d", int(k.RequestedExpiry.Seconds()))) } - u.RawQuery = v.Encode() - - req, err := http.NewRequest(http.MethodPost, u.String(), nil) + req, err := http.NewRequest(http.MethodPost, u.String(), strings.NewReader(v.Encode())) if err != nil { - return value, stripPassword(err) + return value, err } + req.Header.Set("Content-Type", "application/x-www-form-urlencoded") + resp, err := k.Client.Do(req) if err != nil { - return value, stripPassword(err) + return value, err } defer resp.Body.Close() diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_web_identity.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_web_identity.go index 19bc3ddfc..50f5f1ce6 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_web_identity.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_web_identity.go @@ -1,6 +1,6 @@ /* * MinIO Go Library for Amazon S3 Compatible Cloud Storage - * Copyright 2019 MinIO, Inc. + * Copyright 2019-2022 MinIO, Inc. * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. @@ -26,6 +26,7 @@ import ( "net/http" "net/url" "strconv" + "strings" "time" ) @@ -139,13 +140,13 @@ func getWebIdentityCredentials(clnt *http.Client, endpoint, roleARN, roleSession return AssumeRoleWithWebIdentityResponse{}, err } - u.RawQuery = v.Encode() - - req, err := http.NewRequest(http.MethodPost, u.String(), nil) + req, err := http.NewRequest(http.MethodPost, u.String(), strings.NewReader(v.Encode())) if err != nil { return AssumeRoleWithWebIdentityResponse{}, err } + req.Header.Set("Content-Type", "application/x-www-form-urlencoded") + resp, err := clnt.Do(req) if err != nil { return AssumeRoleWithWebIdentityResponse{}, err diff --git a/vendor/github.com/minio/minio-go/v7/pkg/lifecycle/lifecycle.go b/vendor/github.com/minio/minio-go/v7/pkg/lifecycle/lifecycle.go index 743d8eca9..88a56b09f 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/lifecycle/lifecycle.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/lifecycle/lifecycle.go @@ -329,15 +329,15 @@ type Expiration struct { XMLName xml.Name `xml:"Expiration,omitempty" json:"-"` Date ExpirationDate `xml:"Date,omitempty" json:"Date,omitempty"` Days ExpirationDays `xml:"Days,omitempty" json:"Days,omitempty"` - DeleteMarker ExpireDeleteMarker `xml:"ExpiredObjectDeleteMarker,omitempty"` + DeleteMarker ExpireDeleteMarker `xml:"ExpiredObjectDeleteMarker,omitempty" json:"ExpiredObjectDeleteMarker,omitempty"` } // MarshalJSON customizes json encoding by removing empty day/date specification. func (e Expiration) MarshalJSON() ([]byte, error) { type expiration struct { - Date *ExpirationDate `json:"Date,omitempty"` - Days *ExpirationDays `json:"Days,omitempty"` - DeleteMarker ExpireDeleteMarker + Date *ExpirationDate `json:"Date,omitempty"` + Days *ExpirationDays `json:"Days,omitempty"` + DeleteMarker ExpireDeleteMarker `json:"ExpiredObjectDeleteMarker,omitempty"` } newexp := expiration{ diff --git a/vendor/github.com/minio/minio-go/v7/post-policy.go b/vendor/github.com/minio/minio-go/v7/post-policy.go index 7aa96e0d6..7bf560304 100644 --- a/vendor/github.com/minio/minio-go/v7/post-policy.go +++ b/vendor/github.com/minio/minio-go/v7/post-policy.go @@ -197,8 +197,8 @@ func (p *PostPolicy) SetContentLengthRange(min, max int64) error { if min < 0 { return errInvalidArgument("Minimum limit cannot be negative.") } - if max < 0 { - return errInvalidArgument("Maximum limit cannot be negative.") + if max <= 0 { + return errInvalidArgument("Maximum limit cannot be non-positive.") } p.contentLengthRange.min = min p.contentLengthRange.max = max diff --git a/vendor/github.com/minio/minio-go/v7/retry.go b/vendor/github.com/minio/minio-go/v7/retry.go index f454e675c..055c14c4d 100644 --- a/vendor/github.com/minio/minio-go/v7/retry.go +++ b/vendor/github.com/minio/minio-go/v7/retry.go @@ -19,7 +19,10 @@ package minio import ( "context" + "crypto/x509" + "errors" "net/http" + "net/url" "time" ) @@ -123,3 +126,23 @@ func isHTTPStatusRetryable(httpStatusCode int) (ok bool) { _, ok = retryableHTTPStatusCodes[httpStatusCode] return ok } + +// For now, all http Do() requests are retriable except some well defined errors +func isRequestErrorRetryable(err error) bool { + if errors.Is(err, context.Canceled) || errors.Is(err, context.DeadlineExceeded) { + return false + } + if ue, ok := err.(*url.Error); ok { + e := ue.Unwrap() + switch e.(type) { + // x509: certificate signed by unknown authority + case x509.UnknownAuthorityError: + return false + } + switch e.Error() { + case "http: server gave HTTP response to HTTPS client": + return false + } + } + return true +} diff --git a/vendor/github.com/minio/sha256-simd/.travis.yml b/vendor/github.com/minio/sha256-simd/.travis.yml deleted file mode 100644 index 4f85db539..000000000 --- a/vendor/github.com/minio/sha256-simd/.travis.yml +++ /dev/null @@ -1,25 +0,0 @@ -sudo: required -dist: trusty -language: go - -os: -- linux - -go: -- tip -- 1.12.x - -env: -- ARCH=x86_64 -- ARCH=i686 - -matrix: - fast_finish: true - allow_failures: - - go: tip - -script: -- diff -au <(gofmt -d .) <(printf "") -- go test -race -v ./... -- go vet -asmdecl . -- ./test-architectures.sh diff --git a/vendor/github.com/minio/sha256-simd/README.md b/vendor/github.com/minio/sha256-simd/README.md index 5282d83ad..6117488d7 100644 --- a/vendor/github.com/minio/sha256-simd/README.md +++ b/vendor/github.com/minio/sha256-simd/README.md @@ -1,14 +1,18 @@ # sha256-simd -Accelerate SHA256 computations in pure Go using AVX512, SHA Extensions and AVX2 for Intel and ARM64 for ARM. On AVX512 it provides an up to 8x improvement (over 3 GB/s per core) in comparison to AVX2. SHA Extensions give a performance boost of close to 4x over AVX2. +Accelerate SHA256 computations in pure Go using AVX512, SHA Extensions for x86 and ARM64 for ARM. +On AVX512 it provides an up to 8x improvement (over 3 GB/s per core). +SHA Extensions give a performance boost of close to 4x over native. ## Introduction -This package is designed as a replacement for `crypto/sha256`. For Intel CPUs it has two flavors for AVX512 and AVX2 (AVX/SSE are also supported). For ARM CPUs with the Cryptography Extensions, advantage is taken of the SHA2 instructions resulting in a massive performance improvement. +This package is designed as a replacement for `crypto/sha256`. +For ARM CPUs with the Cryptography Extensions, advantage is taken of the SHA2 instructions resulting in a massive performance improvement. -This package uses Golang assembly. The AVX512 version is based on the Intel's "multi-buffer crypto library for IPSec" whereas the other Intel implementations are described in "Fast SHA-256 Implementations on Intel Architecture Processors" by J. Guilford et al. +This package uses Golang assembly. +The AVX512 version is based on the Intel's "multi-buffer crypto library for IPSec" whereas the other Intel implementations are described in "Fast SHA-256 Implementations on Intel Architecture Processors" by J. Guilford et al. -## New: Support for Intel SHA Extensions +## Support for Intel SHA Extensions Support for the Intel SHA Extensions has been added by Kristofer Peterson (@svenski123), originally developed for spacemeshos [here](https://github.com/spacemeshos/POET/issues/23). On CPUs that support it (known thus far Intel Celeron J3455 and AMD Ryzen) it gives a significant boost in performance (with thanks to @AudriusButkevicius for reporting the results; full results [here](https://github.com/minio/sha256-simd/pull/37#issuecomment-451607827)). @@ -18,7 +22,9 @@ benchmark AVX2 MB/s SHA Ext MB/s speedup BenchmarkHash5M 514.40 1975.17 3.84x ``` -Thanks to Kristofer Peterson, we also added additional performance changes such as optimized padding, endian conversions which sped up all implementations i.e. Intel SHA alone while doubled performance for small sizes, the other changes increased everything roughly 50%. +Thanks to Kristofer Peterson, we also added additional performance changes such as optimized padding, +endian conversions which sped up all implementations i.e. Intel SHA alone while doubled performance for small sizes, +the other changes increased everything roughly 50%. ## Support for AVX512 @@ -58,7 +64,8 @@ More detailed information can be found in this [blog](https://blog.minio.io/acce ## Drop-In Replacement -The following code snippet shows how you can use `github.com/minio/sha256-simd`. This will automatically select the fastest method for the architecture on which it will be executed. +The following code snippet shows how you can use `github.com/minio/sha256-simd`. +This will automatically select the fastest method for the architecture on which it will be executed. ```go import "github.com/minio/sha256-simd" @@ -80,9 +87,6 @@ Below is the speed in MB/s for a single core (ranked fast to slow) for blocks la | 3.0 GHz Intel Xeon Platinum 8124M | AVX512 | 3498 | | 3.7 GHz AMD Ryzen 7 2700X | SHA Ext | 1979 | | 1.2 GHz ARM Cortex-A53 | ARM64 | 638 | -| 3.0 GHz Intel Xeon Platinum 8124M | AVX2 | 449 | -| 3.1 GHz Intel Core i7 | AVX | 362 | -| 3.1 GHz Intel Core i7 | SSE | 299 | ## asm2plan9s diff --git a/vendor/github.com/minio/sha256-simd/appveyor.yml b/vendor/github.com/minio/sha256-simd/appveyor.yml deleted file mode 100644 index a66bfa9f2..000000000 --- a/vendor/github.com/minio/sha256-simd/appveyor.yml +++ /dev/null @@ -1,32 +0,0 @@ -# version format -version: "{build}" - -# Operating system (build VM template) -os: Windows Server 2012 R2 - -# Platform. -platform: x64 - -clone_folder: c:\gopath\src\github.com\minio\sha256-simd - -# environment variables -environment: - GOPATH: c:\gopath - GO15VENDOREXPERIMENT: 1 - -# scripts that run after cloning repository -install: - - set PATH=%GOPATH%\bin;c:\go\bin;%PATH% - - go version - - go env - -# to run your custom scripts instead of automatic MSBuild -build_script: - - go test . - - go test -race . - -# to disable automatic tests -test: off - -# to disable deployment -deploy: off diff --git a/vendor/github.com/minio/sha256-simd/cpuid.go b/vendor/github.com/minio/sha256-simd/cpuid.go deleted file mode 100644 index 878ad4638..000000000 --- a/vendor/github.com/minio/sha256-simd/cpuid.go +++ /dev/null @@ -1,119 +0,0 @@ -// Minio Cloud Storage, (C) 2016 Minio, Inc. -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. -// - -package sha256 - -// True when SIMD instructions are available. -var avx512 bool -var avx2 bool -var avx bool -var sse bool -var sse2 bool -var sse3 bool -var ssse3 bool -var sse41 bool -var sse42 bool -var popcnt bool -var sha bool -var armSha = haveArmSha() - -func init() { - var _xsave bool - var _osxsave bool - var _avx bool - var _avx2 bool - var _avx512f bool - var _avx512dq bool - // var _avx512pf bool - // var _avx512er bool - // var _avx512cd bool - var _avx512bw bool - var _avx512vl bool - var _sseState bool - var _avxState bool - var _opmaskState bool - var _zmmHI256State bool - var _hi16ZmmState bool - - mfi, _, _, _ := cpuid(0) - - if mfi >= 1 { - _, _, c, d := cpuid(1) - - sse = (d & (1 << 25)) != 0 - sse2 = (d & (1 << 26)) != 0 - sse3 = (c & (1 << 0)) != 0 - ssse3 = (c & (1 << 9)) != 0 - sse41 = (c & (1 << 19)) != 0 - sse42 = (c & (1 << 20)) != 0 - popcnt = (c & (1 << 23)) != 0 - _xsave = (c & (1 << 26)) != 0 - _osxsave = (c & (1 << 27)) != 0 - _avx = (c & (1 << 28)) != 0 - } - - if mfi >= 7 { - _, b, _, _ := cpuid(7) - - _avx2 = (b & (1 << 5)) != 0 - _avx512f = (b & (1 << 16)) != 0 - _avx512dq = (b & (1 << 17)) != 0 - // _avx512pf = (b & (1 << 26)) != 0 - // _avx512er = (b & (1 << 27)) != 0 - // _avx512cd = (b & (1 << 28)) != 0 - _avx512bw = (b & (1 << 30)) != 0 - _avx512vl = (b & (1 << 31)) != 0 - sha = (b & (1 << 29)) != 0 - } - - // Stop here if XSAVE unsupported or not enabled - if !_xsave || !_osxsave { - return - } - - if _xsave && _osxsave { - a, _ := xgetbv(0) - - _sseState = (a & (1 << 1)) != 0 - _avxState = (a & (1 << 2)) != 0 - _opmaskState = (a & (1 << 5)) != 0 - _zmmHI256State = (a & (1 << 6)) != 0 - _hi16ZmmState = (a & (1 << 7)) != 0 - } else { - _sseState = true - } - - // Very unlikely that OS would enable XSAVE and then disable SSE - if !_sseState { - sse = false - sse2 = false - sse3 = false - ssse3 = false - sse41 = false - sse42 = false - } - - if _avxState { - avx = _avx - avx2 = _avx2 - } - - if _opmaskState && _zmmHI256State && _hi16ZmmState { - avx512 = (_avx512f && - _avx512dq && - _avx512bw && - _avx512vl) - } -} diff --git a/vendor/github.com/minio/sha256-simd/cpuid_386.go b/vendor/github.com/minio/sha256-simd/cpuid_386.go deleted file mode 100644 index c9890be47..000000000 --- a/vendor/github.com/minio/sha256-simd/cpuid_386.go +++ /dev/null @@ -1,24 +0,0 @@ -// Minio Cloud Storage, (C) 2016 Minio, Inc. -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. -// - -package sha256 - -func cpuid(op uint32) (eax, ebx, ecx, edx uint32) -func cpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32) -func xgetbv(index uint32) (eax, edx uint32) - -func haveArmSha() bool { - return false -} diff --git a/vendor/github.com/minio/sha256-simd/cpuid_386.s b/vendor/github.com/minio/sha256-simd/cpuid_386.s deleted file mode 100644 index 1511cd6f6..000000000 --- a/vendor/github.com/minio/sha256-simd/cpuid_386.s +++ /dev/null @@ -1,53 +0,0 @@ -// The MIT License (MIT) -// -// Copyright (c) 2015 Klaus Post -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in all -// copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE -// SOFTWARE. - -// +build 386,!gccgo - -// func cpuid(op uint32) (eax, ebx, ecx, edx uint32) -TEXT ·cpuid(SB), 7, $0 - XORL CX, CX - MOVL op+0(FP), AX - CPUID - MOVL AX, eax+4(FP) - MOVL BX, ebx+8(FP) - MOVL CX, ecx+12(FP) - MOVL DX, edx+16(FP) - RET - -// func cpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32) -TEXT ·cpuidex(SB), 7, $0 - MOVL op+0(FP), AX - MOVL op2+4(FP), CX - CPUID - MOVL AX, eax+8(FP) - MOVL BX, ebx+12(FP) - MOVL CX, ecx+16(FP) - MOVL DX, edx+20(FP) - RET - -// func xgetbv(index uint32) (eax, edx uint32) -TEXT ·xgetbv(SB), 7, $0 - MOVL index+0(FP), CX - BYTE $0x0f; BYTE $0x01; BYTE $0xd0 // XGETBV - MOVL AX, eax+4(FP) - MOVL DX, edx+8(FP) - RET diff --git a/vendor/github.com/minio/sha256-simd/cpuid_amd64.go b/vendor/github.com/minio/sha256-simd/cpuid_amd64.go deleted file mode 100644 index c9890be47..000000000 --- a/vendor/github.com/minio/sha256-simd/cpuid_amd64.go +++ /dev/null @@ -1,24 +0,0 @@ -// Minio Cloud Storage, (C) 2016 Minio, Inc. -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. -// - -package sha256 - -func cpuid(op uint32) (eax, ebx, ecx, edx uint32) -func cpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32) -func xgetbv(index uint32) (eax, edx uint32) - -func haveArmSha() bool { - return false -} diff --git a/vendor/github.com/minio/sha256-simd/cpuid_amd64.s b/vendor/github.com/minio/sha256-simd/cpuid_amd64.s deleted file mode 100644 index b0f414748..000000000 --- a/vendor/github.com/minio/sha256-simd/cpuid_amd64.s +++ /dev/null @@ -1,53 +0,0 @@ -// The MIT License (MIT) -// -// Copyright (c) 2015 Klaus Post -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in all -// copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE -// SOFTWARE. - -// +build amd64,!gccgo - -// func cpuid(op uint32) (eax, ebx, ecx, edx uint32) -TEXT ·cpuid(SB), 7, $0 - XORQ CX, CX - MOVL op+0(FP), AX - CPUID - MOVL AX, eax+8(FP) - MOVL BX, ebx+12(FP) - MOVL CX, ecx+16(FP) - MOVL DX, edx+20(FP) - RET - -// func cpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32) -TEXT ·cpuidex(SB), 7, $0 - MOVL op+0(FP), AX - MOVL op2+4(FP), CX - CPUID - MOVL AX, eax+8(FP) - MOVL BX, ebx+12(FP) - MOVL CX, ecx+16(FP) - MOVL DX, edx+20(FP) - RET - -// func xgetbv(index uint32) (eax, edx uint32) -TEXT ·xgetbv(SB), 7, $0 - MOVL index+0(FP), CX - BYTE $0x0f; BYTE $0x01; BYTE $0xd0 // XGETBV - MOVL AX, eax+8(FP) - MOVL DX, edx+12(FP) - RET diff --git a/vendor/github.com/minio/sha256-simd/cpuid_linux_arm64.go b/vendor/github.com/minio/sha256-simd/cpuid_linux_arm64.go deleted file mode 100644 index e739996d9..000000000 --- a/vendor/github.com/minio/sha256-simd/cpuid_linux_arm64.go +++ /dev/null @@ -1,49 +0,0 @@ -// +build arm64,linux - -// Minio Cloud Storage, (C) 2016 Minio, Inc. -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. -// - -package sha256 - -import ( - "bytes" - "io/ioutil" -) - -func cpuid(op uint32) (eax, ebx, ecx, edx uint32) { - return 0, 0, 0, 0 -} - -func cpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32) { - return 0, 0, 0, 0 -} - -func xgetbv(index uint32) (eax, edx uint32) { - return 0, 0 -} - -// File to check for cpu capabilities. -const procCPUInfo = "/proc/cpuinfo" - -// Feature to check for. -const sha256Feature = "sha2" - -func haveArmSha() bool { - cpuInfo, err := ioutil.ReadFile(procCPUInfo) - if err != nil { - return false - } - return bytes.Contains(cpuInfo, []byte(sha256Feature)) -} diff --git a/vendor/github.com/minio/sha256-simd/cpuid_other.go b/vendor/github.com/minio/sha256-simd/cpuid_other.go index 3e4415828..cd9fbf2d9 100644 --- a/vendor/github.com/minio/sha256-simd/cpuid_other.go +++ b/vendor/github.com/minio/sha256-simd/cpuid_other.go @@ -1,4 +1,4 @@ -// Minio Cloud Storage, (C) 2016 Minio, Inc. +// Minio Cloud Storage, (C) 2021 Minio, Inc. // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. @@ -13,22 +13,34 @@ // limitations under the License. // -// +build !386,!amd64,!arm,!arm64 arm64,!linux - package sha256 -func cpuid(op uint32) (eax, ebx, ecx, edx uint32) { - return 0, 0, 0, 0 -} +import ( + "bytes" + "io/ioutil" + "runtime" -func cpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32) { - return 0, 0, 0, 0 -} + "github.com/klauspost/cpuid/v2" +) -func xgetbv(index uint32) (eax, edx uint32) { - return 0, 0 -} +func hasArmSha2() bool { + if cpuid.CPU.Has(cpuid.SHA2) { + return true + } + if runtime.GOARCH != "arm64" || runtime.GOOS != "linux" { + return false + } + + // Fall back to hacky cpuinfo parsing... + const procCPUInfo = "/proc/cpuinfo" + + // Feature to check for. + const sha256Feature = "sha2" + + cpuInfo, err := ioutil.ReadFile(procCPUInfo) + if err != nil { + return false + } + return bytes.Contains(cpuInfo, []byte(sha256Feature)) -func haveArmSha() bool { - return false } diff --git a/vendor/github.com/minio/sha256-simd/sha256.go b/vendor/github.com/minio/sha256-simd/sha256.go index 4e1f6d2f7..b137ead9f 100644 --- a/vendor/github.com/minio/sha256-simd/sha256.go +++ b/vendor/github.com/minio/sha256-simd/sha256.go @@ -21,6 +21,8 @@ import ( "encoding/binary" "hash" "runtime" + + "github.com/klauspost/cpuid/v2" ) // Size - The size of a SHA256 checksum in bytes. @@ -67,10 +69,6 @@ type blockfuncType int const ( blockfuncGeneric blockfuncType = iota - blockfuncAvx512 blockfuncType = iota - blockfuncAvx2 blockfuncType = iota - blockfuncAvx blockfuncType = iota - blockfuncSsse blockfuncType = iota blockfuncSha blockfuncType = iota blockfuncArm blockfuncType = iota ) @@ -78,26 +76,24 @@ const ( var blockfunc blockfuncType func init() { - is386bit := runtime.GOARCH == "386" - isARM := runtime.GOARCH == "arm" + blockfunc = blockfuncGeneric switch { - case is386bit || isARM: - blockfunc = blockfuncGeneric - case sha && ssse3 && sse41: + case hasSHAExtensions(): blockfunc = blockfuncSha - case avx2: - blockfunc = blockfuncAvx2 - case avx: - blockfunc = blockfuncAvx - case ssse3: - blockfunc = blockfuncSsse - case armSha: + case hasArmSha2(): blockfunc = blockfuncArm default: blockfunc = blockfuncGeneric } } +var avx512 = cpuid.CPU.Supports(cpuid.AVX512F, cpuid.AVX512DQ, cpuid.AVX512BW, cpuid.AVX512VL) + +// hasSHAExtensions return whether the cpu supports SHA extensions. +func hasSHAExtensions() bool { + return cpuid.CPU.Supports(cpuid.SHA, cpuid.SSSE3, cpuid.SSE4) && runtime.GOARCH == "amd64" +} + // New returns a new hash.Hash computing the SHA256 checksum. func New() hash.Hash { if blockfunc != blockfuncGeneric { @@ -278,12 +274,6 @@ func (d *digest) checkSum() (digest [Size]byte) { func block(dig *digest, p []byte) { if blockfunc == blockfuncSha { blockShaGo(dig, p) - } else if blockfunc == blockfuncAvx2 { - blockAvx2Go(dig, p) - } else if blockfunc == blockfuncAvx { - blockAvxGo(dig, p) - } else if blockfunc == blockfuncSsse { - blockSsseGo(dig, p) } else if blockfunc == blockfuncArm { blockArmGo(dig, p) } else if blockfunc == blockfuncGeneric { diff --git a/vendor/github.com/minio/sha256-simd/sha256blockAvx2_amd64.go b/vendor/github.com/minio/sha256-simd/sha256blockAvx2_amd64.go deleted file mode 100644 index 52fcaee6d..000000000 --- a/vendor/github.com/minio/sha256-simd/sha256blockAvx2_amd64.go +++ /dev/null @@ -1,22 +0,0 @@ -//+build !noasm,!appengine - -/* - * Minio Cloud Storage, (C) 2016 Minio, Inc. - * - * Licensed under the Apache License, Version 2.0 (the "License"); - * you may not use this file except in compliance with the License. - * You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package sha256 - -//go:noescape -func blockAvx2(h []uint32, message []uint8) diff --git a/vendor/github.com/minio/sha256-simd/sha256blockAvx2_amd64.s b/vendor/github.com/minio/sha256-simd/sha256blockAvx2_amd64.s deleted file mode 100644 index 80b0b739b..000000000 --- a/vendor/github.com/minio/sha256-simd/sha256blockAvx2_amd64.s +++ /dev/null @@ -1,1449 +0,0 @@ -//+build !noasm,!appengine - -// SHA256 implementation for AVX2 - -// -// Minio Cloud Storage, (C) 2016 Minio, Inc. -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. -// - -// -// This code is based on an Intel White-Paper: -// "Fast SHA-256 Implementations on Intel Architecture Processors" -// -// together with the reference implementation from the following authors: -// James Guilford <james.guilford@intel.com> -// Kirk Yap <kirk.s.yap@intel.com> -// Tim Chen <tim.c.chen@linux.intel.com> -// -// For Golang it has been converted to Plan 9 assembly with the help of -// github.com/minio/asm2plan9s to assemble Intel instructions to their Plan9 -// equivalents -// - -DATA K256<>+0x000(SB)/8, $0x71374491428a2f98 -DATA K256<>+0x008(SB)/8, $0xe9b5dba5b5c0fbcf -DATA K256<>+0x010(SB)/8, $0x71374491428a2f98 -DATA K256<>+0x018(SB)/8, $0xe9b5dba5b5c0fbcf -DATA K256<>+0x020(SB)/8, $0x59f111f13956c25b -DATA K256<>+0x028(SB)/8, $0xab1c5ed5923f82a4 -DATA K256<>+0x030(SB)/8, $0x59f111f13956c25b -DATA K256<>+0x038(SB)/8, $0xab1c5ed5923f82a4 -DATA K256<>+0x040(SB)/8, $0x12835b01d807aa98 -DATA K256<>+0x048(SB)/8, $0x550c7dc3243185be -DATA K256<>+0x050(SB)/8, $0x12835b01d807aa98 -DATA K256<>+0x058(SB)/8, $0x550c7dc3243185be -DATA K256<>+0x060(SB)/8, $0x80deb1fe72be5d74 -DATA K256<>+0x068(SB)/8, $0xc19bf1749bdc06a7 -DATA K256<>+0x070(SB)/8, $0x80deb1fe72be5d74 -DATA K256<>+0x078(SB)/8, $0xc19bf1749bdc06a7 -DATA K256<>+0x080(SB)/8, $0xefbe4786e49b69c1 -DATA K256<>+0x088(SB)/8, $0x240ca1cc0fc19dc6 -DATA K256<>+0x090(SB)/8, $0xefbe4786e49b69c1 -DATA K256<>+0x098(SB)/8, $0x240ca1cc0fc19dc6 -DATA K256<>+0x0a0(SB)/8, $0x4a7484aa2de92c6f -DATA K256<>+0x0a8(SB)/8, $0x76f988da5cb0a9dc -DATA K256<>+0x0b0(SB)/8, $0x4a7484aa2de92c6f -DATA K256<>+0x0b8(SB)/8, $0x76f988da5cb0a9dc -DATA K256<>+0x0c0(SB)/8, $0xa831c66d983e5152 -DATA K256<>+0x0c8(SB)/8, $0xbf597fc7b00327c8 -DATA K256<>+0x0d0(SB)/8, $0xa831c66d983e5152 -DATA K256<>+0x0d8(SB)/8, $0xbf597fc7b00327c8 -DATA K256<>+0x0e0(SB)/8, $0xd5a79147c6e00bf3 -DATA K256<>+0x0e8(SB)/8, $0x1429296706ca6351 -DATA K256<>+0x0f0(SB)/8, $0xd5a79147c6e00bf3 -DATA K256<>+0x0f8(SB)/8, $0x1429296706ca6351 -DATA K256<>+0x100(SB)/8, $0x2e1b213827b70a85 -DATA K256<>+0x108(SB)/8, $0x53380d134d2c6dfc -DATA K256<>+0x110(SB)/8, $0x2e1b213827b70a85 -DATA K256<>+0x118(SB)/8, $0x53380d134d2c6dfc -DATA K256<>+0x120(SB)/8, $0x766a0abb650a7354 -DATA K256<>+0x128(SB)/8, $0x92722c8581c2c92e -DATA K256<>+0x130(SB)/8, $0x766a0abb650a7354 -DATA K256<>+0x138(SB)/8, $0x92722c8581c2c92e -DATA K256<>+0x140(SB)/8, $0xa81a664ba2bfe8a1 -DATA K256<>+0x148(SB)/8, $0xc76c51a3c24b8b70 -DATA K256<>+0x150(SB)/8, $0xa81a664ba2bfe8a1 -DATA K256<>+0x158(SB)/8, $0xc76c51a3c24b8b70 -DATA K256<>+0x160(SB)/8, $0xd6990624d192e819 -DATA K256<>+0x168(SB)/8, $0x106aa070f40e3585 -DATA K256<>+0x170(SB)/8, $0xd6990624d192e819 -DATA K256<>+0x178(SB)/8, $0x106aa070f40e3585 -DATA K256<>+0x180(SB)/8, $0x1e376c0819a4c116 -DATA K256<>+0x188(SB)/8, $0x34b0bcb52748774c -DATA K256<>+0x190(SB)/8, $0x1e376c0819a4c116 -DATA K256<>+0x198(SB)/8, $0x34b0bcb52748774c -DATA K256<>+0x1a0(SB)/8, $0x4ed8aa4a391c0cb3 -DATA K256<>+0x1a8(SB)/8, $0x682e6ff35b9cca4f -DATA K256<>+0x1b0(SB)/8, $0x4ed8aa4a391c0cb3 -DATA K256<>+0x1b8(SB)/8, $0x682e6ff35b9cca4f -DATA K256<>+0x1c0(SB)/8, $0x78a5636f748f82ee -DATA K256<>+0x1c8(SB)/8, $0x8cc7020884c87814 -DATA K256<>+0x1d0(SB)/8, $0x78a5636f748f82ee -DATA K256<>+0x1d8(SB)/8, $0x8cc7020884c87814 -DATA K256<>+0x1e0(SB)/8, $0xa4506ceb90befffa -DATA K256<>+0x1e8(SB)/8, $0xc67178f2bef9a3f7 -DATA K256<>+0x1f0(SB)/8, $0xa4506ceb90befffa -DATA K256<>+0x1f8(SB)/8, $0xc67178f2bef9a3f7 - -DATA K256<>+0x200(SB)/8, $0x0405060700010203 -DATA K256<>+0x208(SB)/8, $0x0c0d0e0f08090a0b -DATA K256<>+0x210(SB)/8, $0x0405060700010203 -DATA K256<>+0x218(SB)/8, $0x0c0d0e0f08090a0b -DATA K256<>+0x220(SB)/8, $0x0b0a090803020100 -DATA K256<>+0x228(SB)/8, $0xffffffffffffffff -DATA K256<>+0x230(SB)/8, $0x0b0a090803020100 -DATA K256<>+0x238(SB)/8, $0xffffffffffffffff -DATA K256<>+0x240(SB)/8, $0xffffffffffffffff -DATA K256<>+0x248(SB)/8, $0x0b0a090803020100 -DATA K256<>+0x250(SB)/8, $0xffffffffffffffff -DATA K256<>+0x258(SB)/8, $0x0b0a090803020100 - -GLOBL K256<>(SB), 8, $608 - -// We need 0x220 stack space aligned on a 512 boundary, so for the -// worstcase-aligned SP we need twice this amount, being 1088 (=0x440) -// -// SP aligned end-aligned stacksize -// 100013d0 10001400 10001620 592 -// 100013d8 10001400 10001620 584 -// 100013e0 10001600 10001820 1088 -// 100013e8 10001600 10001820 1080 - -// func blockAvx2(h []uint32, message []uint8) -TEXT ·blockAvx2(SB),$1088-48 - - MOVQ h+0(FP), DI // DI: &h - MOVQ message_base+24(FP), SI // SI: &message - MOVQ message_len+32(FP), DX // len(message) - ADDQ SI, DX // end pointer of input - MOVQ SP, R11 // copy stack pointer - ADDQ $0x220, SP // sp += 0x220 - ANDQ $0xfffffffffffffe00, SP // align stack frame - ADDQ $0x1c0, SP - MOVQ DI, 0x40(SP) // save ctx - MOVQ SI, 0x48(SP) // save input - MOVQ DX, 0x50(SP) // save end pointer - MOVQ R11, 0x58(SP) // save copy of stack pointer - - WORD $0xf8c5; BYTE $0x77 // vzeroupper - ADDQ $0x40, SI // input++ - MOVL (DI), AX - MOVQ SI, R12 // borrow $T1 - MOVL 4(DI), BX - CMPQ SI, DX // $_end - MOVL 8(DI), CX - LONG $0xe4440f4c // cmove r12,rsp /* next block or random data */ - MOVL 12(DI), DX - MOVL 16(DI), R8 - MOVL 20(DI), R9 - MOVL 24(DI), R10 - MOVL 28(DI), R11 - - LEAQ K256<>(SB), BP - LONG $0x856f7dc5; LONG $0x00000220 // VMOVDQA YMM8, 0x220[rbp] /* vmovdqa ymm8,YMMWORD PTR [rip+0x220] */ - LONG $0x8d6f7dc5; LONG $0x00000240 // VMOVDQA YMM9, 0x240[rbp] /* vmovdqa ymm9,YMMWORD PTR [rip+0x240] */ - LONG $0x956f7dc5; LONG $0x00000200 // VMOVDQA YMM10, 0x200[rbp] /* vmovdqa ymm7,YMMWORD PTR [rip+0x200] */ - -loop0: - LONG $0x6f7dc1c4; BYTE $0xfa // VMOVDQA YMM7, YMM10 - - // Load first 16 dwords from two blocks - MOVOU -64(SI), X0 // vmovdqu xmm0,XMMWORD PTR [rsi-0x40] - MOVOU -48(SI), X1 // vmovdqu xmm1,XMMWORD PTR [rsi-0x30] - MOVOU -32(SI), X2 // vmovdqu xmm2,XMMWORD PTR [rsi-0x20] - MOVOU -16(SI), X3 // vmovdqu xmm3,XMMWORD PTR [rsi-0x10] - - // Byte swap data and transpose data into high/low - LONG $0x387dc3c4; WORD $0x2404; BYTE $0x01 // vinserti128 ymm0,ymm0,[r12],0x1 - LONG $0x3875c3c4; LONG $0x0110244c // vinserti128 ymm1,ymm1,0x10[r12],0x1 - LONG $0x007de2c4; BYTE $0xc7 // vpshufb ymm0,ymm0,ymm7 - LONG $0x386dc3c4; LONG $0x01202454 // vinserti128 ymm2,ymm2,0x20[r12],0x1 - LONG $0x0075e2c4; BYTE $0xcf // vpshufb ymm1,ymm1,ymm7 - LONG $0x3865c3c4; LONG $0x0130245c // vinserti128 ymm3,ymm3,0x30[r12],0x1 - - LEAQ K256<>(SB), BP - LONG $0x006de2c4; BYTE $0xd7 // vpshufb ymm2,ymm2,ymm7 - LONG $0x65fefdc5; BYTE $0x00 // vpaddd ymm4,ymm0,[rbp] - LONG $0x0065e2c4; BYTE $0xdf // vpshufb ymm3,ymm3,ymm7 - LONG $0x6dfef5c5; BYTE $0x20 // vpaddd ymm5,ymm1,0x20[rbp] - LONG $0x75feedc5; BYTE $0x40 // vpaddd ymm6,ymm2,0x40[rbp] - LONG $0x7dfee5c5; BYTE $0x60 // vpaddd ymm7,ymm3,0x60[rbp] - - LONG $0x247ffdc5; BYTE $0x24 // vmovdqa [rsp],ymm4 - XORQ R14, R14 - LONG $0x6c7ffdc5; WORD $0x2024 // vmovdqa [rsp+0x20],ymm5 - - ADDQ $-0x40, SP - MOVQ BX, DI - LONG $0x347ffdc5; BYTE $0x24 // vmovdqa [rsp],ymm6 - XORQ CX, DI // magic - LONG $0x7c7ffdc5; WORD $0x2024 // vmovdqa [rsp+0x20],ymm7 - MOVQ R9, R12 - ADDQ $0x80, BP - -loop1: - // Schedule 48 input dwords, by doing 3 rounds of 12 each - // Note: SIMD instructions are interleaved with the SHA calculations - ADDQ $-0x40, SP - LONG $0x0f75e3c4; WORD $0x04e0 // vpalignr ymm4,ymm1,ymm0,0x4 - - // ROUND(AX, BX, CX, DX, R8, R9, R10, R11, R12, R13, R14, R15, DI, SP, 0x80) - LONG $0x249c0344; LONG $0x00000080 // add r11d,[rsp+0x80] - WORD $0x2145; BYTE $0xc4 // and r12d,r8d - LONG $0xf07b43c4; WORD $0x19e8 // rorx r13d,r8d,0x19 - LONG $0x0f65e3c4; WORD $0x04fa // vpalignr ymm7,ymm3,ymm2,0x4 - LONG $0xf07b43c4; WORD $0x0bf8 // rorx r15d,r8d,0xb - LONG $0x30048d42 // lea eax,[rax+r14*1] - LONG $0x231c8d47 // lea r11d,[r11+r12*1] - LONG $0xd472cdc5; BYTE $0x07 // vpsrld ymm6,ymm4,0x7 - LONG $0xf23842c4; BYTE $0xe2 // andn r12d,r8d,r10d - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b43c4; WORD $0x06f0 // rorx r14d,r8d,0x6 - LONG $0xc7fefdc5 // vpaddd ymm0,ymm0,ymm7 - LONG $0x231c8d47 // lea r11d,[r11+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8941; BYTE $0xc7 // mov r15d,eax - LONG $0xd472c5c5; BYTE $0x03 // vpsrld ymm7,ymm4,0x3 - LONG $0xf07b63c4; WORD $0x16e0 // rorx r12d,eax,0x16 - LONG $0x2b1c8d47 // lea r11d,[r11+r13*1] - WORD $0x3141; BYTE $0xdf // xor r15d,ebx - LONG $0xf472d5c5; BYTE $0x0e // vpslld ymm5,ymm4,0xe - LONG $0xf07b63c4; WORD $0x0df0 // rorx r14d,eax,0xd - LONG $0xf07b63c4; WORD $0x02e8 // rorx r13d,eax,0x2 - LONG $0x1a148d42 // lea edx,[rdx+r11*1] - LONG $0xe6efc5c5 // vpxor ymm4,ymm7,ymm6 - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0xdf31 // xor edi,ebx - LONG $0xfb70fdc5; BYTE $0xfa // vpshufd ymm7,ymm3,0xfa - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x3b1c8d45 // lea r11d,[r11+rdi*1] - WORD $0x8945; BYTE $0xc4 // mov r12d,r8d - LONG $0xd672cdc5; BYTE $0x0b // vpsrld ymm6,ymm6,0xb - - // ROUND(R11, AX, BX, CX, DX, R8, R9, R10, R12, R13, R14, DI, R15, SP, 0x84) - LONG $0x24940344; LONG $0x00000084 // add r10d,[rsp+0x84] - WORD $0x2141; BYTE $0xd4 // and r12d,edx - LONG $0xf07b63c4; WORD $0x19ea // rorx r13d,edx,0x19 - LONG $0xe5efddc5 // vpxor ymm4,ymm4,ymm5 - LONG $0xf07be3c4; WORD $0x0bfa // rorx edi,edx,0xb - LONG $0x331c8d47 // lea r11d,[r11+r14*1] - LONG $0x22148d47 // lea r10d,[r10+r12*1] - LONG $0xf572d5c5; BYTE $0x0b // vpslld ymm5,ymm5,0xb - LONG $0xf26842c4; BYTE $0xe1 // andn r12d,edx,r9d - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b63c4; WORD $0x06f2 // rorx r14d,edx,0x6 - LONG $0xe6efddc5 // vpxor ymm4,ymm4,ymm6 - LONG $0x22148d47 // lea r10d,[r10+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8944; BYTE $0xdf // mov edi,r11d - LONG $0xd772cdc5; BYTE $0x0a // vpsrld ymm6,ymm7,0xa - LONG $0xf07b43c4; WORD $0x16e3 // rorx r12d,r11d,0x16 - LONG $0x2a148d47 // lea r10d,[r10+r13*1] - WORD $0xc731 // xor edi,eax - LONG $0xe5efddc5 // vpxor ymm4,ymm4,ymm5 - LONG $0xf07b43c4; WORD $0x0df3 // rorx r14d,r11d,0xd - LONG $0xf07b43c4; WORD $0x02eb // rorx r13d,r11d,0x2 - LONG $0x110c8d42 // lea ecx,[rcx+r10*1] - LONG $0xd773c5c5; BYTE $0x11 // vpsrlq ymm7,ymm7,0x11 - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3141; BYTE $0xc7 // xor r15d,eax - LONG $0xc4fefdc5 // vpaddd ymm0,ymm0,ymm4 - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x3a148d47 // lea r10d,[r10+r15*1] - WORD $0x8941; BYTE $0xd4 // mov r12d,edx - LONG $0xf7efcdc5 // vpxor ymm6,ymm6,ymm7 - - // ROUND(R10, R11, AX, BX, CX, DX, R8, R9, R12, R13, R14, R15, DI, SP, 0x88) - LONG $0x248c0344; LONG $0x00000088 // add r9d,[rsp+0x88] - WORD $0x2141; BYTE $0xcc // and r12d,ecx - LONG $0xf07b63c4; WORD $0x19e9 // rorx r13d,ecx,0x19 - LONG $0xd773c5c5; BYTE $0x02 // vpsrlq ymm7,ymm7,0x2 - LONG $0xf07b63c4; WORD $0x0bf9 // rorx r15d,ecx,0xb - LONG $0x32148d47 // lea r10d,[r10+r14*1] - LONG $0x210c8d47 // lea r9d,[r9+r12*1] - LONG $0xf7efcdc5 // vpxor ymm6,ymm6,ymm7 - LONG $0xf27042c4; BYTE $0xe0 // andn r12d,ecx,r8d - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b63c4; WORD $0x06f1 // rorx r14d,ecx,0x6 - LONG $0x004dc2c4; BYTE $0xf0 // vpshufb ymm6,ymm6,ymm8 - LONG $0x210c8d47 // lea r9d,[r9+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8945; BYTE $0xd7 // mov r15d,r10d - LONG $0xc6fefdc5 // vpaddd ymm0,ymm0,ymm6 - LONG $0xf07b43c4; WORD $0x16e2 // rorx r12d,r10d,0x16 - LONG $0x290c8d47 // lea r9d,[r9+r13*1] - WORD $0x3145; BYTE $0xdf // xor r15d,r11d - LONG $0xf870fdc5; BYTE $0x50 // vpshufd ymm7,ymm0,0x50 - LONG $0xf07b43c4; WORD $0x0df2 // rorx r14d,r10d,0xd - LONG $0xf07b43c4; WORD $0x02ea // rorx r13d,r10d,0x2 - LONG $0x0b1c8d42 // lea ebx,[rbx+r9*1] - LONG $0xd772cdc5; BYTE $0x0a // vpsrld ymm6,ymm7,0xa - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3144; BYTE $0xdf // xor edi,r11d - LONG $0xd773c5c5; BYTE $0x11 // vpsrlq ymm7,ymm7,0x11 - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x390c8d45 // lea r9d,[r9+rdi*1] - WORD $0x8941; BYTE $0xcc // mov r12d,ecx - LONG $0xf7efcdc5 // vpxor ymm6,ymm6,ymm7 - - // ROUND(R9, R10, R11, AX, BX, CX, DX, R8, R12, R13, R14, DI, R15, SP, 0x8c) - LONG $0x24840344; LONG $0x0000008c // add r8d,[rsp+0x8c] - WORD $0x2141; BYTE $0xdc // and r12d,ebx - LONG $0xf07b63c4; WORD $0x19eb // rorx r13d,ebx,0x19 - LONG $0xd773c5c5; BYTE $0x02 // vpsrlq ymm7,ymm7,0x2 - LONG $0xf07be3c4; WORD $0x0bfb // rorx edi,ebx,0xb - LONG $0x310c8d47 // lea r9d,[r9+r14*1] - LONG $0x20048d47 // lea r8d,[r8+r12*1] - LONG $0xf7efcdc5 // vpxor ymm6,ymm6,ymm7 - LONG $0xf26062c4; BYTE $0xe2 // andn r12d,ebx,edx - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b63c4; WORD $0x06f3 // rorx r14d,ebx,0x6 - LONG $0x004dc2c4; BYTE $0xf1 // vpshufb ymm6,ymm6,ymm9 - LONG $0x20048d47 // lea r8d,[r8+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8944; BYTE $0xcf // mov edi,r9d - LONG $0xc6fefdc5 // vpaddd ymm0,ymm0,ymm6 - LONG $0xf07b43c4; WORD $0x16e1 // rorx r12d,r9d,0x16 - LONG $0x28048d47 // lea r8d,[r8+r13*1] - WORD $0x3144; BYTE $0xd7 // xor edi,r10d - LONG $0x75fefdc5; BYTE $0x00 // vpaddd ymm6,ymm0,[rbp+0x0] - LONG $0xf07b43c4; WORD $0x0df1 // rorx r14d,r9d,0xd - LONG $0xf07b43c4; WORD $0x02e9 // rorx r13d,r9d,0x2 - LONG $0x00048d42 // lea eax,[rax+r8*1] - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3145; BYTE $0xd7 // xor r15d,r10d - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x38048d47 // lea r8d,[r8+r15*1] - WORD $0x8941; BYTE $0xdc // mov r12d,ebx - - LONG $0x347ffdc5; BYTE $0x24 // vmovdqa [rsp],ymm6 - LONG $0x0f6de3c4; WORD $0x04e1 // vpalignr ymm4,ymm2,ymm1,0x4 - - // ROUND(R8, R9, R10, R11, AX, BX, CX, DX, R12, R13, R14, R15, DI, SP, 0xa0) - LONG $0xa0249403; WORD $0x0000; BYTE $0x00 // add edx,[rsp+0xa0] - WORD $0x2141; BYTE $0xc4 // and r12d,eax - LONG $0xf07b63c4; WORD $0x19e8 // rorx r13d,eax,0x19 - LONG $0x0f7de3c4; WORD $0x04fb // vpalignr ymm7,ymm0,ymm3,0x4 - LONG $0xf07b63c4; WORD $0x0bf8 // rorx r15d,eax,0xb - LONG $0x30048d47 // lea r8d,[r8+r14*1] - LONG $0x22148d42 // lea edx,[rdx+r12*1] - LONG $0xd472cdc5; BYTE $0x07 // vpsrld ymm6,ymm4,0x7 - LONG $0xf27862c4; BYTE $0xe1 // andn r12d,eax,ecx - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b63c4; WORD $0x06f0 // rorx r14d,eax,0x6 - LONG $0xcffef5c5 // vpaddd ymm1,ymm1,ymm7 - LONG $0x22148d42 // lea edx,[rdx+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8945; BYTE $0xc7 // mov r15d,r8d - LONG $0xd472c5c5; BYTE $0x03 // vpsrld ymm7,ymm4,0x3 - LONG $0xf07b43c4; WORD $0x16e0 // rorx r12d,r8d,0x16 - LONG $0x2a148d42 // lea edx,[rdx+r13*1] - WORD $0x3145; BYTE $0xcf // xor r15d,r9d - LONG $0xf472d5c5; BYTE $0x0e // vpslld ymm5,ymm4,0xe - LONG $0xf07b43c4; WORD $0x0df0 // rorx r14d,r8d,0xd - LONG $0xf07b43c4; WORD $0x02e8 // rorx r13d,r8d,0x2 - LONG $0x131c8d45 // lea r11d,[r11+rdx*1] - LONG $0xe6efc5c5 // vpxor ymm4,ymm7,ymm6 - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3144; BYTE $0xcf // xor edi,r9d - LONG $0xf870fdc5; BYTE $0xfa // vpshufd ymm7,ymm0,0xfa - WORD $0x3145; BYTE $0xee // xor r14d,r13d - WORD $0x148d; BYTE $0x3a // lea edx,[rdx+rdi*1] - WORD $0x8941; BYTE $0xc4 // mov r12d,eax - LONG $0xd672cdc5; BYTE $0x0b // vpsrld ymm6,ymm6,0xb - - // ROUND(DX, R8, R9, R10, R11, AX, BX, CX, R12, R13, R14, DI, R15, SP, 0xa4) - LONG $0xa4248c03; WORD $0x0000; BYTE $0x00 // add ecx,[rsp+0xa4] - WORD $0x2145; BYTE $0xdc // and r12d,r11d - LONG $0xf07b43c4; WORD $0x19eb // rorx r13d,r11d,0x19 - LONG $0xe5efddc5 // vpxor ymm4,ymm4,ymm5 - LONG $0xf07bc3c4; WORD $0x0bfb // rorx edi,r11d,0xb - LONG $0x32148d42 // lea edx,[rdx+r14*1] - LONG $0x210c8d42 // lea ecx,[rcx+r12*1] - LONG $0xf572d5c5; BYTE $0x0b // vpslld ymm5,ymm5,0xb - LONG $0xf22062c4; BYTE $0xe3 // andn r12d,r11d,ebx - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b43c4; WORD $0x06f3 // rorx r14d,r11d,0x6 - LONG $0xe6efddc5 // vpxor ymm4,ymm4,ymm6 - LONG $0x210c8d42 // lea ecx,[rcx+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0xd789 // mov edi,edx - LONG $0xd772cdc5; BYTE $0x0a // vpsrld ymm6,ymm7,0xa - LONG $0xf07b63c4; WORD $0x16e2 // rorx r12d,edx,0x16 - LONG $0x290c8d42 // lea ecx,[rcx+r13*1] - WORD $0x3144; BYTE $0xc7 // xor edi,r8d - LONG $0xe5efddc5 // vpxor ymm4,ymm4,ymm5 - LONG $0xf07b63c4; WORD $0x0df2 // rorx r14d,edx,0xd - LONG $0xf07b63c4; WORD $0x02ea // rorx r13d,edx,0x2 - LONG $0x0a148d45 // lea r10d,[r10+rcx*1] - LONG $0xd773c5c5; BYTE $0x11 // vpsrlq ymm7,ymm7,0x11 - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3145; BYTE $0xc7 // xor r15d,r8d - LONG $0xccfef5c5 // vpaddd ymm1,ymm1,ymm4 - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x390c8d42 // lea ecx,[rcx+r15*1] - WORD $0x8945; BYTE $0xdc // mov r12d,r11d - LONG $0xf7efcdc5 // vpxor ymm6,ymm6,ymm7 - - // ROUND(CX, DX, R8, R9, R10, R11, AX, BX, R12, R13, R14, R15, DI, SP, 0xa8) - LONG $0xa8249c03; WORD $0x0000; BYTE $0x00 // add ebx,[rsp+0xa8] - WORD $0x2145; BYTE $0xd4 // and r12d,r10d - LONG $0xf07b43c4; WORD $0x19ea // rorx r13d,r10d,0x19 - LONG $0xd773c5c5; BYTE $0x02 // vpsrlq ymm7,ymm7,0x2 - LONG $0xf07b43c4; WORD $0x0bfa // rorx r15d,r10d,0xb - LONG $0x310c8d42 // lea ecx,[rcx+r14*1] - LONG $0x231c8d42 // lea ebx,[rbx+r12*1] - LONG $0xf7efcdc5 // vpxor ymm6,ymm6,ymm7 - LONG $0xf22862c4; BYTE $0xe0 // andn r12d,r10d,eax - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b43c4; WORD $0x06f2 // rorx r14d,r10d,0x6 - LONG $0x004dc2c4; BYTE $0xf0 // vpshufb ymm6,ymm6,ymm8 - LONG $0x231c8d42 // lea ebx,[rbx+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8941; BYTE $0xcf // mov r15d,ecx - LONG $0xcefef5c5 // vpaddd ymm1,ymm1,ymm6 - LONG $0xf07b63c4; WORD $0x16e1 // rorx r12d,ecx,0x16 - LONG $0x2b1c8d42 // lea ebx,[rbx+r13*1] - WORD $0x3141; BYTE $0xd7 // xor r15d,edx - LONG $0xf970fdc5; BYTE $0x50 // vpshufd ymm7,ymm1,0x50 - LONG $0xf07b63c4; WORD $0x0df1 // rorx r14d,ecx,0xd - LONG $0xf07b63c4; WORD $0x02e9 // rorx r13d,ecx,0x2 - LONG $0x190c8d45 // lea r9d,[r9+rbx*1] - LONG $0xd772cdc5; BYTE $0x0a // vpsrld ymm6,ymm7,0xa - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0xd731 // xor edi,edx - LONG $0xd773c5c5; BYTE $0x11 // vpsrlq ymm7,ymm7,0x11 - WORD $0x3145; BYTE $0xee // xor r14d,r13d - WORD $0x1c8d; BYTE $0x3b // lea ebx,[rbx+rdi*1] - WORD $0x8945; BYTE $0xd4 // mov r12d,r10d - LONG $0xf7efcdc5 // vpxor ymm6,ymm6,ymm7 - - // ROUND(BX, CX, DX, R8, R9, R10, R11, AX, R12, R13, R14, DI, R15, SP, 0xac) - LONG $0xac248403; WORD $0x0000; BYTE $0x00 // add eax,[rsp+0xac] - WORD $0x2145; BYTE $0xcc // and r12d,r9d - LONG $0xf07b43c4; WORD $0x19e9 // rorx r13d,r9d,0x19 - LONG $0xd773c5c5; BYTE $0x02 // vpsrlq ymm7,ymm7,0x2 - LONG $0xf07bc3c4; WORD $0x0bf9 // rorx edi,r9d,0xb - LONG $0x331c8d42 // lea ebx,[rbx+r14*1] - LONG $0x20048d42 // lea eax,[rax+r12*1] - LONG $0xf7efcdc5 // vpxor ymm6,ymm6,ymm7 - LONG $0xf23042c4; BYTE $0xe3 // andn r12d,r9d,r11d - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b43c4; WORD $0x06f1 // rorx r14d,r9d,0x6 - LONG $0x004dc2c4; BYTE $0xf1 // vpshufb ymm6,ymm6,ymm9 - LONG $0x20048d42 // lea eax,[rax+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0xdf89 // mov edi,ebx - LONG $0xcefef5c5 // vpaddd ymm1,ymm1,ymm6 - LONG $0xf07b63c4; WORD $0x16e3 // rorx r12d,ebx,0x16 - LONG $0x28048d42 // lea eax,[rax+r13*1] - WORD $0xcf31 // xor edi,ecx - LONG $0x75fef5c5; BYTE $0x20 // vpaddd ymm6,ymm1,[rbp+0x20] - LONG $0xf07b63c4; WORD $0x0df3 // rorx r14d,ebx,0xd - LONG $0xf07b63c4; WORD $0x02eb // rorx r13d,ebx,0x2 - LONG $0x00048d45 // lea r8d,[r8+rax*1] - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3141; BYTE $0xcf // xor r15d,ecx - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x38048d42 // lea eax,[rax+r15*1] - WORD $0x8945; BYTE $0xcc // mov r12d,r9d - - LONG $0x747ffdc5; WORD $0x2024 // vmovdqa [rsp+0x20],ymm6 - - LONG $0x24648d48; BYTE $0xc0 // lea rsp,[rsp-0x40] - LONG $0x0f65e3c4; WORD $0x04e2 // vpalignr ymm4,ymm3,ymm2,0x4 - - // ROUND(AX, BX, CX, DX, R8, R9, R10, R11, R12, R13, R14, R15, DI, SP, 0x80) - LONG $0x249c0344; LONG $0x00000080 // add r11d,[rsp+0x80] - WORD $0x2145; BYTE $0xc4 // and r12d,r8d - LONG $0xf07b43c4; WORD $0x19e8 // rorx r13d,r8d,0x19 - LONG $0x0f75e3c4; WORD $0x04f8 // vpalignr ymm7,ymm1,ymm0,0x4 - LONG $0xf07b43c4; WORD $0x0bf8 // rorx r15d,r8d,0xb - LONG $0x30048d42 // lea eax,[rax+r14*1] - LONG $0x231c8d47 // lea r11d,[r11+r12*1] - LONG $0xd472cdc5; BYTE $0x07 // vpsrld ymm6,ymm4,0x7 - LONG $0xf23842c4; BYTE $0xe2 // andn r12d,r8d,r10d - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b43c4; WORD $0x06f0 // rorx r14d,r8d,0x6 - LONG $0xd7feedc5 // vpaddd ymm2,ymm2,ymm7 - LONG $0x231c8d47 // lea r11d,[r11+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8941; BYTE $0xc7 // mov r15d,eax - LONG $0xd472c5c5; BYTE $0x03 // vpsrld ymm7,ymm4,0x3 - LONG $0xf07b63c4; WORD $0x16e0 // rorx r12d,eax,0x16 - LONG $0x2b1c8d47 // lea r11d,[r11+r13*1] - WORD $0x3141; BYTE $0xdf // xor r15d,ebx - LONG $0xf472d5c5; BYTE $0x0e // vpslld ymm5,ymm4,0xe - LONG $0xf07b63c4; WORD $0x0df0 // rorx r14d,eax,0xd - LONG $0xf07b63c4; WORD $0x02e8 // rorx r13d,eax,0x2 - LONG $0x1a148d42 // lea edx,[rdx+r11*1] - LONG $0xe6efc5c5 // vpxor ymm4,ymm7,ymm6 - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0xdf31 // xor edi,ebx - LONG $0xf970fdc5; BYTE $0xfa // vpshufd ymm7,ymm1,0xfa - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x3b1c8d45 // lea r11d,[r11+rdi*1] - WORD $0x8945; BYTE $0xc4 // mov r12d,r8d - LONG $0xd672cdc5; BYTE $0x0b // vpsrld ymm6,ymm6,0xb - - // ROUND(R11, AX, BX, CX, DX, R8, R9, R10, R12, R13, R14, DI, R15, SP, 0x84) - LONG $0x24940344; LONG $0x00000084 // add r10d,[rsp+0x84] - WORD $0x2141; BYTE $0xd4 // and r12d,edx - LONG $0xf07b63c4; WORD $0x19ea // rorx r13d,edx,0x19 - LONG $0xe5efddc5 // vpxor ymm4,ymm4,ymm5 - LONG $0xf07be3c4; WORD $0x0bfa // rorx edi,edx,0xb - LONG $0x331c8d47 // lea r11d,[r11+r14*1] - LONG $0x22148d47 // lea r10d,[r10+r12*1] - LONG $0xf572d5c5; BYTE $0x0b // vpslld ymm5,ymm5,0xb - LONG $0xf26842c4; BYTE $0xe1 // andn r12d,edx,r9d - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b63c4; WORD $0x06f2 // rorx r14d,edx,0x6 - LONG $0xe6efddc5 // vpxor ymm4,ymm4,ymm6 - LONG $0x22148d47 // lea r10d,[r10+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8944; BYTE $0xdf // mov edi,r11d - LONG $0xd772cdc5; BYTE $0x0a // vpsrld ymm6,ymm7,0xa - LONG $0xf07b43c4; WORD $0x16e3 // rorx r12d,r11d,0x16 - LONG $0x2a148d47 // lea r10d,[r10+r13*1] - WORD $0xc731 // xor edi,eax - LONG $0xe5efddc5 // vpxor ymm4,ymm4,ymm5 - LONG $0xf07b43c4; WORD $0x0df3 // rorx r14d,r11d,0xd - LONG $0xf07b43c4; WORD $0x02eb // rorx r13d,r11d,0x2 - LONG $0x110c8d42 // lea ecx,[rcx+r10*1] - LONG $0xd773c5c5; BYTE $0x11 // vpsrlq ymm7,ymm7,0x11 - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3141; BYTE $0xc7 // xor r15d,eax - LONG $0xd4feedc5 // vpaddd ymm2,ymm2,ymm4 - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x3a148d47 // lea r10d,[r10+r15*1] - WORD $0x8941; BYTE $0xd4 // mov r12d,edx - LONG $0xf7efcdc5 // vpxor ymm6,ymm6,ymm7 - - // ROUND(R10, R11, AX, BX, CX, DX, R8, R9, R12, R13, R14, R15, DI, SP, 0x88) - LONG $0x248c0344; LONG $0x00000088 // add r9d,[rsp+0x88] - WORD $0x2141; BYTE $0xcc // and r12d,ecx - LONG $0xf07b63c4; WORD $0x19e9 // rorx r13d,ecx,0x19 - LONG $0xd773c5c5; BYTE $0x02 // vpsrlq ymm7,ymm7,0x2 - LONG $0xf07b63c4; WORD $0x0bf9 // rorx r15d,ecx,0xb - LONG $0x32148d47 // lea r10d,[r10+r14*1] - LONG $0x210c8d47 // lea r9d,[r9+r12*1] - LONG $0xf7efcdc5 // vpxor ymm6,ymm6,ymm7 - LONG $0xf27042c4; BYTE $0xe0 // andn r12d,ecx,r8d - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b63c4; WORD $0x06f1 // rorx r14d,ecx,0x6 - LONG $0x004dc2c4; BYTE $0xf0 // vpshufb ymm6,ymm6,ymm8 - LONG $0x210c8d47 // lea r9d,[r9+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8945; BYTE $0xd7 // mov r15d,r10d - LONG $0xd6feedc5 // vpaddd ymm2,ymm2,ymm6 - LONG $0xf07b43c4; WORD $0x16e2 // rorx r12d,r10d,0x16 - LONG $0x290c8d47 // lea r9d,[r9+r13*1] - WORD $0x3145; BYTE $0xdf // xor r15d,r11d - LONG $0xfa70fdc5; BYTE $0x50 // vpshufd ymm7,ymm2,0x50 - LONG $0xf07b43c4; WORD $0x0df2 // rorx r14d,r10d,0xd - LONG $0xf07b43c4; WORD $0x02ea // rorx r13d,r10d,0x2 - LONG $0x0b1c8d42 // lea ebx,[rbx+r9*1] - LONG $0xd772cdc5; BYTE $0x0a // vpsrld ymm6,ymm7,0xa - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3144; BYTE $0xdf // xor edi,r11d - LONG $0xd773c5c5; BYTE $0x11 // vpsrlq ymm7,ymm7,0x11 - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x390c8d45 // lea r9d,[r9+rdi*1] - WORD $0x8941; BYTE $0xcc // mov r12d,ecx - LONG $0xf7efcdc5 // vpxor ymm6,ymm6,ymm7 - - // ROUND(R9, R10, R11, AX, BX, CX, DX, R8, R12, R13, R14, DI, R15, SP, 0x8c) - LONG $0x24840344; LONG $0x0000008c // add r8d,[rsp+0x8c] - WORD $0x2141; BYTE $0xdc // and r12d,ebx - LONG $0xf07b63c4; WORD $0x19eb // rorx r13d,ebx,0x19 - LONG $0xd773c5c5; BYTE $0x02 // vpsrlq ymm7,ymm7,0x2 - LONG $0xf07be3c4; WORD $0x0bfb // rorx edi,ebx,0xb - LONG $0x310c8d47 // lea r9d,[r9+r14*1] - LONG $0x20048d47 // lea r8d,[r8+r12*1] - LONG $0xf7efcdc5 // vpxor ymm6,ymm6,ymm7 - LONG $0xf26062c4; BYTE $0xe2 // andn r12d,ebx,edx - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b63c4; WORD $0x06f3 // rorx r14d,ebx,0x6 - LONG $0x004dc2c4; BYTE $0xf1 // vpshufb ymm6,ymm6,ymm9 - LONG $0x20048d47 // lea r8d,[r8+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8944; BYTE $0xcf // mov edi,r9d - LONG $0xd6feedc5 // vpaddd ymm2,ymm2,ymm6 - LONG $0xf07b43c4; WORD $0x16e1 // rorx r12d,r9d,0x16 - LONG $0x28048d47 // lea r8d,[r8+r13*1] - WORD $0x3144; BYTE $0xd7 // xor edi,r10d - LONG $0x75feedc5; BYTE $0x40 // vpaddd ymm6,ymm2,[rbp+0x40] - LONG $0xf07b43c4; WORD $0x0df1 // rorx r14d,r9d,0xd - LONG $0xf07b43c4; WORD $0x02e9 // rorx r13d,r9d,0x2 - LONG $0x00048d42 // lea eax,[rax+r8*1] - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3145; BYTE $0xd7 // xor r15d,r10d - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x38048d47 // lea r8d,[r8+r15*1] - WORD $0x8941; BYTE $0xdc // mov r12d,ebx - - LONG $0x347ffdc5; BYTE $0x24 // vmovdqa [rsp],ymm6 - LONG $0x0f7de3c4; WORD $0x04e3 // vpalignr ymm4,ymm0,ymm3,0x4 - - // ROUND(R8, R9, R10, R11, AX, BX, CX, DX, R12, R13, R14, R15, DI, SP, 0xa0) - LONG $0xa0249403; WORD $0x0000; BYTE $0x00 // add edx,[rsp+0xa0] - WORD $0x2141; BYTE $0xc4 // and r12d,eax - LONG $0xf07b63c4; WORD $0x19e8 // rorx r13d,eax,0x19 - LONG $0x0f6de3c4; WORD $0x04f9 // vpalignr ymm7,ymm2,ymm1,0x4 - LONG $0xf07b63c4; WORD $0x0bf8 // rorx r15d,eax,0xb - LONG $0x30048d47 // lea r8d,[r8+r14*1] - LONG $0x22148d42 // lea edx,[rdx+r12*1] - LONG $0xd472cdc5; BYTE $0x07 // vpsrld ymm6,ymm4,0x7 - LONG $0xf27862c4; BYTE $0xe1 // andn r12d,eax,ecx - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b63c4; WORD $0x06f0 // rorx r14d,eax,0x6 - LONG $0xdffee5c5 // vpaddd ymm3,ymm3,ymm7 - LONG $0x22148d42 // lea edx,[rdx+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8945; BYTE $0xc7 // mov r15d,r8d - LONG $0xd472c5c5; BYTE $0x03 // vpsrld ymm7,ymm4,0x3 - LONG $0xf07b43c4; WORD $0x16e0 // rorx r12d,r8d,0x16 - LONG $0x2a148d42 // lea edx,[rdx+r13*1] - WORD $0x3145; BYTE $0xcf // xor r15d,r9d - LONG $0xf472d5c5; BYTE $0x0e // vpslld ymm5,ymm4,0xe - LONG $0xf07b43c4; WORD $0x0df0 // rorx r14d,r8d,0xd - LONG $0xf07b43c4; WORD $0x02e8 // rorx r13d,r8d,0x2 - LONG $0x131c8d45 // lea r11d,[r11+rdx*1] - LONG $0xe6efc5c5 // vpxor ymm4,ymm7,ymm6 - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3144; BYTE $0xcf // xor edi,r9d - LONG $0xfa70fdc5; BYTE $0xfa // vpshufd ymm7,ymm2,0xfa - WORD $0x3145; BYTE $0xee // xor r14d,r13d - WORD $0x148d; BYTE $0x3a // lea edx,[rdx+rdi*1] - WORD $0x8941; BYTE $0xc4 // mov r12d,eax - LONG $0xd672cdc5; BYTE $0x0b // vpsrld ymm6,ymm6,0xb - - // ROUND(DX, R8, R9, R10, R11, AX, BX, CX, R12, R13, R14, DI, R15, SP, 0xa4) - LONG $0xa4248c03; WORD $0x0000; BYTE $0x00 // add ecx,[rsp+0xa4] - WORD $0x2145; BYTE $0xdc // and r12d,r11d - LONG $0xf07b43c4; WORD $0x19eb // rorx r13d,r11d,0x19 - LONG $0xe5efddc5 // vpxor ymm4,ymm4,ymm5 - LONG $0xf07bc3c4; WORD $0x0bfb // rorx edi,r11d,0xb - LONG $0x32148d42 // lea edx,[rdx+r14*1] - LONG $0x210c8d42 // lea ecx,[rcx+r12*1] - LONG $0xf572d5c5; BYTE $0x0b // vpslld ymm5,ymm5,0xb - LONG $0xf22062c4; BYTE $0xe3 // andn r12d,r11d,ebx - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b43c4; WORD $0x06f3 // rorx r14d,r11d,0x6 - LONG $0xe6efddc5 // vpxor ymm4,ymm4,ymm6 - LONG $0x210c8d42 // lea ecx,[rcx+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0xd789 // mov edi,edx - LONG $0xd772cdc5; BYTE $0x0a // vpsrld ymm6,ymm7,0xa - LONG $0xf07b63c4; WORD $0x16e2 // rorx r12d,edx,0x16 - LONG $0x290c8d42 // lea ecx,[rcx+r13*1] - WORD $0x3144; BYTE $0xc7 // xor edi,r8d - LONG $0xe5efddc5 // vpxor ymm4,ymm4,ymm5 - LONG $0xf07b63c4; WORD $0x0df2 // rorx r14d,edx,0xd - LONG $0xf07b63c4; WORD $0x02ea // rorx r13d,edx,0x2 - LONG $0x0a148d45 // lea r10d,[r10+rcx*1] - LONG $0xd773c5c5; BYTE $0x11 // vpsrlq ymm7,ymm7,0x11 - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3145; BYTE $0xc7 // xor r15d,r8d - LONG $0xdcfee5c5 // vpaddd ymm3,ymm3,ymm4 - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x390c8d42 // lea ecx,[rcx+r15*1] - WORD $0x8945; BYTE $0xdc // mov r12d,r11d - LONG $0xf7efcdc5 // vpxor ymm6,ymm6,ymm7 - - // ROUND(CX, DX, R8, R9, R10, R11, AX, BX, R12, R13, R14, R15, DI, SP, 0xa8) - LONG $0xa8249c03; WORD $0x0000; BYTE $0x00 // add ebx,[rsp+0xa8] - WORD $0x2145; BYTE $0xd4 // and r12d,r10d - LONG $0xf07b43c4; WORD $0x19ea // rorx r13d,r10d,0x19 - LONG $0xd773c5c5; BYTE $0x02 // vpsrlq ymm7,ymm7,0x2 - LONG $0xf07b43c4; WORD $0x0bfa // rorx r15d,r10d,0xb - LONG $0x310c8d42 // lea ecx,[rcx+r14*1] - LONG $0x231c8d42 // lea ebx,[rbx+r12*1] - LONG $0xf7efcdc5 // vpxor ymm6,ymm6,ymm7 - LONG $0xf22862c4; BYTE $0xe0 // andn r12d,r10d,eax - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b43c4; WORD $0x06f2 // rorx r14d,r10d,0x6 - LONG $0x004dc2c4; BYTE $0xf0 // vpshufb ymm6,ymm6,ymm8 - LONG $0x231c8d42 // lea ebx,[rbx+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8941; BYTE $0xcf // mov r15d,ecx - LONG $0xdefee5c5 // vpaddd ymm3,ymm3,ymm6 - LONG $0xf07b63c4; WORD $0x16e1 // rorx r12d,ecx,0x16 - LONG $0x2b1c8d42 // lea ebx,[rbx+r13*1] - WORD $0x3141; BYTE $0xd7 // xor r15d,edx - LONG $0xfb70fdc5; BYTE $0x50 // vpshufd ymm7,ymm3,0x50 - LONG $0xf07b63c4; WORD $0x0df1 // rorx r14d,ecx,0xd - LONG $0xf07b63c4; WORD $0x02e9 // rorx r13d,ecx,0x2 - LONG $0x190c8d45 // lea r9d,[r9+rbx*1] - LONG $0xd772cdc5; BYTE $0x0a // vpsrld ymm6,ymm7,0xa - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0xd731 // xor edi,edx - LONG $0xd773c5c5; BYTE $0x11 // vpsrlq ymm7,ymm7,0x11 - WORD $0x3145; BYTE $0xee // xor r14d,r13d - WORD $0x1c8d; BYTE $0x3b // lea ebx,[rbx+rdi*1] - WORD $0x8945; BYTE $0xd4 // mov r12d,r10d - LONG $0xf7efcdc5 // vpxor ymm6,ymm6,ymm7 - - // ROUND(BX, CX, DX, R8, R9, R10, R11, AX, R12, R13, R14, DI, R15, SP, 0xac) - LONG $0xac248403; WORD $0x0000; BYTE $0x00 // add eax,[rsp+0xac] - WORD $0x2145; BYTE $0xcc // and r12d,r9d - LONG $0xf07b43c4; WORD $0x19e9 // rorx r13d,r9d,0x19 - LONG $0xd773c5c5; BYTE $0x02 // vpsrlq ymm7,ymm7,0x2 - LONG $0xf07bc3c4; WORD $0x0bf9 // rorx edi,r9d,0xb - LONG $0x331c8d42 // lea ebx,[rbx+r14*1] - LONG $0x20048d42 // lea eax,[rax+r12*1] - LONG $0xf7efcdc5 // vpxor ymm6,ymm6,ymm7 - LONG $0xf23042c4; BYTE $0xe3 // andn r12d,r9d,r11d - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b43c4; WORD $0x06f1 // rorx r14d,r9d,0x6 - LONG $0x004dc2c4; BYTE $0xf1 // vpshufb ymm6,ymm6,ymm9 - LONG $0x20048d42 // lea eax,[rax+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0xdf89 // mov edi,ebx - LONG $0xdefee5c5 // vpaddd ymm3,ymm3,ymm6 - LONG $0xf07b63c4; WORD $0x16e3 // rorx r12d,ebx,0x16 - LONG $0x28048d42 // lea eax,[rax+r13*1] - WORD $0xcf31 // xor edi,ecx - LONG $0x75fee5c5; BYTE $0x60 // vpaddd ymm6,ymm3,[rbp+0x60] - LONG $0xf07b63c4; WORD $0x0df3 // rorx r14d,ebx,0xd - LONG $0xf07b63c4; WORD $0x02eb // rorx r13d,ebx,0x2 - LONG $0x00048d45 // lea r8d,[r8+rax*1] - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3141; BYTE $0xcf // xor r15d,ecx - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x38048d42 // lea eax,[rax+r15*1] - WORD $0x8945; BYTE $0xcc // mov r12d,r9d - - LONG $0x747ffdc5; WORD $0x2024 // vmovdqa [rsp+0x20],ymm6 - ADDQ $0x80, BP - - CMPB 0x3(BP), $0x0 - JNE loop1 - - // ROUND(AX, BX, CX, DX, R8, R9, R10, R11, R12, R13, R14, R15, DI, SP, 0x40) - LONG $0x245c0344; BYTE $0x40 // add r11d,[rsp+0x40] - WORD $0x2145; BYTE $0xc4 // and r12d,r8d - LONG $0xf07b43c4; WORD $0x19e8 // rorx r13d,r8d,0x19 - LONG $0xf07b43c4; WORD $0x0bf8 // rorx r15d,r8d,0xb - LONG $0x30048d42 // lea eax,[rax+r14*1] - LONG $0x231c8d47 // lea r11d,[r11+r12*1] - LONG $0xf23842c4; BYTE $0xe2 // andn r12d,r8d,r10d - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b43c4; WORD $0x06f0 // rorx r14d,r8d,0x6 - LONG $0x231c8d47 // lea r11d,[r11+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8941; BYTE $0xc7 // mov r15d,eax - LONG $0xf07b63c4; WORD $0x16e0 // rorx r12d,eax,0x16 - LONG $0x2b1c8d47 // lea r11d,[r11+r13*1] - WORD $0x3141; BYTE $0xdf // xor r15d,ebx - LONG $0xf07b63c4; WORD $0x0df0 // rorx r14d,eax,0xd - LONG $0xf07b63c4; WORD $0x02e8 // rorx r13d,eax,0x2 - LONG $0x1a148d42 // lea edx,[rdx+r11*1] - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0xdf31 // xor edi,ebx - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x3b1c8d45 // lea r11d,[r11+rdi*1] - WORD $0x8945; BYTE $0xc4 // mov r12d,r8d - - // ROUND(R11, AX, BX, CX, DX, R8, R9, R10, R12, R13, R14, DI, R15, SP, 0x44) - LONG $0x24540344; BYTE $0x44 // add r10d,[rsp+0x44] - WORD $0x2141; BYTE $0xd4 // and r12d,edx - LONG $0xf07b63c4; WORD $0x19ea // rorx r13d,edx,0x19 - LONG $0xf07be3c4; WORD $0x0bfa // rorx edi,edx,0xb - LONG $0x331c8d47 // lea r11d,[r11+r14*1] - LONG $0x22148d47 // lea r10d,[r10+r12*1] - LONG $0xf26842c4; BYTE $0xe1 // andn r12d,edx,r9d - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b63c4; WORD $0x06f2 // rorx r14d,edx,0x6 - LONG $0x22148d47 // lea r10d,[r10+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8944; BYTE $0xdf // mov edi,r11d - LONG $0xf07b43c4; WORD $0x16e3 // rorx r12d,r11d,0x16 - LONG $0x2a148d47 // lea r10d,[r10+r13*1] - WORD $0xc731 // xor edi,eax - LONG $0xf07b43c4; WORD $0x0df3 // rorx r14d,r11d,0xd - LONG $0xf07b43c4; WORD $0x02eb // rorx r13d,r11d,0x2 - LONG $0x110c8d42 // lea ecx,[rcx+r10*1] - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3141; BYTE $0xc7 // xor r15d,eax - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x3a148d47 // lea r10d,[r10+r15*1] - WORD $0x8941; BYTE $0xd4 // mov r12d,edx - - // ROUND(R10, R11, AX, BX, CX, DX, R8, R9, R12, R13, R14, R15, DI, SP, 0x48) - LONG $0x244c0344; BYTE $0x48 // add r9d,[rsp+0x48] - WORD $0x2141; BYTE $0xcc // and r12d,ecx - LONG $0xf07b63c4; WORD $0x19e9 // rorx r13d,ecx,0x19 - LONG $0xf07b63c4; WORD $0x0bf9 // rorx r15d,ecx,0xb - LONG $0x32148d47 // lea r10d,[r10+r14*1] - LONG $0x210c8d47 // lea r9d,[r9+r12*1] - LONG $0xf27042c4; BYTE $0xe0 // andn r12d,ecx,r8d - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b63c4; WORD $0x06f1 // rorx r14d,ecx,0x6 - LONG $0x210c8d47 // lea r9d,[r9+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8945; BYTE $0xd7 // mov r15d,r10d - LONG $0xf07b43c4; WORD $0x16e2 // rorx r12d,r10d,0x16 - LONG $0x290c8d47 // lea r9d,[r9+r13*1] - WORD $0x3145; BYTE $0xdf // xor r15d,r11d - LONG $0xf07b43c4; WORD $0x0df2 // rorx r14d,r10d,0xd - LONG $0xf07b43c4; WORD $0x02ea // rorx r13d,r10d,0x2 - LONG $0x0b1c8d42 // lea ebx,[rbx+r9*1] - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3144; BYTE $0xdf // xor edi,r11d - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x390c8d45 // lea r9d,[r9+rdi*1] - WORD $0x8941; BYTE $0xcc // mov r12d,ecx - - // ROUND(R9, R10, R11, AX, BX, CX, DX, R8, R12, R13, R14, DI, R15, SP, 0x4c) - LONG $0x24440344; BYTE $0x4c // add r8d,[rsp+0x4c] - WORD $0x2141; BYTE $0xdc // and r12d,ebx - LONG $0xf07b63c4; WORD $0x19eb // rorx r13d,ebx,0x19 - LONG $0xf07be3c4; WORD $0x0bfb // rorx edi,ebx,0xb - LONG $0x310c8d47 // lea r9d,[r9+r14*1] - LONG $0x20048d47 // lea r8d,[r8+r12*1] - LONG $0xf26062c4; BYTE $0xe2 // andn r12d,ebx,edx - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b63c4; WORD $0x06f3 // rorx r14d,ebx,0x6 - LONG $0x20048d47 // lea r8d,[r8+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8944; BYTE $0xcf // mov edi,r9d - LONG $0xf07b43c4; WORD $0x16e1 // rorx r12d,r9d,0x16 - LONG $0x28048d47 // lea r8d,[r8+r13*1] - WORD $0x3144; BYTE $0xd7 // xor edi,r10d - LONG $0xf07b43c4; WORD $0x0df1 // rorx r14d,r9d,0xd - LONG $0xf07b43c4; WORD $0x02e9 // rorx r13d,r9d,0x2 - LONG $0x00048d42 // lea eax,[rax+r8*1] - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3145; BYTE $0xd7 // xor r15d,r10d - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x38048d47 // lea r8d,[r8+r15*1] - WORD $0x8941; BYTE $0xdc // mov r12d,ebx - - // ROUND(R8, R9, R10, R11, AX, BX, CX, DX, R12, R13, R14, R15, DI, SP, 0x60) - LONG $0x60245403 // add edx,[rsp+0x60] - WORD $0x2141; BYTE $0xc4 // and r12d,eax - LONG $0xf07b63c4; WORD $0x19e8 // rorx r13d,eax,0x19 - LONG $0xf07b63c4; WORD $0x0bf8 // rorx r15d,eax,0xb - LONG $0x30048d47 // lea r8d,[r8+r14*1] - LONG $0x22148d42 // lea edx,[rdx+r12*1] - LONG $0xf27862c4; BYTE $0xe1 // andn r12d,eax,ecx - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b63c4; WORD $0x06f0 // rorx r14d,eax,0x6 - LONG $0x22148d42 // lea edx,[rdx+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8945; BYTE $0xc7 // mov r15d,r8d - LONG $0xf07b43c4; WORD $0x16e0 // rorx r12d,r8d,0x16 - LONG $0x2a148d42 // lea edx,[rdx+r13*1] - WORD $0x3145; BYTE $0xcf // xor r15d,r9d - LONG $0xf07b43c4; WORD $0x0df0 // rorx r14d,r8d,0xd - LONG $0xf07b43c4; WORD $0x02e8 // rorx r13d,r8d,0x2 - LONG $0x131c8d45 // lea r11d,[r11+rdx*1] - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3144; BYTE $0xcf // xor edi,r9d - WORD $0x3145; BYTE $0xee // xor r14d,r13d - WORD $0x148d; BYTE $0x3a // lea edx,[rdx+rdi*1] - WORD $0x8941; BYTE $0xc4 // mov r12d,eax - - // ROUND(DX, R8, R9, R10, R11, AX, BX, CX, R12, R13, R14, DI, R15, SP, 0x64) - LONG $0x64244c03 // add ecx,[rsp+0x64] - WORD $0x2145; BYTE $0xdc // and r12d,r11d - LONG $0xf07b43c4; WORD $0x19eb // rorx r13d,r11d,0x19 - LONG $0xf07bc3c4; WORD $0x0bfb // rorx edi,r11d,0xb - LONG $0x32148d42 // lea edx,[rdx+r14*1] - LONG $0x210c8d42 // lea ecx,[rcx+r12*1] - LONG $0xf22062c4; BYTE $0xe3 // andn r12d,r11d,ebx - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b43c4; WORD $0x06f3 // rorx r14d,r11d,0x6 - LONG $0x210c8d42 // lea ecx,[rcx+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0xd789 // mov edi,edx - LONG $0xf07b63c4; WORD $0x16e2 // rorx r12d,edx,0x16 - LONG $0x290c8d42 // lea ecx,[rcx+r13*1] - WORD $0x3144; BYTE $0xc7 // xor edi,r8d - LONG $0xf07b63c4; WORD $0x0df2 // rorx r14d,edx,0xd - LONG $0xf07b63c4; WORD $0x02ea // rorx r13d,edx,0x2 - LONG $0x0a148d45 // lea r10d,[r10+rcx*1] - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3145; BYTE $0xc7 // xor r15d,r8d - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x390c8d42 // lea ecx,[rcx+r15*1] - WORD $0x8945; BYTE $0xdc // mov r12d,r11d - - // ROUND(CX, DX, R8, R9, R10, R11, AX, BX, R12, R13, R14, R15, DI, SP, 0x68) - LONG $0x68245c03 // add ebx,[rsp+0x68] - WORD $0x2145; BYTE $0xd4 // and r12d,r10d - LONG $0xf07b43c4; WORD $0x19ea // rorx r13d,r10d,0x19 - LONG $0xf07b43c4; WORD $0x0bfa // rorx r15d,r10d,0xb - LONG $0x310c8d42 // lea ecx,[rcx+r14*1] - LONG $0x231c8d42 // lea ebx,[rbx+r12*1] - LONG $0xf22862c4; BYTE $0xe0 // andn r12d,r10d,eax - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b43c4; WORD $0x06f2 // rorx r14d,r10d,0x6 - LONG $0x231c8d42 // lea ebx,[rbx+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8941; BYTE $0xcf // mov r15d,ecx - LONG $0xf07b63c4; WORD $0x16e1 // rorx r12d,ecx,0x16 - LONG $0x2b1c8d42 // lea ebx,[rbx+r13*1] - WORD $0x3141; BYTE $0xd7 // xor r15d,edx - LONG $0xf07b63c4; WORD $0x0df1 // rorx r14d,ecx,0xd - LONG $0xf07b63c4; WORD $0x02e9 // rorx r13d,ecx,0x2 - LONG $0x190c8d45 // lea r9d,[r9+rbx*1] - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0xd731 // xor edi,edx - WORD $0x3145; BYTE $0xee // xor r14d,r13d - WORD $0x1c8d; BYTE $0x3b // lea ebx,[rbx+rdi*1] - WORD $0x8945; BYTE $0xd4 // mov r12d,r10d - - // ROUND(BX, CX, DX, R8, R9, R10, R11, AX, R12, R13, R14, DI, R15, SP, 0x6c) - LONG $0x6c244403 // add eax,[rsp+0x6c] - WORD $0x2145; BYTE $0xcc // and r12d,r9d - LONG $0xf07b43c4; WORD $0x19e9 // rorx r13d,r9d,0x19 - LONG $0xf07bc3c4; WORD $0x0bf9 // rorx edi,r9d,0xb - LONG $0x331c8d42 // lea ebx,[rbx+r14*1] - LONG $0x20048d42 // lea eax,[rax+r12*1] - LONG $0xf23042c4; BYTE $0xe3 // andn r12d,r9d,r11d - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b43c4; WORD $0x06f1 // rorx r14d,r9d,0x6 - LONG $0x20048d42 // lea eax,[rax+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0xdf89 // mov edi,ebx - LONG $0xf07b63c4; WORD $0x16e3 // rorx r12d,ebx,0x16 - LONG $0x28048d42 // lea eax,[rax+r13*1] - WORD $0xcf31 // xor edi,ecx - LONG $0xf07b63c4; WORD $0x0df3 // rorx r14d,ebx,0xd - LONG $0xf07b63c4; WORD $0x02eb // rorx r13d,ebx,0x2 - LONG $0x00048d45 // lea r8d,[r8+rax*1] - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3141; BYTE $0xcf // xor r15d,ecx - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x38048d42 // lea eax,[rax+r15*1] - WORD $0x8945; BYTE $0xcc // mov r12d,r9d - - // ROUND(AX, BX, CX, DX, R8, R9, R10, R11, R12, R13, R14, R15, DI, SP, 0x00) - LONG $0x241c0344 // add r11d,[rsp] - WORD $0x2145; BYTE $0xc4 // and r12d,r8d - LONG $0xf07b43c4; WORD $0x19e8 // rorx r13d,r8d,0x19 - LONG $0xf07b43c4; WORD $0x0bf8 // rorx r15d,r8d,0xb - LONG $0x30048d42 // lea eax,[rax+r14*1] - LONG $0x231c8d47 // lea r11d,[r11+r12*1] - LONG $0xf23842c4; BYTE $0xe2 // andn r12d,r8d,r10d - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b43c4; WORD $0x06f0 // rorx r14d,r8d,0x6 - LONG $0x231c8d47 // lea r11d,[r11+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8941; BYTE $0xc7 // mov r15d,eax - LONG $0xf07b63c4; WORD $0x16e0 // rorx r12d,eax,0x16 - LONG $0x2b1c8d47 // lea r11d,[r11+r13*1] - WORD $0x3141; BYTE $0xdf // xor r15d,ebx - LONG $0xf07b63c4; WORD $0x0df0 // rorx r14d,eax,0xd - LONG $0xf07b63c4; WORD $0x02e8 // rorx r13d,eax,0x2 - LONG $0x1a148d42 // lea edx,[rdx+r11*1] - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0xdf31 // xor edi,ebx - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x3b1c8d45 // lea r11d,[r11+rdi*1] - WORD $0x8945; BYTE $0xc4 // mov r12d,r8d - - // ROUND(R11, AX, BX, CX, DX, R8, R9, R10, R12, R13, R14, DI, R15, SP, 0x04) - LONG $0x24540344; BYTE $0x04 // add r10d,[rsp+0x4] - WORD $0x2141; BYTE $0xd4 // and r12d,edx - LONG $0xf07b63c4; WORD $0x19ea // rorx r13d,edx,0x19 - LONG $0xf07be3c4; WORD $0x0bfa // rorx edi,edx,0xb - LONG $0x331c8d47 // lea r11d,[r11+r14*1] - LONG $0x22148d47 // lea r10d,[r10+r12*1] - LONG $0xf26842c4; BYTE $0xe1 // andn r12d,edx,r9d - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b63c4; WORD $0x06f2 // rorx r14d,edx,0x6 - LONG $0x22148d47 // lea r10d,[r10+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8944; BYTE $0xdf // mov edi,r11d - LONG $0xf07b43c4; WORD $0x16e3 // rorx r12d,r11d,0x16 - LONG $0x2a148d47 // lea r10d,[r10+r13*1] - WORD $0xc731 // xor edi,eax - LONG $0xf07b43c4; WORD $0x0df3 // rorx r14d,r11d,0xd - LONG $0xf07b43c4; WORD $0x02eb // rorx r13d,r11d,0x2 - LONG $0x110c8d42 // lea ecx,[rcx+r10*1] - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3141; BYTE $0xc7 // xor r15d,eax - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x3a148d47 // lea r10d,[r10+r15*1] - WORD $0x8941; BYTE $0xd4 // mov r12d,edx - - // ROUND(R10, R11, AX, BX, CX, DX, R8, R9, R12, R13, R14, R15, DI, SP, 0x08) - LONG $0x244c0344; BYTE $0x08 // add r9d,[rsp+0x8] - WORD $0x2141; BYTE $0xcc // and r12d,ecx - LONG $0xf07b63c4; WORD $0x19e9 // rorx r13d,ecx,0x19 - LONG $0xf07b63c4; WORD $0x0bf9 // rorx r15d,ecx,0xb - LONG $0x32148d47 // lea r10d,[r10+r14*1] - LONG $0x210c8d47 // lea r9d,[r9+r12*1] - LONG $0xf27042c4; BYTE $0xe0 // andn r12d,ecx,r8d - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b63c4; WORD $0x06f1 // rorx r14d,ecx,0x6 - LONG $0x210c8d47 // lea r9d,[r9+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8945; BYTE $0xd7 // mov r15d,r10d - LONG $0xf07b43c4; WORD $0x16e2 // rorx r12d,r10d,0x16 - LONG $0x290c8d47 // lea r9d,[r9+r13*1] - WORD $0x3145; BYTE $0xdf // xor r15d,r11d - LONG $0xf07b43c4; WORD $0x0df2 // rorx r14d,r10d,0xd - LONG $0xf07b43c4; WORD $0x02ea // rorx r13d,r10d,0x2 - LONG $0x0b1c8d42 // lea ebx,[rbx+r9*1] - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3144; BYTE $0xdf // xor edi,r11d - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x390c8d45 // lea r9d,[r9+rdi*1] - WORD $0x8941; BYTE $0xcc // mov r12d,ecx - - // ROUND(R9, R10, R11, AX, BX, CX, DX, R8, R12, R13, R14, DI, R15, SP, 0x0c) - LONG $0x24440344; BYTE $0x0c // add r8d,[rsp+0xc] - WORD $0x2141; BYTE $0xdc // and r12d,ebx - LONG $0xf07b63c4; WORD $0x19eb // rorx r13d,ebx,0x19 - LONG $0xf07be3c4; WORD $0x0bfb // rorx edi,ebx,0xb - LONG $0x310c8d47 // lea r9d,[r9+r14*1] - LONG $0x20048d47 // lea r8d,[r8+r12*1] - LONG $0xf26062c4; BYTE $0xe2 // andn r12d,ebx,edx - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b63c4; WORD $0x06f3 // rorx r14d,ebx,0x6 - LONG $0x20048d47 // lea r8d,[r8+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8944; BYTE $0xcf // mov edi,r9d - LONG $0xf07b43c4; WORD $0x16e1 // rorx r12d,r9d,0x16 - LONG $0x28048d47 // lea r8d,[r8+r13*1] - WORD $0x3144; BYTE $0xd7 // xor edi,r10d - LONG $0xf07b43c4; WORD $0x0df1 // rorx r14d,r9d,0xd - LONG $0xf07b43c4; WORD $0x02e9 // rorx r13d,r9d,0x2 - LONG $0x00048d42 // lea eax,[rax+r8*1] - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3145; BYTE $0xd7 // xor r15d,r10d - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x38048d47 // lea r8d,[r8+r15*1] - WORD $0x8941; BYTE $0xdc // mov r12d,ebx - - // ROUND(R8, R9, R10, R11, AX, BX, CX, DX, R12, R13, R14, R15, DI, SP, 0x20) - LONG $0x20245403 // add edx,[rsp+0x20] - WORD $0x2141; BYTE $0xc4 // and r12d,eax - LONG $0xf07b63c4; WORD $0x19e8 // rorx r13d,eax,0x19 - LONG $0xf07b63c4; WORD $0x0bf8 // rorx r15d,eax,0xb - LONG $0x30048d47 // lea r8d,[r8+r14*1] - LONG $0x22148d42 // lea edx,[rdx+r12*1] - LONG $0xf27862c4; BYTE $0xe1 // andn r12d,eax,ecx - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b63c4; WORD $0x06f0 // rorx r14d,eax,0x6 - LONG $0x22148d42 // lea edx,[rdx+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8945; BYTE $0xc7 // mov r15d,r8d - LONG $0xf07b43c4; WORD $0x16e0 // rorx r12d,r8d,0x16 - LONG $0x2a148d42 // lea edx,[rdx+r13*1] - WORD $0x3145; BYTE $0xcf // xor r15d,r9d - LONG $0xf07b43c4; WORD $0x0df0 // rorx r14d,r8d,0xd - LONG $0xf07b43c4; WORD $0x02e8 // rorx r13d,r8d,0x2 - LONG $0x131c8d45 // lea r11d,[r11+rdx*1] - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3144; BYTE $0xcf // xor edi,r9d - WORD $0x3145; BYTE $0xee // xor r14d,r13d - WORD $0x148d; BYTE $0x3a // lea edx,[rdx+rdi*1] - WORD $0x8941; BYTE $0xc4 // mov r12d,eax - - // ROUND(DX, R8, R9, R10, R11, AX, BX, CX, R12, R13, R14, DI, R15, SP, 0x24) - LONG $0x24244c03 // add ecx,[rsp+0x24] - WORD $0x2145; BYTE $0xdc // and r12d,r11d - LONG $0xf07b43c4; WORD $0x19eb // rorx r13d,r11d,0x19 - LONG $0xf07bc3c4; WORD $0x0bfb // rorx edi,r11d,0xb - LONG $0x32148d42 // lea edx,[rdx+r14*1] - LONG $0x210c8d42 // lea ecx,[rcx+r12*1] - LONG $0xf22062c4; BYTE $0xe3 // andn r12d,r11d,ebx - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b43c4; WORD $0x06f3 // rorx r14d,r11d,0x6 - LONG $0x210c8d42 // lea ecx,[rcx+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0xd789 // mov edi,edx - LONG $0xf07b63c4; WORD $0x16e2 // rorx r12d,edx,0x16 - LONG $0x290c8d42 // lea ecx,[rcx+r13*1] - WORD $0x3144; BYTE $0xc7 // xor edi,r8d - LONG $0xf07b63c4; WORD $0x0df2 // rorx r14d,edx,0xd - LONG $0xf07b63c4; WORD $0x02ea // rorx r13d,edx,0x2 - LONG $0x0a148d45 // lea r10d,[r10+rcx*1] - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3145; BYTE $0xc7 // xor r15d,r8d - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x390c8d42 // lea ecx,[rcx+r15*1] - WORD $0x8945; BYTE $0xdc // mov r12d,r11d - - // ROUND(CX, DX, R8, R9, R10, R11, AX, BX, R12, R13, R14, R15, DI, SP, 0x28) - LONG $0x28245c03 // add ebx,[rsp+0x28] - WORD $0x2145; BYTE $0xd4 // and r12d,r10d - LONG $0xf07b43c4; WORD $0x19ea // rorx r13d,r10d,0x19 - LONG $0xf07b43c4; WORD $0x0bfa // rorx r15d,r10d,0xb - LONG $0x310c8d42 // lea ecx,[rcx+r14*1] - LONG $0x231c8d42 // lea ebx,[rbx+r12*1] - LONG $0xf22862c4; BYTE $0xe0 // andn r12d,r10d,eax - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b43c4; WORD $0x06f2 // rorx r14d,r10d,0x6 - LONG $0x231c8d42 // lea ebx,[rbx+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8941; BYTE $0xcf // mov r15d,ecx - LONG $0xf07b63c4; WORD $0x16e1 // rorx r12d,ecx,0x16 - LONG $0x2b1c8d42 // lea ebx,[rbx+r13*1] - WORD $0x3141; BYTE $0xd7 // xor r15d,edx - LONG $0xf07b63c4; WORD $0x0df1 // rorx r14d,ecx,0xd - LONG $0xf07b63c4; WORD $0x02e9 // rorx r13d,ecx,0x2 - LONG $0x190c8d45 // lea r9d,[r9+rbx*1] - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0xd731 // xor edi,edx - WORD $0x3145; BYTE $0xee // xor r14d,r13d - WORD $0x1c8d; BYTE $0x3b // lea ebx,[rbx+rdi*1] - WORD $0x8945; BYTE $0xd4 // mov r12d,r10d - - // ROUND(BX, CX, DX, R8, R9, R10, R11, AX, R12, R13, R14, DI, R15, SP, 0x2c) - LONG $0x2c244403 // add eax,[rsp+0x2c] - WORD $0x2145; BYTE $0xcc // and r12d,r9d - LONG $0xf07b43c4; WORD $0x19e9 // rorx r13d,r9d,0x19 - LONG $0xf07bc3c4; WORD $0x0bf9 // rorx edi,r9d,0xb - LONG $0x331c8d42 // lea ebx,[rbx+r14*1] - LONG $0x20048d42 // lea eax,[rax+r12*1] - LONG $0xf23042c4; BYTE $0xe3 // andn r12d,r9d,r11d - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b43c4; WORD $0x06f1 // rorx r14d,r9d,0x6 - LONG $0x20048d42 // lea eax,[rax+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0xdf89 // mov edi,ebx - LONG $0xf07b63c4; WORD $0x16e3 // rorx r12d,ebx,0x16 - LONG $0x28048d42 // lea eax,[rax+r13*1] - WORD $0xcf31 // xor edi,ecx - LONG $0xf07b63c4; WORD $0x0df3 // rorx r14d,ebx,0xd - LONG $0xf07b63c4; WORD $0x02eb // rorx r13d,ebx,0x2 - LONG $0x00048d45 // lea r8d,[r8+rax*1] - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3141; BYTE $0xcf // xor r15d,ecx - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x38048d42 // lea eax,[rax+r15*1] - WORD $0x8945; BYTE $0xcc // mov r12d,r9d - - MOVQ 0x200(SP), DI // $_ctx - ADDQ R14, AX - - LEAQ 0x1c0(SP), BP - - ADDL (DI), AX - ADDL 4(DI), BX - ADDL 8(DI), CX - ADDL 12(DI), DX - ADDL 16(DI), R8 - ADDL 20(DI), R9 - ADDL 24(DI), R10 - ADDL 28(DI), R11 - - MOVL AX, (DI) - MOVL BX, 4(DI) - MOVL CX, 8(DI) - MOVL DX, 12(DI) - MOVL R8, 16(DI) - MOVL R9, 20(DI) - MOVL R10, 24(DI) - MOVL R11, 28(DI) - - CMPQ SI, 0x50(BP) // $_end - JE done - - XORQ R14, R14 - MOVQ BX, DI - XORQ CX, DI // magic - MOVQ R9, R12 - -loop2: - // ROUND(AX, BX, CX, DX, R8, R9, R10, R11, R12, R13, R14, R15, DI, BP, 0x10) - LONG $0x105d0344 // add r11d,[rbp+0x10] - WORD $0x2145; BYTE $0xc4 // and r12d,r8d - LONG $0xf07b43c4; WORD $0x19e8 // rorx r13d,r8d,0x19 - LONG $0xf07b43c4; WORD $0x0bf8 // rorx r15d,r8d,0xb - LONG $0x30048d42 // lea eax,[rax+r14*1] - LONG $0x231c8d47 // lea r11d,[r11+r12*1] - LONG $0xf23842c4; BYTE $0xe2 // andn r12d,r8d,r10d - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b43c4; WORD $0x06f0 // rorx r14d,r8d,0x6 - LONG $0x231c8d47 // lea r11d,[r11+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8941; BYTE $0xc7 // mov r15d,eax - LONG $0xf07b63c4; WORD $0x16e0 // rorx r12d,eax,0x16 - LONG $0x2b1c8d47 // lea r11d,[r11+r13*1] - WORD $0x3141; BYTE $0xdf // xor r15d,ebx - LONG $0xf07b63c4; WORD $0x0df0 // rorx r14d,eax,0xd - LONG $0xf07b63c4; WORD $0x02e8 // rorx r13d,eax,0x2 - LONG $0x1a148d42 // lea edx,[rdx+r11*1] - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0xdf31 // xor edi,ebx - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x3b1c8d45 // lea r11d,[r11+rdi*1] - WORD $0x8945; BYTE $0xc4 // mov r12d,r8d - - // ROUND(R11, AX, BX, CX, DX, R8, R9, R10, R12, R13, R14, DI, R15, BP, 0x14) - LONG $0x14550344 // add r10d,[rbp+0x14] - WORD $0x2141; BYTE $0xd4 // and r12d,edx - LONG $0xf07b63c4; WORD $0x19ea // rorx r13d,edx,0x19 - LONG $0xf07be3c4; WORD $0x0bfa // rorx edi,edx,0xb - LONG $0x331c8d47 // lea r11d,[r11+r14*1] - LONG $0x22148d47 // lea r10d,[r10+r12*1] - LONG $0xf26842c4; BYTE $0xe1 // andn r12d,edx,r9d - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b63c4; WORD $0x06f2 // rorx r14d,edx,0x6 - LONG $0x22148d47 // lea r10d,[r10+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8944; BYTE $0xdf // mov edi,r11d - LONG $0xf07b43c4; WORD $0x16e3 // rorx r12d,r11d,0x16 - LONG $0x2a148d47 // lea r10d,[r10+r13*1] - WORD $0xc731 // xor edi,eax - LONG $0xf07b43c4; WORD $0x0df3 // rorx r14d,r11d,0xd - LONG $0xf07b43c4; WORD $0x02eb // rorx r13d,r11d,0x2 - LONG $0x110c8d42 // lea ecx,[rcx+r10*1] - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3141; BYTE $0xc7 // xor r15d,eax - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x3a148d47 // lea r10d,[r10+r15*1] - WORD $0x8941; BYTE $0xd4 // mov r12d,edx - - // ROUND(R10, R11, AX, BX, CX, DX, R8, R9, R12, R13, R14, R15, DI, BP, 0x18) - LONG $0x184d0344 // add r9d,[rbp+0x18] - WORD $0x2141; BYTE $0xcc // and r12d,ecx - LONG $0xf07b63c4; WORD $0x19e9 // rorx r13d,ecx,0x19 - LONG $0xf07b63c4; WORD $0x0bf9 // rorx r15d,ecx,0xb - LONG $0x32148d47 // lea r10d,[r10+r14*1] - LONG $0x210c8d47 // lea r9d,[r9+r12*1] - LONG $0xf27042c4; BYTE $0xe0 // andn r12d,ecx,r8d - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b63c4; WORD $0x06f1 // rorx r14d,ecx,0x6 - LONG $0x210c8d47 // lea r9d,[r9+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8945; BYTE $0xd7 // mov r15d,r10d - LONG $0xf07b43c4; WORD $0x16e2 // rorx r12d,r10d,0x16 - LONG $0x290c8d47 // lea r9d,[r9+r13*1] - WORD $0x3145; BYTE $0xdf // xor r15d,r11d - LONG $0xf07b43c4; WORD $0x0df2 // rorx r14d,r10d,0xd - LONG $0xf07b43c4; WORD $0x02ea // rorx r13d,r10d,0x2 - LONG $0x0b1c8d42 // lea ebx,[rbx+r9*1] - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3144; BYTE $0xdf // xor edi,r11d - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x390c8d45 // lea r9d,[r9+rdi*1] - WORD $0x8941; BYTE $0xcc // mov r12d,ecx - - // ROUND(R9, R10, R11, AX, BX, CX, DX, R8, R12, R13, R14, DI, R15, BP, 0x1c) - LONG $0x1c450344 // add r8d,[rbp+0x1c] - WORD $0x2141; BYTE $0xdc // and r12d,ebx - LONG $0xf07b63c4; WORD $0x19eb // rorx r13d,ebx,0x19 - LONG $0xf07be3c4; WORD $0x0bfb // rorx edi,ebx,0xb - LONG $0x310c8d47 // lea r9d,[r9+r14*1] - LONG $0x20048d47 // lea r8d,[r8+r12*1] - LONG $0xf26062c4; BYTE $0xe2 // andn r12d,ebx,edx - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b63c4; WORD $0x06f3 // rorx r14d,ebx,0x6 - LONG $0x20048d47 // lea r8d,[r8+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8944; BYTE $0xcf // mov edi,r9d - LONG $0xf07b43c4; WORD $0x16e1 // rorx r12d,r9d,0x16 - LONG $0x28048d47 // lea r8d,[r8+r13*1] - WORD $0x3144; BYTE $0xd7 // xor edi,r10d - LONG $0xf07b43c4; WORD $0x0df1 // rorx r14d,r9d,0xd - LONG $0xf07b43c4; WORD $0x02e9 // rorx r13d,r9d,0x2 - LONG $0x00048d42 // lea eax,[rax+r8*1] - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3145; BYTE $0xd7 // xor r15d,r10d - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x38048d47 // lea r8d,[r8+r15*1] - WORD $0x8941; BYTE $0xdc // mov r12d,ebx - - // ROUND(R8, R9, R10, R11, AX, BX, CX, DX, R12, R13, R14, R15, DI, BP, 0x30) - WORD $0x5503; BYTE $0x30 // add edx,[rbp+0x30] - WORD $0x2141; BYTE $0xc4 // and r12d,eax - LONG $0xf07b63c4; WORD $0x19e8 // rorx r13d,eax,0x19 - LONG $0xf07b63c4; WORD $0x0bf8 // rorx r15d,eax,0xb - LONG $0x30048d47 // lea r8d,[r8+r14*1] - LONG $0x22148d42 // lea edx,[rdx+r12*1] - LONG $0xf27862c4; BYTE $0xe1 // andn r12d,eax,ecx - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b63c4; WORD $0x06f0 // rorx r14d,eax,0x6 - LONG $0x22148d42 // lea edx,[rdx+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8945; BYTE $0xc7 // mov r15d,r8d - LONG $0xf07b43c4; WORD $0x16e0 // rorx r12d,r8d,0x16 - LONG $0x2a148d42 // lea edx,[rdx+r13*1] - WORD $0x3145; BYTE $0xcf // xor r15d,r9d - LONG $0xf07b43c4; WORD $0x0df0 // rorx r14d,r8d,0xd - LONG $0xf07b43c4; WORD $0x02e8 // rorx r13d,r8d,0x2 - LONG $0x131c8d45 // lea r11d,[r11+rdx*1] - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3144; BYTE $0xcf // xor edi,r9d - WORD $0x3145; BYTE $0xee // xor r14d,r13d - WORD $0x148d; BYTE $0x3a // lea edx,[rdx+rdi*1] - WORD $0x8941; BYTE $0xc4 // mov r12d,eax - - // ROUND(DX, R8, R9, R10, R11, AX, BX, CX, R12, R13, R14, DI, R15, BP, 0x34) - WORD $0x4d03; BYTE $0x34 // add ecx,[rbp+0x34] - WORD $0x2145; BYTE $0xdc // and r12d,r11d - LONG $0xf07b43c4; WORD $0x19eb // rorx r13d,r11d,0x19 - LONG $0xf07bc3c4; WORD $0x0bfb // rorx edi,r11d,0xb - LONG $0x32148d42 // lea edx,[rdx+r14*1] - LONG $0x210c8d42 // lea ecx,[rcx+r12*1] - LONG $0xf22062c4; BYTE $0xe3 // andn r12d,r11d,ebx - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b43c4; WORD $0x06f3 // rorx r14d,r11d,0x6 - LONG $0x210c8d42 // lea ecx,[rcx+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0xd789 // mov edi,edx - LONG $0xf07b63c4; WORD $0x16e2 // rorx r12d,edx,0x16 - LONG $0x290c8d42 // lea ecx,[rcx+r13*1] - WORD $0x3144; BYTE $0xc7 // xor edi,r8d - LONG $0xf07b63c4; WORD $0x0df2 // rorx r14d,edx,0xd - LONG $0xf07b63c4; WORD $0x02ea // rorx r13d,edx,0x2 - LONG $0x0a148d45 // lea r10d,[r10+rcx*1] - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3145; BYTE $0xc7 // xor r15d,r8d - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x390c8d42 // lea ecx,[rcx+r15*1] - WORD $0x8945; BYTE $0xdc // mov r12d,r11d - - // ROUND(CX, DX, R8, R9, R10, R11, AX, BX, R12, R13, R14, R15, DI, BP, 0x38) - WORD $0x5d03; BYTE $0x38 // add ebx,[rbp+0x38] - WORD $0x2145; BYTE $0xd4 // and r12d,r10d - LONG $0xf07b43c4; WORD $0x19ea // rorx r13d,r10d,0x19 - LONG $0xf07b43c4; WORD $0x0bfa // rorx r15d,r10d,0xb - LONG $0x310c8d42 // lea ecx,[rcx+r14*1] - LONG $0x231c8d42 // lea ebx,[rbx+r12*1] - LONG $0xf22862c4; BYTE $0xe0 // andn r12d,r10d,eax - WORD $0x3145; BYTE $0xfd // xor r13d,r15d - LONG $0xf07b43c4; WORD $0x06f2 // rorx r14d,r10d,0x6 - LONG $0x231c8d42 // lea ebx,[rbx+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0x8941; BYTE $0xcf // mov r15d,ecx - LONG $0xf07b63c4; WORD $0x16e1 // rorx r12d,ecx,0x16 - LONG $0x2b1c8d42 // lea ebx,[rbx+r13*1] - WORD $0x3141; BYTE $0xd7 // xor r15d,edx - LONG $0xf07b63c4; WORD $0x0df1 // rorx r14d,ecx,0xd - LONG $0xf07b63c4; WORD $0x02e9 // rorx r13d,ecx,0x2 - LONG $0x190c8d45 // lea r9d,[r9+rbx*1] - WORD $0x2144; BYTE $0xff // and edi,r15d - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0xd731 // xor edi,edx - WORD $0x3145; BYTE $0xee // xor r14d,r13d - WORD $0x1c8d; BYTE $0x3b // lea ebx,[rbx+rdi*1] - WORD $0x8945; BYTE $0xd4 // mov r12d,r10d - - // ROUND(BX, CX, DX, R8, R9, R10, R11, AX, R12, R13, R14, DI, R15, BP, 0x3c) - WORD $0x4503; BYTE $0x3c // add eax,[rbp+0x3c] - WORD $0x2145; BYTE $0xcc // and r12d,r9d - LONG $0xf07b43c4; WORD $0x19e9 // rorx r13d,r9d,0x19 - LONG $0xf07bc3c4; WORD $0x0bf9 // rorx edi,r9d,0xb - LONG $0x331c8d42 // lea ebx,[rbx+r14*1] - LONG $0x20048d42 // lea eax,[rax+r12*1] - LONG $0xf23042c4; BYTE $0xe3 // andn r12d,r9d,r11d - WORD $0x3141; BYTE $0xfd // xor r13d,edi - LONG $0xf07b43c4; WORD $0x06f1 // rorx r14d,r9d,0x6 - LONG $0x20048d42 // lea eax,[rax+r12*1] - WORD $0x3145; BYTE $0xf5 // xor r13d,r14d - WORD $0xdf89 // mov edi,ebx - LONG $0xf07b63c4; WORD $0x16e3 // rorx r12d,ebx,0x16 - LONG $0x28048d42 // lea eax,[rax+r13*1] - WORD $0xcf31 // xor edi,ecx - LONG $0xf07b63c4; WORD $0x0df3 // rorx r14d,ebx,0xd - LONG $0xf07b63c4; WORD $0x02eb // rorx r13d,ebx,0x2 - LONG $0x00048d45 // lea r8d,[r8+rax*1] - WORD $0x2141; BYTE $0xff // and r15d,edi - WORD $0x3145; BYTE $0xe6 // xor r14d,r12d - WORD $0x3141; BYTE $0xcf // xor r15d,ecx - WORD $0x3145; BYTE $0xee // xor r14d,r13d - LONG $0x38048d42 // lea eax,[rax+r15*1] - WORD $0x8945; BYTE $0xcc // mov r12d,r9d - - ADDQ $-0x40, BP - CMPQ BP, SP - JAE loop2 - - MOVQ 0x200(SP), DI // $_ctx - ADDQ R14, AX - - ADDQ $0x1c0, SP - - ADDL (DI), AX - ADDL 4(DI), BX - ADDL 8(DI), CX - ADDL 12(DI), DX - ADDL 16(DI), R8 - ADDL 20(DI), R9 - - ADDQ $0x80, SI // input += 2 - ADDL 24(DI), R10 - MOVQ SI, R12 - ADDL 28(DI), R11 - CMPQ SI, 0x50(SP) // input == _end - - MOVL AX, (DI) - LONG $0xe4440f4c // cmove r12,rsp /* next block or stale data */ - MOVL AX, (DI) - MOVL BX, 4(DI) - MOVL CX, 8(DI) - MOVL DX, 12(DI) - MOVL R8, 16(DI) - MOVL R9, 20(DI) - MOVL R10, 24(DI) - MOVL R11, 28(DI) - - JBE loop0 - LEAQ (SP), BP - -done: - MOVQ BP, SP - MOVQ 0x58(SP), SP // restore saved stack pointer - WORD $0xf8c5; BYTE $0x77 // vzeroupper - - RET - diff --git a/vendor/github.com/minio/sha256-simd/sha256blockAvx512_amd64.go b/vendor/github.com/minio/sha256-simd/sha256blockAvx512_amd64.go index db8e48d31..b7d7c1637 100644 --- a/vendor/github.com/minio/sha256-simd/sha256blockAvx512_amd64.go +++ b/vendor/github.com/minio/sha256-simd/sha256blockAvx512_amd64.go @@ -1,4 +1,4 @@ -//+build !noasm,!appengine +//+build !noasm,!appengine,gc /* * Minio Cloud Storage, (C) 2017 Minio, Inc. diff --git a/vendor/github.com/minio/sha256-simd/sha256blockAvx_amd64.go b/vendor/github.com/minio/sha256-simd/sha256blockAvx_amd64.go deleted file mode 100644 index c2f71181f..000000000 --- a/vendor/github.com/minio/sha256-simd/sha256blockAvx_amd64.go +++ /dev/null @@ -1,22 +0,0 @@ -//+build !noasm,!appengine - -/* - * Minio Cloud Storage, (C) 2016 Minio, Inc. - * - * Licensed under the Apache License, Version 2.0 (the "License"); - * you may not use this file except in compliance with the License. - * You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package sha256 - -//go:noescape -func blockAvx(h []uint32, message []uint8, reserved0, reserved1, reserved2, reserved3 uint64) diff --git a/vendor/github.com/minio/sha256-simd/sha256blockAvx_amd64.s b/vendor/github.com/minio/sha256-simd/sha256blockAvx_amd64.s deleted file mode 100644 index 9f444d49f..000000000 --- a/vendor/github.com/minio/sha256-simd/sha256blockAvx_amd64.s +++ /dev/null @@ -1,408 +0,0 @@ -//+build !noasm,!appengine - -// SHA256 implementation for AVX - -// -// Minio Cloud Storage, (C) 2016 Minio, Inc. -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. -// - -// -// This code is based on an Intel White-Paper: -// "Fast SHA-256 Implementations on Intel Architecture Processors" -// -// together with the reference implementation from the following authors: -// James Guilford <james.guilford@intel.com> -// Kirk Yap <kirk.s.yap@intel.com> -// Tim Chen <tim.c.chen@linux.intel.com> -// -// For Golang it has been converted to Plan 9 assembly with the help of -// github.com/minio/asm2plan9s to assemble Intel instructions to their Plan9 -// equivalents -// - -#include "textflag.h" - -#define ROTATE_XS \ - MOVOU X4, X15 \ - MOVOU X5, X4 \ - MOVOU X6, X5 \ - MOVOU X7, X6 \ - MOVOU X15, X7 - -// compute s0 four at a time and s1 two at a time -// compute W[-16] + W[-7] 4 at a time -#define FOUR_ROUNDS_AND_SCHED(a, b, c, d, e, f, g, h) \ - MOVL e, R13 \ // y0 = e - ROLL $18, R13 \ // y0 = e >> (25-11) - MOVL a, R14 \ // y1 = a - LONG $0x0f41e3c4; WORD $0x04c6 \ // VPALIGNR XMM0,XMM7,XMM6,0x4 /* XTMP0 = W[-7] */ - ROLL $23, R14 \ // y1 = a >> (22-13) - XORL e, R13 \ // y0 = e ^ (e >> (25-11)) - MOVL f, R15 \ // y2 = f - ROLL $27, R13 \ // y0 = (e >> (11-6)) ^ (e >> (25-6)) - XORL a, R14 \ // y1 = a ^ (a >> (22-13) - XORL g, R15 \ // y2 = f^g - LONG $0xc4fef9c5 \ // VPADDD XMM0,XMM0,XMM4 /* XTMP0 = W[-7] + W[-16] */ - XORL e, R13 \ // y0 = e ^ (e >> (11-6)) ^ (e >> (25-6) ) - ANDL e, R15 \ // y2 = (f^g)&e - ROLL $21, R14 \ // y1 = (a >> (13-2)) ^ (a >> (22-2)) - \ - \ // compute s0 - \ - LONG $0x0f51e3c4; WORD $0x04cc \ // VPALIGNR XMM1,XMM5,XMM4,0x4 /* XTMP1 = W[-15] */ - XORL a, R14 \ // y1 = a ^ (a >> (13-2)) ^ (a >> (22-2)) - ROLL $26, R13 \ // y0 = S1 = (e>>6) & (e>>11) ^ (e>>25) - XORL g, R15 \ // y2 = CH = ((f^g)&e)^g - ROLL $30, R14 \ // y1 = S0 = (a>>2) ^ (a>>13) ^ (a>>22) - ADDL R13, R15 \ // y2 = S1 + CH - ADDL _xfer+48(FP), R15 \ // y2 = k + w + S1 + CH - MOVL a, R13 \ // y0 = a - ADDL R15, h \ // h = h + S1 + CH + k + w - \ // ROTATE_ARGS - MOVL a, R15 \ // y2 = a - LONG $0xd172e9c5; BYTE $0x07 \ // VPSRLD XMM2,XMM1,0x7 /* */ - ORL c, R13 \ // y0 = a|c - ADDL h, d \ // d = d + h + S1 + CH + k + w - ANDL c, R15 \ // y2 = a&c - LONG $0xf172e1c5; BYTE $0x19 \ // VPSLLD XMM3,XMM1,0x19 /* */ - ANDL b, R13 \ // y0 = (a|c)&b - ADDL R14, h \ // h = h + S1 + CH + k + w + S0 - LONG $0xdaebe1c5 \ // VPOR XMM3,XMM3,XMM2 /* XTMP1 = W[-15] MY_ROR 7 */ - ORL R15, R13 \ // y0 = MAJ = (a|c)&b)|(a&c) - ADDL R13, h \ // h = h + S1 + CH + k + w + S0 + MAJ - \ // ROTATE_ARGS - MOVL d, R13 \ // y0 = e - MOVL h, R14 \ // y1 = a - ROLL $18, R13 \ // y0 = e >> (25-11) - XORL d, R13 \ // y0 = e ^ (e >> (25-11)) - MOVL e, R15 \ // y2 = f - ROLL $23, R14 \ // y1 = a >> (22-13) - LONG $0xd172e9c5; BYTE $0x12 \ // VPSRLD XMM2,XMM1,0x12 /* */ - XORL h, R14 \ // y1 = a ^ (a >> (22-13) - ROLL $27, R13 \ // y0 = (e >> (11-6)) ^ (e >> (25-6)) - XORL f, R15 \ // y2 = f^g - LONG $0xd172b9c5; BYTE $0x03 \ // VPSRLD XMM8,XMM1,0x3 /* XTMP4 = W[-15] >> 3 */ - ROLL $21, R14 \ // y1 = (a >> (13-2)) ^ (a >> (22-2)) - XORL d, R13 \ // y0 = e ^ (e >> (11-6)) ^ (e >> (25-6)) - ANDL d, R15 \ // y2 = (f^g)&e - ROLL $26, R13 \ // y0 = S1 = (e>>6) & (e>>11) ^ (e>>25) - LONG $0xf172f1c5; BYTE $0x0e \ // VPSLLD XMM1,XMM1,0xe /* */ - XORL h, R14 \ // y1 = a ^ (a >> (13-2)) ^ (a >> (22-2)) - XORL f, R15 \ // y2 = CH = ((f^g)&e)^g - LONG $0xd9efe1c5 \ // VPXOR XMM3,XMM3,XMM1 /* */ - ADDL R13, R15 \ // y2 = S1 + CH - ADDL _xfer+52(FP), R15 \ // y2 = k + w + S1 + CH - ROLL $30, R14 \ // y1 = S0 = (a>>2) ^ (a>>13) ^ (a>>22) - LONG $0xdaefe1c5 \ // VPXOR XMM3,XMM3,XMM2 /* XTMP1 = W[-15] MY_ROR 7 ^ W[-15] MY_ROR */ - MOVL h, R13 \ // y0 = a - ADDL R15, g \ // h = h + S1 + CH + k + w - MOVL h, R15 \ // y2 = a - LONG $0xef61c1c4; BYTE $0xc8 \ // VPXOR XMM1,XMM3,XMM8 /* XTMP1 = s0 */ - ORL b, R13 \ // y0 = a|c - ADDL g, c \ // d = d + h + S1 + CH + k + w - ANDL b, R15 \ // y2 = a&c - \ - \ // compute low s1 - \ - LONG $0xd770f9c5; BYTE $0xfa \ // VPSHUFD XMM2,XMM7,0xfa /* XTMP2 = W[-2] {BBAA} */ - ANDL a, R13 \ // y0 = (a|c)&b - ADDL R14, g \ // h = h + S1 + CH + k + w + S0 - LONG $0xc1fef9c5 \ // VPADDD XMM0,XMM0,XMM1 /* XTMP0 = W[-16] + W[-7] + s0 */ - ORL R15, R13 \ // y0 = MAJ = (a|c)&b)|(a&c) - ADDL R13, g \ // h = h + S1 + CH + k + w + S0 + MAJ - \ // ROTATE_ARGS - MOVL c, R13 \ // y0 = e - MOVL g, R14 \ // y1 = a - ROLL $18, R13 \ // y0 = e >> (25-11) - XORL c, R13 \ // y0 = e ^ (e >> (25-11)) - ROLL $23, R14 \ // y1 = a >> (22-13) - MOVL d, R15 \ // y2 = f - XORL g, R14 \ // y1 = a ^ (a >> (22-13) - ROLL $27, R13 \ // y0 = (e >> (11-6)) ^ (e >> (25-6)) - LONG $0xd272b9c5; BYTE $0x0a \ // VPSRLD XMM8,XMM2,0xa /* XTMP4 = W[-2] >> 10 {BBAA} */ - XORL e, R15 \ // y2 = f^g - LONG $0xd273e1c5; BYTE $0x13 \ // VPSRLQ XMM3,XMM2,0x13 /* XTMP3 = W[-2] MY_ROR 19 {xBxA} */ - XORL c, R13 \ // y0 = e ^ (e >> (11-6)) ^ (e >> (25-6)) - ANDL c, R15 \ // y2 = (f^g)&e - LONG $0xd273e9c5; BYTE $0x11 \ // VPSRLQ XMM2,XMM2,0x11 /* XTMP2 = W[-2] MY_ROR 17 {xBxA} */ - ROLL $21, R14 \ // y1 = (a >> (13-2)) ^ (a >> (22-2)) - XORL g, R14 \ // y1 = a ^ (a >> (13-2)) ^ (a >> (22-2)) - XORL e, R15 \ // y2 = CH = ((f^g)&e)^g - ROLL $26, R13 \ // y0 = S1 = (e>>6) & (e>>11) ^ (e>>25) - LONG $0xd3efe9c5 \ // VPXOR XMM2,XMM2,XMM3 /* */ - ADDL R13, R15 \ // y2 = S1 + CH - ROLL $30, R14 \ // y1 = S0 = (a>>2) ^ (a>>13) ^ (a>>22) - ADDL _xfer+56(FP), R15 \ // y2 = k + w + S1 + CH - LONG $0xc2ef39c5 \ // VPXOR XMM8,XMM8,XMM2 /* XTMP4 = s1 {xBxA} */ - MOVL g, R13 \ // y0 = a - ADDL R15, f \ // h = h + S1 + CH + k + w - MOVL g, R15 \ // y2 = a - LONG $0x003942c4; BYTE $0xc2 \ // VPSHUFB XMM8,XMM8,XMM10 /* XTMP4 = s1 {00BA} */ - ORL a, R13 \ // y0 = a|c - ADDL f, b \ // d = d + h + S1 + CH + k + w - ANDL a, R15 \ // y2 = a&c - LONG $0xfe79c1c4; BYTE $0xc0 \ // VPADDD XMM0,XMM0,XMM8 /* XTMP0 = {..., ..., W[1], W[0]} */ - ANDL h, R13 \ // y0 = (a|c)&b - ADDL R14, f \ // h = h + S1 + CH + k + w + S0 - \ - \ // compute high s1 - \ - LONG $0xd070f9c5; BYTE $0x50 \ // VPSHUFD XMM2,XMM0,0x50 /* XTMP2 = W[-2] {DDCC} */ - ORL R15, R13 \ // y0 = MAJ = (a|c)&b)|(a&c) - ADDL R13, f \ // h = h + S1 + CH + k + w + S0 + MAJ - \ // ROTATE_ARGS - MOVL b, R13 \ // y0 = e - ROLL $18, R13 \ // y0 = e >> (25-11) - MOVL f, R14 \ // y1 = a - ROLL $23, R14 \ // y1 = a >> (22-13) - XORL b, R13 \ // y0 = e ^ (e >> (25-11)) - MOVL c, R15 \ // y2 = f - ROLL $27, R13 \ // y0 = (e >> (11-6)) ^ (e >> (25-6)) - LONG $0xd272a1c5; BYTE $0x0a \ // VPSRLD XMM11,XMM2,0xa /* XTMP5 = W[-2] >> 10 {DDCC} */ - XORL f, R14 \ // y1 = a ^ (a >> (22-13) - XORL d, R15 \ // y2 = f^g - LONG $0xd273e1c5; BYTE $0x13 \ // VPSRLQ XMM3,XMM2,0x13 /* XTMP3 = W[-2] MY_ROR 19 {xDxC} */ - XORL b, R13 \ // y0 = e ^ (e >> (11-6)) ^ (e >> (25-6)) - ANDL b, R15 \ // y2 = (f^g)&e - ROLL $21, R14 \ // y1 = (a >> (13-2)) ^ (a >> (22-2)) - LONG $0xd273e9c5; BYTE $0x11 \ // VPSRLQ XMM2,XMM2,0x11 /* XTMP2 = W[-2] MY_ROR 17 {xDxC} */ - XORL f, R14 \ // y1 = a ^ (a >> (13-2)) ^ (a >> (22-2)) - ROLL $26, R13 \ // y0 = S1 = (e>>6) & (e>>11) ^ (e>>25) - XORL d, R15 \ // y2 = CH = ((f^g)&e)^g - LONG $0xd3efe9c5 \ // VPXOR XMM2,XMM2,XMM3 /* */ - ROLL $30, R14 \ // y1 = S0 = (a>>2) ^ (a>>13) ^ (a>>22) - ADDL R13, R15 \ // y2 = S1 + CH - ADDL _xfer+60(FP), R15 \ // y2 = k + w + S1 + CH - LONG $0xdaef21c5 \ // VPXOR XMM11,XMM11,XMM2 /* XTMP5 = s1 {xDxC} */ - MOVL f, R13 \ // y0 = a - ADDL R15, e \ // h = h + S1 + CH + k + w - MOVL f, R15 \ // y2 = a - LONG $0x002142c4; BYTE $0xdc \ // VPSHUFB XMM11,XMM11,XMM12 /* XTMP5 = s1 {DC00} */ - ORL h, R13 \ // y0 = a|c - ADDL e, a \ // d = d + h + S1 + CH + k + w - ANDL h, R15 \ // y2 = a&c - LONG $0xe0fea1c5 \ // VPADDD XMM4,XMM11,XMM0 /* X0 = {W[3], W[2], W[1], W[0]} */ - ANDL g, R13 \ // y0 = (a|c)&b - ADDL R14, e \ // h = h + S1 + CH + k + w + S0 - ORL R15, R13 \ // y0 = MAJ = (a|c)&b)|(a&c) - ADDL R13, e \ // h = h + S1 + CH + k + w + S0 + MAJ - \ // ROTATE_ARGS - ROTATE_XS - -#define DO_ROUND(a, b, c, d, e, f, g, h, offset) \ - MOVL e, R13 \ // y0 = e - ROLL $18, R13 \ // y0 = e >> (25-11) - MOVL a, R14 \ // y1 = a - XORL e, R13 \ // y0 = e ^ (e >> (25-11)) - ROLL $23, R14 \ // y1 = a >> (22-13) - MOVL f, R15 \ // y2 = f - XORL a, R14 \ // y1 = a ^ (a >> (22-13) - ROLL $27, R13 \ // y0 = (e >> (11-6)) ^ (e >> (25-6)) - XORL g, R15 \ // y2 = f^g - XORL e, R13 \ // y0 = e ^ (e >> (11-6)) ^ (e >> (25-6)) - ROLL $21, R14 \ // y1 = (a >> (13-2)) ^ (a >> (22-2)) - ANDL e, R15 \ // y2 = (f^g)&e - XORL a, R14 \ // y1 = a ^ (a >> (13-2)) ^ (a >> (22-2)) - ROLL $26, R13 \ // y0 = S1 = (e>>6) & (e>>11) ^ (e>>25) - XORL g, R15 \ // y2 = CH = ((f^g)&e)^g - ADDL R13, R15 \ // y2 = S1 + CH - ROLL $30, R14 \ // y1 = S0 = (a>>2) ^ (a>>13) ^ (a>>22) - ADDL _xfer+offset(FP), R15 \ // y2 = k + w + S1 + CH - MOVL a, R13 \ // y0 = a - ADDL R15, h \ // h = h + S1 + CH + k + w - MOVL a, R15 \ // y2 = a - ORL c, R13 \ // y0 = a|c - ADDL h, d \ // d = d + h + S1 + CH + k + w - ANDL c, R15 \ // y2 = a&c - ANDL b, R13 \ // y0 = (a|c)&b - ADDL R14, h \ // h = h + S1 + CH + k + w + S0 - ORL R15, R13 \ // y0 = MAJ = (a|c)&b)|(a&c) - ADDL R13, h // h = h + S1 + CH + k + w + S0 + MAJ - -// func blockAvx(h []uint32, message []uint8, reserved0, reserved1, reserved2, reserved3 uint64) -TEXT ·blockAvx(SB), 7, $0-80 - - MOVQ h+0(FP), SI // SI: &h - MOVQ message_base+24(FP), R8 // &message - MOVQ message_len+32(FP), R9 // length of message - CMPQ R9, $0 - JEQ done_hash - ADDQ R8, R9 - MOVQ R9, reserved2+64(FP) // store end of message - - // Register definition - // a --> eax - // b --> ebx - // c --> ecx - // d --> r8d - // e --> edx - // f --> r9d - // g --> r10d - // h --> r11d - // - // y0 --> r13d - // y1 --> r14d - // y2 --> r15d - - MOVL (0*4)(SI), AX // a = H0 - MOVL (1*4)(SI), BX // b = H1 - MOVL (2*4)(SI), CX // c = H2 - MOVL (3*4)(SI), R8 // d = H3 - MOVL (4*4)(SI), DX // e = H4 - MOVL (5*4)(SI), R9 // f = H5 - MOVL (6*4)(SI), R10 // g = H6 - MOVL (7*4)(SI), R11 // h = H7 - - MOVOU bflipMask<>(SB), X13 - MOVOU shuf00BA<>(SB), X10 // shuffle xBxA -> 00BA - MOVOU shufDC00<>(SB), X12 // shuffle xDxC -> DC00 - - MOVQ message_base+24(FP), SI // SI: &message - -loop0: - LEAQ constants<>(SB), BP - - // byte swap first 16 dwords - MOVOU 0*16(SI), X4 - LONG $0x0059c2c4; BYTE $0xe5 // VPSHUFB XMM4, XMM4, XMM13 - MOVOU 1*16(SI), X5 - LONG $0x0051c2c4; BYTE $0xed // VPSHUFB XMM5, XMM5, XMM13 - MOVOU 2*16(SI), X6 - LONG $0x0049c2c4; BYTE $0xf5 // VPSHUFB XMM6, XMM6, XMM13 - MOVOU 3*16(SI), X7 - LONG $0x0041c2c4; BYTE $0xfd // VPSHUFB XMM7, XMM7, XMM13 - - MOVQ SI, reserved3+72(FP) - MOVD $0x3, DI - - // schedule 48 input dwords, by doing 3 rounds of 16 each -loop1: - LONG $0x4dfe59c5; BYTE $0x00 // VPADDD XMM9, XMM4, 0[RBP] /* Add 1st constant to first part of message */ - MOVOU X9, reserved0+48(FP) - FOUR_ROUNDS_AND_SCHED(AX, BX, CX, R8, DX, R9, R10, R11) - - LONG $0x4dfe59c5; BYTE $0x10 // VPADDD XMM9, XMM4, 16[RBP] /* Add 2nd constant to message */ - MOVOU X9, reserved0+48(FP) - FOUR_ROUNDS_AND_SCHED(DX, R9, R10, R11, AX, BX, CX, R8) - - LONG $0x4dfe59c5; BYTE $0x20 // VPADDD XMM9, XMM4, 32[RBP] /* Add 3rd constant to message */ - MOVOU X9, reserved0+48(FP) - FOUR_ROUNDS_AND_SCHED(AX, BX, CX, R8, DX, R9, R10, R11) - - LONG $0x4dfe59c5; BYTE $0x30 // VPADDD XMM9, XMM4, 48[RBP] /* Add 4th constant to message */ - MOVOU X9, reserved0+48(FP) - ADDQ $64, BP - FOUR_ROUNDS_AND_SCHED(DX, R9, R10, R11, AX, BX, CX, R8) - - SUBQ $1, DI - JNE loop1 - - MOVD $0x2, DI - -loop2: - LONG $0x4dfe59c5; BYTE $0x00 // VPADDD XMM9, XMM4, 0[RBP] /* Add 1st constant to first part of message */ - MOVOU X9, reserved0+48(FP) - DO_ROUND( AX, BX, CX, R8, DX, R9, R10, R11, 48) - DO_ROUND(R11, AX, BX, CX, R8, DX, R9, R10, 52) - DO_ROUND(R10, R11, AX, BX, CX, R8, DX, R9, 56) - DO_ROUND( R9, R10, R11, AX, BX, CX, R8, DX, 60) - - LONG $0x4dfe51c5; BYTE $0x10 // VPADDD XMM9, XMM5, 16[RBP] /* Add 2nd constant to message */ - MOVOU X9, reserved0+48(FP) - ADDQ $32, BP - DO_ROUND( DX, R9, R10, R11, AX, BX, CX, R8, 48) - DO_ROUND( R8, DX, R9, R10, R11, AX, BX, CX, 52) - DO_ROUND( CX, R8, DX, R9, R10, R11, AX, BX, 56) - DO_ROUND( BX, CX, R8, DX, R9, R10, R11, AX, 60) - - MOVOU X6, X4 - MOVOU X7, X5 - - SUBQ $1, DI - JNE loop2 - - MOVQ h+0(FP), SI // SI: &h - ADDL (0*4)(SI), AX // H0 = a + H0 - MOVL AX, (0*4)(SI) - ADDL (1*4)(SI), BX // H1 = b + H1 - MOVL BX, (1*4)(SI) - ADDL (2*4)(SI), CX // H2 = c + H2 - MOVL CX, (2*4)(SI) - ADDL (3*4)(SI), R8 // H3 = d + H3 - MOVL R8, (3*4)(SI) - ADDL (4*4)(SI), DX // H4 = e + H4 - MOVL DX, (4*4)(SI) - ADDL (5*4)(SI), R9 // H5 = f + H5 - MOVL R9, (5*4)(SI) - ADDL (6*4)(SI), R10 // H6 = g + H6 - MOVL R10, (6*4)(SI) - ADDL (7*4)(SI), R11 // H7 = h + H7 - MOVL R11, (7*4)(SI) - - MOVQ reserved3+72(FP), SI - ADDQ $64, SI - CMPQ reserved2+64(FP), SI - JNE loop0 - -done_hash: - RET - -// Constants table -DATA constants<>+0x0(SB)/8, $0x71374491428a2f98 -DATA constants<>+0x8(SB)/8, $0xe9b5dba5b5c0fbcf -DATA constants<>+0x10(SB)/8, $0x59f111f13956c25b -DATA constants<>+0x18(SB)/8, $0xab1c5ed5923f82a4 -DATA constants<>+0x20(SB)/8, $0x12835b01d807aa98 -DATA constants<>+0x28(SB)/8, $0x550c7dc3243185be -DATA constants<>+0x30(SB)/8, $0x80deb1fe72be5d74 -DATA constants<>+0x38(SB)/8, $0xc19bf1749bdc06a7 -DATA constants<>+0x40(SB)/8, $0xefbe4786e49b69c1 -DATA constants<>+0x48(SB)/8, $0x240ca1cc0fc19dc6 -DATA constants<>+0x50(SB)/8, $0x4a7484aa2de92c6f -DATA constants<>+0x58(SB)/8, $0x76f988da5cb0a9dc -DATA constants<>+0x60(SB)/8, $0xa831c66d983e5152 -DATA constants<>+0x68(SB)/8, $0xbf597fc7b00327c8 -DATA constants<>+0x70(SB)/8, $0xd5a79147c6e00bf3 -DATA constants<>+0x78(SB)/8, $0x1429296706ca6351 -DATA constants<>+0x80(SB)/8, $0x2e1b213827b70a85 -DATA constants<>+0x88(SB)/8, $0x53380d134d2c6dfc -DATA constants<>+0x90(SB)/8, $0x766a0abb650a7354 -DATA constants<>+0x98(SB)/8, $0x92722c8581c2c92e -DATA constants<>+0xa0(SB)/8, $0xa81a664ba2bfe8a1 -DATA constants<>+0xa8(SB)/8, $0xc76c51a3c24b8b70 -DATA constants<>+0xb0(SB)/8, $0xd6990624d192e819 -DATA constants<>+0xb8(SB)/8, $0x106aa070f40e3585 -DATA constants<>+0xc0(SB)/8, $0x1e376c0819a4c116 -DATA constants<>+0xc8(SB)/8, $0x34b0bcb52748774c -DATA constants<>+0xd0(SB)/8, $0x4ed8aa4a391c0cb3 -DATA constants<>+0xd8(SB)/8, $0x682e6ff35b9cca4f -DATA constants<>+0xe0(SB)/8, $0x78a5636f748f82ee -DATA constants<>+0xe8(SB)/8, $0x8cc7020884c87814 -DATA constants<>+0xf0(SB)/8, $0xa4506ceb90befffa -DATA constants<>+0xf8(SB)/8, $0xc67178f2bef9a3f7 - -DATA bflipMask<>+0x00(SB)/8, $0x0405060700010203 -DATA bflipMask<>+0x08(SB)/8, $0x0c0d0e0f08090a0b - -DATA shuf00BA<>+0x00(SB)/8, $0x0b0a090803020100 -DATA shuf00BA<>+0x08(SB)/8, $0xFFFFFFFFFFFFFFFF - -DATA shufDC00<>+0x00(SB)/8, $0xFFFFFFFFFFFFFFFF -DATA shufDC00<>+0x08(SB)/8, $0x0b0a090803020100 - -GLOBL constants<>(SB), 8, $256 -GLOBL bflipMask<>(SB), (NOPTR+RODATA), $16 -GLOBL shuf00BA<>(SB), (NOPTR+RODATA), $16 -GLOBL shufDC00<>(SB), (NOPTR+RODATA), $16 diff --git a/vendor/github.com/minio/sha256-simd/sha256blockSha_amd64.go b/vendor/github.com/minio/sha256-simd/sha256blockSha_amd64.go index 483689ef0..bef949419 100644 --- a/vendor/github.com/minio/sha256-simd/sha256blockSha_amd64.go +++ b/vendor/github.com/minio/sha256-simd/sha256blockSha_amd64.go @@ -1,4 +1,4 @@ -//+build !noasm,!appengine +//+build !noasm,!appengine,gc package sha256 diff --git a/vendor/github.com/minio/sha256-simd/sha256blockSsse_amd64.go b/vendor/github.com/minio/sha256-simd/sha256blockSsse_amd64.go deleted file mode 100644 index 1ae2320bd..000000000 --- a/vendor/github.com/minio/sha256-simd/sha256blockSsse_amd64.go +++ /dev/null @@ -1,22 +0,0 @@ -//+build !noasm,!appengine - -/* - * Minio Cloud Storage, (C) 2016 Minio, Inc. - * - * Licensed under the Apache License, Version 2.0 (the "License"); - * you may not use this file except in compliance with the License. - * You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package sha256 - -//go:noescape -func blockSsse(h []uint32, message []uint8, reserved0, reserved1, reserved2, reserved3 uint64) diff --git a/vendor/github.com/minio/sha256-simd/sha256blockSsse_amd64.s b/vendor/github.com/minio/sha256-simd/sha256blockSsse_amd64.s deleted file mode 100644 index 7afb45c87..000000000 --- a/vendor/github.com/minio/sha256-simd/sha256blockSsse_amd64.s +++ /dev/null @@ -1,429 +0,0 @@ -//+build !noasm,!appengine - -// SHA256 implementation for SSSE3 - -// -// Minio Cloud Storage, (C) 2016 Minio, Inc. -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. -// - -// -// This code is based on an Intel White-Paper: -// "Fast SHA-256 Implementations on Intel Architecture Processors" -// -// together with the reference implementation from the following authors: -// James Guilford <james.guilford@intel.com> -// Kirk Yap <kirk.s.yap@intel.com> -// Tim Chen <tim.c.chen@linux.intel.com> -// -// For Golang it has been converted to Plan 9 assembly with the help of -// github.com/minio/asm2plan9s to assemble Intel instructions to their Plan9 -// equivalents -// - -#include "textflag.h" - -#define ROTATE_XS \ - MOVOU X4, X15 \ - MOVOU X5, X4 \ - MOVOU X6, X5 \ - MOVOU X7, X6 \ - MOVOU X15, X7 - -// compute s0 four at a time and s1 two at a time -// compute W[-16] + W[-7] 4 at a time -#define FOUR_ROUNDS_AND_SCHED(a, b, c, d, e, f, g, h) \ - MOVL e, R13 \ // y0 = e - ROLL $18, R13 \ // y0 = e >> (25-11) - MOVL a, R14 \ // y1 = a - MOVOU X7, X0 \ - LONG $0x0f3a0f66; WORD $0x04c6 \ // PALIGNR XMM0,XMM6,0x4 /* XTMP0 = W[-7] */ - ROLL $23, R14 \ // y1 = a >> (22-13) - XORL e, R13 \ // y0 = e ^ (e >> (25-11)) - MOVL f, R15 \ // y2 = f - ROLL $27, R13 \ // y0 = (e >> (11-6)) ^ (e >> (25-6)) - XORL a, R14 \ // y1 = a ^ (a >> (22-13) - XORL g, R15 \ // y2 = f^g - LONG $0xc4fe0f66 \ // PADDD XMM0,XMM4 /* XTMP0 = W[-7] + W[-16] */ - XORL e, R13 \ // y0 = e ^ (e >> (11-6)) ^ (e >> (25-6) ) - ANDL e, R15 \ // y2 = (f^g)&e - ROLL $21, R14 \ // y1 = (a >> (13-2)) ^ (a >> (22-2)) - \ - \ // compute s0 - \ - MOVOU X5, X1 \ - LONG $0x0f3a0f66; WORD $0x04cc \ // PALIGNR XMM1,XMM4,0x4 /* XTMP1 = W[-15] */ - XORL a, R14 \ // y1 = a ^ (a >> (13-2)) ^ (a >> (22-2)) - ROLL $26, R13 \ // y0 = S1 = (e>>6) & (e>>11) ^ (e>>25) - XORL g, R15 \ // y2 = CH = ((f^g)&e)^g - ROLL $30, R14 \ // y1 = S0 = (a>>2) ^ (a>>13) ^ (a>>22) - ADDL R13, R15 \ // y2 = S1 + CH - ADDL _xfer+48(FP), R15 \ // y2 = k + w + S1 + CH - MOVL a, R13 \ // y0 = a - ADDL R15, h \ // h = h + S1 + CH + k + w - \ // ROTATE_ARGS - MOVL a, R15 \ // y2 = a - MOVOU X1, X2 \ - LONG $0xd2720f66; BYTE $0x07 \ // PSRLD XMM2,0x7 /* */ - ORL c, R13 \ // y0 = a|c - ADDL h, d \ // d = d + h + S1 + CH + k + w - ANDL c, R15 \ // y2 = a&c - MOVOU X1, X3 \ - LONG $0xf3720f66; BYTE $0x19 \ // PSLLD XMM3,0x19 /* */ - ANDL b, R13 \ // y0 = (a|c)&b - ADDL R14, h \ // h = h + S1 + CH + k + w + S0 - LONG $0xdaeb0f66 \ // POR XMM3,XMM2 /* XTMP1 = W[-15] MY_ROR 7 */ - ORL R15, R13 \ // y0 = MAJ = (a|c)&b)|(a&c) - ADDL R13, h \ // h = h + S1 + CH + k + w + S0 + MAJ - \ // ROTATE_ARGS - MOVL d, R13 \ // y0 = e - MOVL h, R14 \ // y1 = a - ROLL $18, R13 \ // y0 = e >> (25-11) - XORL d, R13 \ // y0 = e ^ (e >> (25-11)) - MOVL e, R15 \ // y2 = f - ROLL $23, R14 \ // y1 = a >> (22-13) - MOVOU X1, X2 \ - LONG $0xd2720f66; BYTE $0x12 \ // PSRLD XMM2,0x12 /* */ - XORL h, R14 \ // y1 = a ^ (a >> (22-13) - ROLL $27, R13 \ // y0 = (e >> (11-6)) ^ (e >> (25-6)) - XORL f, R15 \ // y2 = f^g - MOVOU X1, X8 \ - LONG $0x720f4166; WORD $0x03d0 \ // PSRLD XMM8,0x3 /* XTMP4 = W[-15] >> 3 */ - ROLL $21, R14 \ // y1 = (a >> (13-2)) ^ (a >> (22-2)) - XORL d, R13 \ // y0 = e ^ (e >> (11-6)) ^ (e >> (25-6)) - ANDL d, R15 \ // y2 = (f^g)&e - ROLL $26, R13 \ // y0 = S1 = (e>>6) & (e>>11) ^ (e>>25) - LONG $0xf1720f66; BYTE $0x0e \ // PSLLD XMM1,0xe /* */ - XORL h, R14 \ // y1 = a ^ (a >> (13-2)) ^ (a >> (22-2)) - XORL f, R15 \ // y2 = CH = ((f^g)&e)^g - LONG $0xd9ef0f66 \ // PXOR XMM3,XMM1 /* */ - ADDL R13, R15 \ // y2 = S1 + CH - ADDL _xfer+52(FP), R15 \ // y2 = k + w + S1 + CH - ROLL $30, R14 \ // y1 = S0 = (a>>2) ^ (a>>13) ^ (a>>22) - LONG $0xdaef0f66 \ // PXOR XMM3,XMM2 /* XTMP1 = W[-15] MY_ROR 7 ^ W[-15] MY_ROR */ - MOVL h, R13 \ // y0 = a - ADDL R15, g \ // h = h + S1 + CH + k + w - MOVL h, R15 \ // y2 = a - MOVOU X3, X1 \ - LONG $0xef0f4166; BYTE $0xc8 \ // PXOR XMM1,XMM8 /* XTMP1 = s0 */ - ORL b, R13 \ // y0 = a|c - ADDL g, c \ // d = d + h + S1 + CH + k + w - ANDL b, R15 \ // y2 = a&c - \ - \ // compute low s1 - \ - LONG $0xd7700f66; BYTE $0xfa \ // PSHUFD XMM2,XMM7,0xfa /* XTMP2 = W[-2] {BBAA} */ - ANDL a, R13 \ // y0 = (a|c)&b - ADDL R14, g \ // h = h + S1 + CH + k + w + S0 - LONG $0xc1fe0f66 \ // PADDD XMM0,XMM1 /* XTMP0 = W[-16] + W[-7] + s0 */ - ORL R15, R13 \ // y0 = MAJ = (a|c)&b)|(a&c) - ADDL R13, g \ // h = h + S1 + CH + k + w + S0 + MAJ - \ // ROTATE_ARGS - MOVL c, R13 \ // y0 = e - MOVL g, R14 \ // y1 = a - ROLL $18, R13 \ // y0 = e >> (25-11) - XORL c, R13 \ // y0 = e ^ (e >> (25-11)) - ROLL $23, R14 \ // y1 = a >> (22-13) - MOVL d, R15 \ // y2 = f - XORL g, R14 \ // y1 = a ^ (a >> (22-13) - ROLL $27, R13 \ // y0 = (e >> (11-6)) ^ (e >> (25-6)) - MOVOU X2, X8 \ - LONG $0x720f4166; WORD $0x0ad0 \ // PSRLD XMM8,0xa /* XTMP4 = W[-2] >> 10 {BBAA} */ - XORL e, R15 \ // y2 = f^g - MOVOU X2, X3 \ - LONG $0xd3730f66; BYTE $0x13 \ // PSRLQ XMM3,0x13 /* XTMP3 = W[-2] MY_ROR 19 {xBxA} */ - XORL c, R13 \ // y0 = e ^ (e >> (11-6)) ^ (e >> (25-6)) - ANDL c, R15 \ // y2 = (f^g)&e - LONG $0xd2730f66; BYTE $0x11 \ // PSRLQ XMM2,0x11 /* XTMP2 = W[-2] MY_ROR 17 {xBxA} */ - ROLL $21, R14 \ // y1 = (a >> (13-2)) ^ (a >> (22-2)) - XORL g, R14 \ // y1 = a ^ (a >> (13-2)) ^ (a >> (22-2)) - XORL e, R15 \ // y2 = CH = ((f^g)&e)^g - ROLL $26, R13 \ // y0 = S1 = (e>>6) & (e>>11) ^ (e>>25) - LONG $0xd3ef0f66 \ // PXOR XMM2,XMM3 /* */ - ADDL R13, R15 \ // y2 = S1 + CH - ROLL $30, R14 \ // y1 = S0 = (a>>2) ^ (a>>13) ^ (a>>22) - ADDL _xfer+56(FP), R15 \ // y2 = k + w + S1 + CH - LONG $0xef0f4466; BYTE $0xc2 \ // PXOR XMM8,XMM2 /* XTMP4 = s1 {xBxA} */ - MOVL g, R13 \ // y0 = a - ADDL R15, f \ // h = h + S1 + CH + k + w - MOVL g, R15 \ // y2 = a - LONG $0x380f4566; WORD $0xc200 \ // PSHUFB XMM8,XMM10 /* XTMP4 = s1 {00BA} */ - ORL a, R13 \ // y0 = a|c - ADDL f, b \ // d = d + h + S1 + CH + k + w - ANDL a, R15 \ // y2 = a&c - LONG $0xfe0f4166; BYTE $0xc0 \ // PADDD XMM0,XMM8 /* XTMP0 = {..., ..., W[1], W[0]} */ - ANDL h, R13 \ // y0 = (a|c)&b - ADDL R14, f \ // h = h + S1 + CH + k + w + S0 - \ - \ // compute high s1 - \ - LONG $0xd0700f66; BYTE $0x50 \ // PSHUFD XMM2,XMM0,0x50 /* XTMP2 = W[-2] {DDCC} */ - ORL R15, R13 \ // y0 = MAJ = (a|c)&b)|(a&c) - ADDL R13, f \ // h = h + S1 + CH + k + w + S0 + MAJ - \ // ROTATE_ARGS - MOVL b, R13 \ // y0 = e - ROLL $18, R13 \ // y0 = e >> (25-11) - MOVL f, R14 \ // y1 = a - ROLL $23, R14 \ // y1 = a >> (22-13) - XORL b, R13 \ // y0 = e ^ (e >> (25-11)) - MOVL c, R15 \ // y2 = f - ROLL $27, R13 \ // y0 = (e >> (11-6)) ^ (e >> (25-6)) - MOVOU X2, X11 \ - LONG $0x720f4166; WORD $0x0ad3 \ // PSRLD XMM11,0xa /* XTMP5 = W[-2] >> 10 {DDCC} */ - XORL f, R14 \ // y1 = a ^ (a >> (22-13) - XORL d, R15 \ // y2 = f^g - MOVOU X2, X3 \ - LONG $0xd3730f66; BYTE $0x13 \ // PSRLQ XMM3,0x13 /* XTMP3 = W[-2] MY_ROR 19 {xDxC} */ - XORL b, R13 \ // y0 = e ^ (e >> (11-6)) ^ (e >> (25-6)) - ANDL b, R15 \ // y2 = (f^g)&e - ROLL $21, R14 \ // y1 = (a >> (13-2)) ^ (a >> (22-2)) - LONG $0xd2730f66; BYTE $0x11 \ // PSRLQ XMM2,0x11 /* XTMP2 = W[-2] MY_ROR 17 {xDxC} */ - XORL f, R14 \ // y1 = a ^ (a >> (13-2)) ^ (a >> (22-2)) - ROLL $26, R13 \ // y0 = S1 = (e>>6) & (e>>11) ^ (e>>25) - XORL d, R15 \ // y2 = CH = ((f^g)&e)^g - LONG $0xd3ef0f66 \ // PXOR XMM2,XMM3 /* */ - ROLL $30, R14 \ // y1 = S0 = (a>>2) ^ (a>>13) ^ (a>>22) - ADDL R13, R15 \ // y2 = S1 + CH - ADDL _xfer+60(FP), R15 \ // y2 = k + w + S1 + CH - LONG $0xef0f4466; BYTE $0xda \ // PXOR XMM11,XMM2 /* XTMP5 = s1 {xDxC} */ - MOVL f, R13 \ // y0 = a - ADDL R15, e \ // h = h + S1 + CH + k + w - MOVL f, R15 \ // y2 = a - LONG $0x380f4566; WORD $0xdc00 \ // PSHUFB XMM11,XMM12 /* XTMP5 = s1 {DC00} */ - ORL h, R13 \ // y0 = a|c - ADDL e, a \ // d = d + h + S1 + CH + k + w - ANDL h, R15 \ // y2 = a&c - MOVOU X11, X4 \ - LONG $0xe0fe0f66 \ // PADDD XMM4,XMM0 /* X0 = {W[3], W[2], W[1], W[0]} */ - ANDL g, R13 \ // y0 = (a|c)&b - ADDL R14, e \ // h = h + S1 + CH + k + w + S0 - ORL R15, R13 \ // y0 = MAJ = (a|c)&b)|(a&c) - ADDL R13, e \ // h = h + S1 + CH + k + w + S0 + MAJ - \ // ROTATE_ARGS - ROTATE_XS - -#define DO_ROUND(a, b, c, d, e, f, g, h, offset) \ - MOVL e, R13 \ // y0 = e - ROLL $18, R13 \ // y0 = e >> (25-11) - MOVL a, R14 \ // y1 = a - XORL e, R13 \ // y0 = e ^ (e >> (25-11)) - ROLL $23, R14 \ // y1 = a >> (22-13) - MOVL f, R15 \ // y2 = f - XORL a, R14 \ // y1 = a ^ (a >> (22-13) - ROLL $27, R13 \ // y0 = (e >> (11-6)) ^ (e >> (25-6)) - XORL g, R15 \ // y2 = f^g - XORL e, R13 \ // y0 = e ^ (e >> (11-6)) ^ (e >> (25-6)) - ROLL $21, R14 \ // y1 = (a >> (13-2)) ^ (a >> (22-2)) - ANDL e, R15 \ // y2 = (f^g)&e - XORL a, R14 \ // y1 = a ^ (a >> (13-2)) ^ (a >> (22-2)) - ROLL $26, R13 \ // y0 = S1 = (e>>6) & (e>>11) ^ (e>>25) - XORL g, R15 \ // y2 = CH = ((f^g)&e)^g - ADDL R13, R15 \ // y2 = S1 + CH - ROLL $30, R14 \ // y1 = S0 = (a>>2) ^ (a>>13) ^ (a>>22) - ADDL _xfer+offset(FP), R15 \ // y2 = k + w + S1 + CH - MOVL a, R13 \ // y0 = a - ADDL R15, h \ // h = h + S1 + CH + k + w - MOVL a, R15 \ // y2 = a - ORL c, R13 \ // y0 = a|c - ADDL h, d \ // d = d + h + S1 + CH + k + w - ANDL c, R15 \ // y2 = a&c - ANDL b, R13 \ // y0 = (a|c)&b - ADDL R14, h \ // h = h + S1 + CH + k + w + S0 - ORL R15, R13 \ // y0 = MAJ = (a|c)&b)|(a&c) - ADDL R13, h // h = h + S1 + CH + k + w + S0 + MAJ - -// func blockSsse(h []uint32, message []uint8, reserved0, reserved1, reserved2, reserved3 uint64) -TEXT ·blockSsse(SB), 7, $0-80 - - MOVQ h+0(FP), SI // SI: &h - MOVQ message_base+24(FP), R8 // &message - MOVQ message_len+32(FP), R9 // length of message - CMPQ R9, $0 - JEQ done_hash - ADDQ R8, R9 - MOVQ R9, reserved2+64(FP) // store end of message - - // Register definition - // a --> eax - // b --> ebx - // c --> ecx - // d --> r8d - // e --> edx - // f --> r9d - // g --> r10d - // h --> r11d - // - // y0 --> r13d - // y1 --> r14d - // y2 --> r15d - - MOVL (0*4)(SI), AX // a = H0 - MOVL (1*4)(SI), BX // b = H1 - MOVL (2*4)(SI), CX // c = H2 - MOVL (3*4)(SI), R8 // d = H3 - MOVL (4*4)(SI), DX // e = H4 - MOVL (5*4)(SI), R9 // f = H5 - MOVL (6*4)(SI), R10 // g = H6 - MOVL (7*4)(SI), R11 // h = H7 - - MOVOU bflipMask<>(SB), X13 - MOVOU shuf00BA<>(SB), X10 // shuffle xBxA -> 00BA - MOVOU shufDC00<>(SB), X12 // shuffle xDxC -> DC00 - - MOVQ message_base+24(FP), SI // SI: &message - -loop0: - LEAQ constants<>(SB), BP - - // byte swap first 16 dwords - MOVOU 0*16(SI), X4 - LONG $0x380f4166; WORD $0xe500 // PSHUFB XMM4, XMM13 - MOVOU 1*16(SI), X5 - LONG $0x380f4166; WORD $0xed00 // PSHUFB XMM5, XMM13 - MOVOU 2*16(SI), X6 - LONG $0x380f4166; WORD $0xf500 // PSHUFB XMM6, XMM13 - MOVOU 3*16(SI), X7 - LONG $0x380f4166; WORD $0xfd00 // PSHUFB XMM7, XMM13 - - MOVQ SI, reserved3+72(FP) - MOVD $0x3, DI - - // Align - // nop WORD PTR [rax+rax*1+0x0] - - // schedule 48 input dwords, by doing 3 rounds of 16 each -loop1: - MOVOU X4, X9 - LONG $0xfe0f4466; WORD $0x004d // PADDD XMM9, 0[RBP] /* Add 1st constant to first part of message */ - MOVOU X9, reserved0+48(FP) - FOUR_ROUNDS_AND_SCHED(AX, BX, CX, R8, DX, R9, R10, R11) - - MOVOU X4, X9 - LONG $0xfe0f4466; WORD $0x104d // PADDD XMM9, 16[RBP] /* Add 2nd constant to message */ - MOVOU X9, reserved0+48(FP) - FOUR_ROUNDS_AND_SCHED(DX, R9, R10, R11, AX, BX, CX, R8) - - MOVOU X4, X9 - LONG $0xfe0f4466; WORD $0x204d // PADDD XMM9, 32[RBP] /* Add 3rd constant to message */ - MOVOU X9, reserved0+48(FP) - FOUR_ROUNDS_AND_SCHED(AX, BX, CX, R8, DX, R9, R10, R11) - - MOVOU X4, X9 - LONG $0xfe0f4466; WORD $0x304d // PADDD XMM9, 48[RBP] /* Add 4th constant to message */ - MOVOU X9, reserved0+48(FP) - ADDQ $64, BP - FOUR_ROUNDS_AND_SCHED(DX, R9, R10, R11, AX, BX, CX, R8) - - SUBQ $1, DI - JNE loop1 - - MOVD $0x2, DI - -loop2: - MOVOU X4, X9 - LONG $0xfe0f4466; WORD $0x004d // PADDD XMM9, 0[RBP] /* Add 1st constant to first part of message */ - MOVOU X9, reserved0+48(FP) - DO_ROUND( AX, BX, CX, R8, DX, R9, R10, R11, 48) - DO_ROUND(R11, AX, BX, CX, R8, DX, R9, R10, 52) - DO_ROUND(R10, R11, AX, BX, CX, R8, DX, R9, 56) - DO_ROUND( R9, R10, R11, AX, BX, CX, R8, DX, 60) - - MOVOU X5, X9 - LONG $0xfe0f4466; WORD $0x104d // PADDD XMM9, 16[RBP] /* Add 2nd constant to message */ - MOVOU X9, reserved0+48(FP) - ADDQ $32, BP - DO_ROUND( DX, R9, R10, R11, AX, BX, CX, R8, 48) - DO_ROUND( R8, DX, R9, R10, R11, AX, BX, CX, 52) - DO_ROUND( CX, R8, DX, R9, R10, R11, AX, BX, 56) - DO_ROUND( BX, CX, R8, DX, R9, R10, R11, AX, 60) - - MOVOU X6, X4 - MOVOU X7, X5 - - SUBQ $1, DI - JNE loop2 - - MOVQ h+0(FP), SI // SI: &h - ADDL (0*4)(SI), AX // H0 = a + H0 - MOVL AX, (0*4)(SI) - ADDL (1*4)(SI), BX // H1 = b + H1 - MOVL BX, (1*4)(SI) - ADDL (2*4)(SI), CX // H2 = c + H2 - MOVL CX, (2*4)(SI) - ADDL (3*4)(SI), R8 // H3 = d + H3 - MOVL R8, (3*4)(SI) - ADDL (4*4)(SI), DX // H4 = e + H4 - MOVL DX, (4*4)(SI) - ADDL (5*4)(SI), R9 // H5 = f + H5 - MOVL R9, (5*4)(SI) - ADDL (6*4)(SI), R10 // H6 = g + H6 - MOVL R10, (6*4)(SI) - ADDL (7*4)(SI), R11 // H7 = h + H7 - MOVL R11, (7*4)(SI) - - MOVQ reserved3+72(FP), SI - ADDQ $64, SI - CMPQ reserved2+64(FP), SI - JNE loop0 - -done_hash: - RET - -// Constants table -DATA constants<>+0x0(SB)/8, $0x71374491428a2f98 -DATA constants<>+0x8(SB)/8, $0xe9b5dba5b5c0fbcf -DATA constants<>+0x10(SB)/8, $0x59f111f13956c25b -DATA constants<>+0x18(SB)/8, $0xab1c5ed5923f82a4 -DATA constants<>+0x20(SB)/8, $0x12835b01d807aa98 -DATA constants<>+0x28(SB)/8, $0x550c7dc3243185be -DATA constants<>+0x30(SB)/8, $0x80deb1fe72be5d74 -DATA constants<>+0x38(SB)/8, $0xc19bf1749bdc06a7 -DATA constants<>+0x40(SB)/8, $0xefbe4786e49b69c1 -DATA constants<>+0x48(SB)/8, $0x240ca1cc0fc19dc6 -DATA constants<>+0x50(SB)/8, $0x4a7484aa2de92c6f -DATA constants<>+0x58(SB)/8, $0x76f988da5cb0a9dc -DATA constants<>+0x60(SB)/8, $0xa831c66d983e5152 -DATA constants<>+0x68(SB)/8, $0xbf597fc7b00327c8 -DATA constants<>+0x70(SB)/8, $0xd5a79147c6e00bf3 -DATA constants<>+0x78(SB)/8, $0x1429296706ca6351 -DATA constants<>+0x80(SB)/8, $0x2e1b213827b70a85 -DATA constants<>+0x88(SB)/8, $0x53380d134d2c6dfc -DATA constants<>+0x90(SB)/8, $0x766a0abb650a7354 -DATA constants<>+0x98(SB)/8, $0x92722c8581c2c92e -DATA constants<>+0xa0(SB)/8, $0xa81a664ba2bfe8a1 -DATA constants<>+0xa8(SB)/8, $0xc76c51a3c24b8b70 -DATA constants<>+0xb0(SB)/8, $0xd6990624d192e819 -DATA constants<>+0xb8(SB)/8, $0x106aa070f40e3585 -DATA constants<>+0xc0(SB)/8, $0x1e376c0819a4c116 -DATA constants<>+0xc8(SB)/8, $0x34b0bcb52748774c -DATA constants<>+0xd0(SB)/8, $0x4ed8aa4a391c0cb3 -DATA constants<>+0xd8(SB)/8, $0x682e6ff35b9cca4f -DATA constants<>+0xe0(SB)/8, $0x78a5636f748f82ee -DATA constants<>+0xe8(SB)/8, $0x8cc7020884c87814 -DATA constants<>+0xf0(SB)/8, $0xa4506ceb90befffa -DATA constants<>+0xf8(SB)/8, $0xc67178f2bef9a3f7 - -DATA bflipMask<>+0x00(SB)/8, $0x0405060700010203 -DATA bflipMask<>+0x08(SB)/8, $0x0c0d0e0f08090a0b - -DATA shuf00BA<>+0x00(SB)/8, $0x0b0a090803020100 -DATA shuf00BA<>+0x08(SB)/8, $0xFFFFFFFFFFFFFFFF - -DATA shufDC00<>+0x00(SB)/8, $0xFFFFFFFFFFFFFFFF -DATA shufDC00<>+0x08(SB)/8, $0x0b0a090803020100 - -GLOBL constants<>(SB), 8, $256 -GLOBL bflipMask<>(SB), (NOPTR+RODATA), $16 -GLOBL shuf00BA<>(SB), (NOPTR+RODATA), $16 -GLOBL shufDC00<>(SB), (NOPTR+RODATA), $16 diff --git a/vendor/github.com/minio/sha256-simd/sha256block_amd64.go b/vendor/github.com/minio/sha256-simd/sha256block_amd64.go index 1c4d97f0c..0c48d45f8 100644 --- a/vendor/github.com/minio/sha256-simd/sha256block_amd64.go +++ b/vendor/github.com/minio/sha256-simd/sha256block_amd64.go @@ -1,4 +1,4 @@ -//+build !noasm,!appengine +//+build !noasm,!appengine,gc /* * Minio Cloud Storage, (C) 2016 Minio, Inc. @@ -18,36 +18,10 @@ package sha256 -func blockArmGo(dig *digest, p []byte) {} - -func blockAvxGo(dig *digest, p []byte) { - - h := []uint32{dig.h[0], dig.h[1], dig.h[2], dig.h[3], dig.h[4], dig.h[5], dig.h[6], dig.h[7]} - - blockAvx(h[:], p[:], 0, 0, 0, 0) - - dig.h[0], dig.h[1], dig.h[2], dig.h[3], dig.h[4], dig.h[5], dig.h[6], dig.h[7] = h[0], h[1], h[2], h[3], h[4], h[5], h[6], h[7] -} - -func blockAvx2Go(dig *digest, p []byte) { - - h := []uint32{dig.h[0], dig.h[1], dig.h[2], dig.h[3], dig.h[4], dig.h[5], dig.h[6], dig.h[7]} - - blockAvx2(h[:], p[:]) - - dig.h[0], dig.h[1], dig.h[2], dig.h[3], dig.h[4], dig.h[5], dig.h[6], dig.h[7] = h[0], h[1], h[2], h[3], h[4], h[5], h[6], h[7] -} - -func blockSsseGo(dig *digest, p []byte) { - - h := []uint32{dig.h[0], dig.h[1], dig.h[2], dig.h[3], dig.h[4], dig.h[5], dig.h[6], dig.h[7]} - - blockSsse(h[:], p[:], 0, 0, 0, 0) - - dig.h[0], dig.h[1], dig.h[2], dig.h[3], dig.h[4], dig.h[5], dig.h[6], dig.h[7] = h[0], h[1], h[2], h[3], h[4], h[5], h[6], h[7] +func blockArmGo(dig *digest, p []byte) { + panic("blockArmGo called unexpectedly") } func blockShaGo(dig *digest, p []byte) { - blockSha(&dig.h, p) } diff --git a/vendor/github.com/minio/sha256-simd/sha256block_arm64.go b/vendor/github.com/minio/sha256-simd/sha256block_arm64.go index 0979c20ae..58ccf6eb5 100644 --- a/vendor/github.com/minio/sha256-simd/sha256block_arm64.go +++ b/vendor/github.com/minio/sha256-simd/sha256block_arm64.go @@ -1,4 +1,4 @@ -//+build !noasm,!appengine +//+build !noasm,!appengine,gc /* * Minio Cloud Storage, (C) 2016 Minio, Inc. @@ -18,10 +18,9 @@ package sha256 -func blockAvx2Go(dig *digest, p []byte) {} -func blockAvxGo(dig *digest, p []byte) {} -func blockSsseGo(dig *digest, p []byte) {} -func blockShaGo(dig *digest, p []byte) {} +func blockShaGo(dig *digest, p []byte) { + panic("blockShaGoc called unexpectedly") +} //go:noescape func blockArm(h []uint32, message []uint8) diff --git a/vendor/github.com/minio/sha256-simd/sha256block_other.go b/vendor/github.com/minio/sha256-simd/sha256block_other.go index 0187c950a..ec586c060 100644 --- a/vendor/github.com/minio/sha256-simd/sha256block_other.go +++ b/vendor/github.com/minio/sha256-simd/sha256block_other.go @@ -1,4 +1,4 @@ -//+build appengine noasm !amd64,!arm64 +//+build appengine noasm !amd64,!arm64 !gc /* * Minio Cloud Storage, (C) 2019 Minio, Inc. @@ -18,8 +18,11 @@ package sha256 -func blockAvx2Go(dig *digest, p []byte) {} -func blockAvxGo(dig *digest, p []byte) {} -func blockSsseGo(dig *digest, p []byte) {} -func blockShaGo(dig *digest, p []byte) {} -func blockArmGo(dig *digest, p []byte) {} +func blockShaGo(dig *digest, p []byte) { + panic("blockShaGo called unexpectedly") + +} + +func blockArmGo(dig *digest, p []byte) { + panic("blockArmGo called unexpectedly") +} diff --git a/vendor/github.com/mitchellh/go-homedir/README.md b/vendor/github.com/mitchellh/go-homedir/README.md deleted file mode 100644 index d70706d5b..000000000 --- a/vendor/github.com/mitchellh/go-homedir/README.md +++ /dev/null @@ -1,14 +0,0 @@ -# go-homedir - -This is a Go library for detecting the user's home directory without -the use of cgo, so the library can be used in cross-compilation environments. - -Usage is incredibly simple, just call `homedir.Dir()` to get the home directory -for a user, and `homedir.Expand()` to expand the `~` in a path to the home -directory. - -**Why not just use `os/user`?** The built-in `os/user` package requires -cgo on Darwin systems. This means that any Go code that uses that package -cannot cross compile. But 99% of the time the use for `os/user` is just to -retrieve the home directory, which we can do for the current user without -cgo. This library does that, enabling cross-compilation. diff --git a/vendor/github.com/mitchellh/go-homedir/homedir.go b/vendor/github.com/mitchellh/go-homedir/homedir.go deleted file mode 100644 index 25378537e..000000000 --- a/vendor/github.com/mitchellh/go-homedir/homedir.go +++ /dev/null @@ -1,167 +0,0 @@ -package homedir - -import ( - "bytes" - "errors" - "os" - "os/exec" - "path/filepath" - "runtime" - "strconv" - "strings" - "sync" -) - -// DisableCache will disable caching of the home directory. Caching is enabled -// by default. -var DisableCache bool - -var homedirCache string -var cacheLock sync.RWMutex - -// Dir returns the home directory for the executing user. -// -// This uses an OS-specific method for discovering the home directory. -// An error is returned if a home directory cannot be detected. -func Dir() (string, error) { - if !DisableCache { - cacheLock.RLock() - cached := homedirCache - cacheLock.RUnlock() - if cached != "" { - return cached, nil - } - } - - cacheLock.Lock() - defer cacheLock.Unlock() - - var result string - var err error - if runtime.GOOS == "windows" { - result, err = dirWindows() - } else { - // Unix-like system, so just assume Unix - result, err = dirUnix() - } - - if err != nil { - return "", err - } - homedirCache = result - return result, nil -} - -// Expand expands the path to include the home directory if the path -// is prefixed with `~`. If it isn't prefixed with `~`, the path is -// returned as-is. -func Expand(path string) (string, error) { - if len(path) == 0 { - return path, nil - } - - if path[0] != '~' { - return path, nil - } - - if len(path) > 1 && path[1] != '/' && path[1] != '\\' { - return "", errors.New("cannot expand user-specific home dir") - } - - dir, err := Dir() - if err != nil { - return "", err - } - - return filepath.Join(dir, path[1:]), nil -} - -// Reset clears the cache, forcing the next call to Dir to re-detect -// the home directory. This generally never has to be called, but can be -// useful in tests if you're modifying the home directory via the HOME -// env var or something. -func Reset() { - cacheLock.Lock() - defer cacheLock.Unlock() - homedirCache = "" -} - -func dirUnix() (string, error) { - homeEnv := "HOME" - if runtime.GOOS == "plan9" { - // On plan9, env vars are lowercase. - homeEnv = "home" - } - - // First prefer the HOME environmental variable - if home := os.Getenv(homeEnv); home != "" { - return home, nil - } - - var stdout bytes.Buffer - - // If that fails, try OS specific commands - if runtime.GOOS == "darwin" { - cmd := exec.Command("sh", "-c", `dscl -q . -read /Users/"$(whoami)" NFSHomeDirectory | sed 's/^[^ ]*: //'`) - cmd.Stdout = &stdout - if err := cmd.Run(); err == nil { - result := strings.TrimSpace(stdout.String()) - if result != "" { - return result, nil - } - } - } else { - cmd := exec.Command("getent", "passwd", strconv.Itoa(os.Getuid())) - cmd.Stdout = &stdout - if err := cmd.Run(); err != nil { - // If the error is ErrNotFound, we ignore it. Otherwise, return it. - if err != exec.ErrNotFound { - return "", err - } - } else { - if passwd := strings.TrimSpace(stdout.String()); passwd != "" { - // username:password:uid:gid:gecos:home:shell - passwdParts := strings.SplitN(passwd, ":", 7) - if len(passwdParts) > 5 { - return passwdParts[5], nil - } - } - } - } - - // If all else fails, try the shell - stdout.Reset() - cmd := exec.Command("sh", "-c", "cd && pwd") - cmd.Stdout = &stdout - if err := cmd.Run(); err != nil { - return "", err - } - - result := strings.TrimSpace(stdout.String()) - if result == "" { - return "", errors.New("blank output when reading home directory") - } - - return result, nil -} - -func dirWindows() (string, error) { - // First prefer the HOME environmental variable - if home := os.Getenv("HOME"); home != "" { - return home, nil - } - - // Prefer standard environment variable USERPROFILE - if home := os.Getenv("USERPROFILE"); home != "" { - return home, nil - } - - drive := os.Getenv("HOMEDRIVE") - path := os.Getenv("HOMEPATH") - home := drive + path - if drive == "" || path == "" { - return "", errors.New("HOMEDRIVE, HOMEPATH, or USERPROFILE are blank") - } - - return home, nil -} diff --git a/vendor/github.com/pelletier/go-toml/v2/.goreleaser.yaml b/vendor/github.com/pelletier/go-toml/v2/.goreleaser.yaml index 793fb1849..3aa1840ec 100644 --- a/vendor/github.com/pelletier/go-toml/v2/.goreleaser.yaml +++ b/vendor/github.com/pelletier/go-toml/v2/.goreleaser.yaml @@ -16,7 +16,11 @@ builds: mod_timestamp: '{{ .CommitTimestamp }}' targets: - linux_amd64 + - linux_arm64 + - linux_arm - windows_amd64 + - windows_arm64 + - windows_arm - darwin_amd64 - darwin_arm64 - id: tomljson @@ -31,7 +35,11 @@ builds: mod_timestamp: '{{ .CommitTimestamp }}' targets: - linux_amd64 + - linux_arm64 + - linux_arm - windows_amd64 + - windows_arm64 + - windows_arm - darwin_amd64 - darwin_arm64 - id: jsontoml @@ -46,7 +54,11 @@ builds: mod_timestamp: '{{ .CommitTimestamp }}' targets: - linux_amd64 + - linux_arm64 + - linux_arm - windows_amd64 + - windows_arm64 + - windows_arm - darwin_amd64 - darwin_arm64 universal_binaries: diff --git a/vendor/github.com/pelletier/go-toml/v2/README.md b/vendor/github.com/pelletier/go-toml/v2/README.md index 9d3bb1022..a63c3a796 100644 --- a/vendor/github.com/pelletier/go-toml/v2/README.md +++ b/vendor/github.com/pelletier/go-toml/v2/README.md @@ -38,7 +38,7 @@ operations should not be shockingly slow. See [benchmarks](#benchmarks). ### Strict mode `Decoder` can be set to "strict mode", which makes it error when some parts of -the TOML document was not prevent in the target structure. This is a great way +the TOML document was not present in the target structure. This is a great way to check for typos. [See example in the documentation][strict]. [strict]: https://pkg.go.dev/github.com/pelletier/go-toml/v2#example-Decoder.DisallowUnknownFields @@ -540,6 +540,13 @@ complete solutions exist out there. [query]: https://github.com/pelletier/go-toml/tree/f99d6bbca119636aeafcf351ee52b3d202782627/query [dasel]: https://github.com/TomWright/dasel +## Versioning + +Go-toml follows [Semantic Versioning](http://semver.org/). The supported version +of [TOML](https://github.com/toml-lang/toml) is indicated at the beginning of +this document. The last two major versions of Go are supported +(see [Go Release Policy](https://golang.org/doc/devel/release.html#policy)). + ## License The MIT License (MIT). Read [LICENSE](LICENSE). diff --git a/vendor/github.com/pelletier/go-toml/v2/errors.go b/vendor/github.com/pelletier/go-toml/v2/errors.go index 5e6635c3e..2e7f0ffdf 100644 --- a/vendor/github.com/pelletier/go-toml/v2/errors.go +++ b/vendor/github.com/pelletier/go-toml/v2/errors.go @@ -103,6 +103,7 @@ func (e *DecodeError) Key() Key { // // The function copies all bytes used in DecodeError, so that document and // highlight can be freely deallocated. +// //nolint:funlen func wrapDecodeError(document []byte, de *decodeError) *DecodeError { offset := danger.SubsliceOffset(document, de.highlight) diff --git a/vendor/github.com/pelletier/go-toml/v2/internal/ast/ast.go b/vendor/github.com/pelletier/go-toml/v2/internal/ast/ast.go index 33c7f9155..9dec2e000 100644 --- a/vendor/github.com/pelletier/go-toml/v2/internal/ast/ast.go +++ b/vendor/github.com/pelletier/go-toml/v2/internal/ast/ast.go @@ -11,10 +11,10 @@ import ( // // For example: // -// it := n.Children() -// for it.Next() { -// it.Node() -// } +// it := n.Children() +// for it.Next() { +// it.Node() +// } type Iterator struct { started bool node *Node diff --git a/vendor/github.com/pelletier/go-toml/v2/marshaler.go b/vendor/github.com/pelletier/go-toml/v2/marshaler.go index 91f3b3c20..acb288315 100644 --- a/vendor/github.com/pelletier/go-toml/v2/marshaler.go +++ b/vendor/github.com/pelletier/go-toml/v2/marshaler.go @@ -54,7 +54,7 @@ func NewEncoder(w io.Writer) *Encoder { // This behavior can be controlled on an individual struct field basis with the // inline tag: // -// MyField `inline:"true"` +// MyField `toml:",inline"` func (enc *Encoder) SetTablesInline(inline bool) *Encoder { enc.tablesInline = inline return enc @@ -65,7 +65,7 @@ func (enc *Encoder) SetTablesInline(inline bool) *Encoder { // // This behavior can be controlled on an individual struct field basis with the multiline tag: // -// MyField `multiline:"true"` +// MyField `multiline:"true"` func (enc *Encoder) SetArraysMultiline(multiline bool) *Encoder { enc.arraysMultiline = multiline return enc @@ -89,7 +89,7 @@ func (enc *Encoder) SetIndentTables(indent bool) *Encoder { // // If v cannot be represented to TOML it returns an error. // -// Encoding rules +// # Encoding rules // // A top level slice containing only maps or structs is encoded as [[table // array]]. @@ -107,10 +107,30 @@ func (enc *Encoder) SetIndentTables(indent bool) *Encoder { // a newline character or a single quote. In that case they are emitted as // quoted strings. // +// Unsigned integers larger than math.MaxInt64 cannot be encoded. Doing so +// results in an error. This rule exists because the TOML specification only +// requires parsers to support at least the 64 bits integer range. Allowing +// larger numbers would create non-standard TOML documents, which may not be +// readable (at best) by other implementations. To encode such numbers, a +// solution is a custom type that implements encoding.TextMarshaler. +// // When encoding structs, fields are encoded in order of definition, with their // exact name. // -// Struct tags +// Tables and array tables are separated by empty lines. However, consecutive +// subtables definitions are not. For example: +// +// [top1] +// +// [top2] +// [top2.child1] +// +// [[array]] +// +// [[array]] +// [array.child2] +// +// # Struct tags // // The encoding of each public struct field can be customized by the format // string in the "toml" key of the struct field's tag. This follows @@ -128,7 +148,8 @@ func (enc *Encoder) SetIndentTables(indent bool) *Encoder { // // In addition to the "toml" tag struct tag, a "comment" tag can be used to emit // a TOML comment before the value being annotated. Comments are ignored inside -// inline tables. +// inline tables. For array tables, the comment is only present before the first +// element of the array. func (enc *Encoder) Encode(v interface{}) error { var ( b []byte @@ -302,7 +323,11 @@ func (enc *Encoder) encode(b []byte, ctx encoderCtx, v reflect.Value) ([]byte, e b = append(b, "false"...) } case reflect.Uint64, reflect.Uint32, reflect.Uint16, reflect.Uint8, reflect.Uint: - b = strconv.AppendUint(b, v.Uint(), 10) + x := v.Uint() + if x > uint64(math.MaxInt64) { + return nil, fmt.Errorf("toml: not encoding uint (%d) greater than max int64 (%d)", x, int64(math.MaxInt64)) + } + b = strconv.AppendUint(b, x, 10) case reflect.Int64, reflect.Int32, reflect.Int16, reflect.Int8, reflect.Int: b = strconv.AppendInt(b, v.Int(), 10) default: @@ -321,13 +346,13 @@ func isNil(v reflect.Value) bool { } } +func shouldOmitEmpty(options valueOptions, v reflect.Value) bool { + return options.omitempty && isEmptyValue(v) +} + func (enc *Encoder) encodeKv(b []byte, ctx encoderCtx, options valueOptions, v reflect.Value) ([]byte, error) { var err error - if (ctx.options.omitempty || options.omitempty) && isEmptyValue(v) { - return b, nil - } - if !ctx.inline { b = enc.encodeComment(ctx.indent, options.comment, b) } @@ -353,6 +378,8 @@ func (enc *Encoder) encodeKv(b []byte, ctx encoderCtx, options valueOptions, v r func isEmptyValue(v reflect.Value) bool { switch v.Kind() { + case reflect.Struct: + return isEmptyStruct(v) case reflect.Array, reflect.Map, reflect.Slice, reflect.String: return v.Len() == 0 case reflect.Bool: @@ -369,6 +396,34 @@ func isEmptyValue(v reflect.Value) bool { return false } +func isEmptyStruct(v reflect.Value) bool { + // TODO: merge with walkStruct and cache. + typ := v.Type() + for i := 0; i < typ.NumField(); i++ { + fieldType := typ.Field(i) + + // only consider exported fields + if fieldType.PkgPath != "" { + continue + } + + tag := fieldType.Tag.Get("toml") + + // special field name to skip field + if tag == "-" { + continue + } + + f := v.Field(i) + + if !isEmptyValue(f) { + return false + } + } + + return true +} + const literalQuote = '\'' func (enc *Encoder) encodeString(b []byte, v string, options valueOptions) []byte { @@ -398,7 +453,6 @@ func (enc *Encoder) encodeLiteralString(b []byte, v string) []byte { return b } -//nolint:cyclop func (enc *Encoder) encodeQuotedString(multiline bool, b []byte, v string) []byte { stringQuote := `"` @@ -652,10 +706,19 @@ func (enc *Encoder) encodeStruct(b []byte, ctx encoderCtx, v reflect.Value) ([]b } func (enc *Encoder) encodeComment(indent int, comment string, b []byte) []byte { - if comment != "" { + for len(comment) > 0 { + var line string + idx := strings.IndexByte(comment, '\n') + if idx >= 0 { + line = comment[:idx] + comment = comment[idx+1:] + } else { + line = comment + comment = "" + } b = enc.indent(indent, b) b = append(b, "# "...) - b = append(b, comment...) + b = append(b, line...) b = append(b, '\n') } return b @@ -736,7 +799,13 @@ func (enc *Encoder) encodeTable(b []byte, ctx encoderCtx, t table) ([]byte, erro } ctx.skipTableHeader = false + hasNonEmptyKV := false for _, kv := range t.kvs { + if shouldOmitEmpty(kv.Options, kv.Value) { + continue + } + hasNonEmptyKV = true + ctx.setKey(kv.Key) b, err = enc.encodeKv(b, ctx, kv.Options, kv.Value) @@ -747,7 +816,20 @@ func (enc *Encoder) encodeTable(b []byte, ctx encoderCtx, t table) ([]byte, erro b = append(b, '\n') } + first := true for _, table := range t.tables { + if shouldOmitEmpty(table.Options, table.Value) { + continue + } + if first { + first = false + if hasNonEmptyKV { + b = append(b, '\n') + } + } else { + b = append(b, "\n"...) + } + ctx.setKey(table.Key) ctx.options = table.Options @@ -756,8 +838,6 @@ func (enc *Encoder) encodeTable(b []byte, ctx encoderCtx, t table) ([]byte, erro if err != nil { return nil, err } - - b = append(b, '\n') } return b, nil @@ -770,6 +850,10 @@ func (enc *Encoder) encodeTableInline(b []byte, ctx encoderCtx, t table) ([]byte first := true for _, kv := range t.kvs { + if shouldOmitEmpty(kv.Options, kv.Value) { + continue + } + if first { first = false } else { @@ -785,7 +869,7 @@ func (enc *Encoder) encodeTableInline(b []byte, ctx encoderCtx, t table) ([]byte } if len(t.tables) > 0 { - panic("inline table cannot contain nested tables, online key-values") + panic("inline table cannot contain nested tables, only key-values") } b = append(b, "}"...) @@ -881,7 +965,13 @@ func (enc *Encoder) encodeSliceAsArrayTable(b []byte, ctx encoderCtx, v reflect. scratch = append(scratch, "]]\n"...) ctx.skipTableHeader = true + b = enc.encodeComment(ctx.indent, ctx.options.comment, b) + for i := 0; i < v.Len(); i++ { + if i != 0 { + b = append(b, "\n"...) + } + b = append(b, scratch...) var err error diff --git a/vendor/github.com/pelletier/go-toml/v2/unmarshaler.go b/vendor/github.com/pelletier/go-toml/v2/unmarshaler.go index 2219f704e..d0d7a72d0 100644 --- a/vendor/github.com/pelletier/go-toml/v2/unmarshaler.go +++ b/vendor/github.com/pelletier/go-toml/v2/unmarshaler.go @@ -79,22 +79,22 @@ func (d *Decoder) DisallowUnknownFields() *Decoder { // strict mode and a field is missing, a `toml.StrictMissingError` is // returned. In any other case, this function returns a standard Go error. // -// Type mapping +// # Type mapping // // List of supported TOML types and their associated accepted Go types: // -// String -> string -// Integer -> uint*, int*, depending on size -// Float -> float*, depending on size -// Boolean -> bool -// Offset Date-Time -> time.Time -// Local Date-time -> LocalDateTime, time.Time -// Local Date -> LocalDate, time.Time -// Local Time -> LocalTime, time.Time -// Array -> slice and array, depending on elements types -// Table -> map and struct -// Inline Table -> same as Table -// Array of Tables -> same as Array and Table +// String -> string +// Integer -> uint*, int*, depending on size +// Float -> float*, depending on size +// Boolean -> bool +// Offset Date-Time -> time.Time +// Local Date-time -> LocalDateTime, time.Time +// Local Date -> LocalDate, time.Time +// Local Time -> LocalTime, time.Time +// Array -> slice and array, depending on elements types +// Table -> map and struct +// Inline Table -> same as Table +// Array of Tables -> same as Array and Table func (d *Decoder) Decode(v interface{}) error { b, err := ioutil.ReadAll(d.r) if err != nil { @@ -123,7 +123,7 @@ type decoder struct { stashedExpr bool // Skip expressions until a table is found. This is set to true when a - // table could not be create (missing field in map), so all KV expressions + // table could not be created (missing field in map), so all KV expressions // need to be skipped. skipUntilTable bool @@ -344,9 +344,9 @@ func (d *decoder) handleArrayTableCollectionLast(key ast.Iterator, v reflect.Val elem := v.Index(idx) _, err := d.handleArrayTable(key, elem) return v, err + default: + return reflect.Value{}, fmt.Errorf("toml: cannot decode array table into a %s", v.Type()) } - - return d.handleArrayTable(key, v) } // When parsing an array table expression, each part of the key needs to be @@ -483,7 +483,7 @@ func (d *decoder) handleKeyPart(key ast.Iterator, v reflect.Value, nextFn handle d.errorContext.Struct = t d.errorContext.Field = path - f := v.FieldByIndex(path) + f := fieldByIndex(v, path) x, err := nextFn(key, f) if err != nil || d.skipUntilTable { return reflect.Value{}, err @@ -866,12 +866,27 @@ func (d *decoder) unmarshalFloat(value *ast.Node, v reflect.Value) error { return nil } -func (d *decoder) unmarshalInteger(value *ast.Node, v reflect.Value) error { - const ( - maxInt = int64(^uint(0) >> 1) - minInt = -maxInt - 1 - ) +const ( + maxInt = int64(^uint(0) >> 1) + minInt = -maxInt - 1 +) + +// Maximum value of uint for decoding. Currently the decoder parses the integer +// into an int64. As a result, on architectures where uint is 64 bits, the +// effective maximum uint we can decode is the maximum of int64. On +// architectures where uint is 32 bits, the maximum value we can decode is +// lower: the maximum of uint32. I didn't find a way to figure out this value at +// compile time, so it is computed during initialization. +var maxUint int64 = math.MaxInt64 + +func init() { + m := uint64(^uint(0)) + if m < uint64(maxUint) { + maxUint = int64(m) + } +} +func (d *decoder) unmarshalInteger(value *ast.Node, v reflect.Value) error { i, err := parseInteger(value.Data) if err != nil { return err @@ -932,7 +947,7 @@ func (d *decoder) unmarshalInteger(value *ast.Node, v reflect.Value) error { r = reflect.ValueOf(uint8(i)) case reflect.Uint: - if i < 0 { + if i < 0 || i > maxUint { return fmt.Errorf("toml: negative number %d does not fit in an uint", i) } @@ -1056,7 +1071,7 @@ func (d *decoder) handleKeyValuePart(key ast.Iterator, value *ast.Node, v reflec d.errorContext.Struct = t d.errorContext.Field = path - f := v.FieldByIndex(path) + f := fieldByIndex(v, path) x, err := d.handleKeyValueInner(key, value, f) if err != nil { return reflect.Value{}, err @@ -1120,6 +1135,21 @@ func initAndDereferencePointer(v reflect.Value) reflect.Value { return elem } +// Same as reflect.Value.FieldByIndex, but creates pointers if needed. +func fieldByIndex(v reflect.Value, path []int) reflect.Value { + for i, x := range path { + v = v.Field(x) + + if i < len(path)-1 && v.Kind() == reflect.Ptr { + if v.IsNil() { + v.Set(reflect.New(v.Type().Elem())) + } + v = v.Elem() + } + } + return v +} + type fieldPathsMap = map[string][]int var globalFieldPathsCache atomic.Value // map[danger.TypeID]fieldPathsMap @@ -1167,11 +1197,6 @@ func forEachField(t reflect.Type, path []int, do func(name string, path []int)) fieldPath := append(path, i) fieldPath = fieldPath[:len(fieldPath):len(fieldPath)] - if f.Anonymous { - forEachField(f.Type, fieldPath, do) - continue - } - name := f.Tag.Get("toml") if name == "-" { continue @@ -1180,6 +1205,19 @@ func forEachField(t reflect.Type, path []int, do func(name string, path []int)) if i := strings.IndexByte(name, ','); i >= 0 { name = name[:i] } + + if f.Anonymous && name == "" { + t2 := f.Type + if t2.Kind() == reflect.Ptr { + t2 = t2.Elem() + } + + if t2.Kind() == reflect.Struct { + forEachField(t2, fieldPath, do) + } + continue + } + if name == "" { name = f.Name } diff --git a/vendor/github.com/rs/xid/README.md b/vendor/github.com/rs/xid/README.md index 1f886fd7c..5bf462e83 100644 --- a/vendor/github.com/rs/xid/README.md +++ b/vendor/github.com/rs/xid/README.md @@ -2,9 +2,9 @@ [](https://godoc.org/github.com/rs/xid) [](https://raw.githubusercontent.com/rs/xid/master/LICENSE) [](https://travis-ci.org/rs/xid) [](http://gocover.io/github.com/rs/xid) -Package xid is a globally unique id generator library, ready to be used safely directly in your server code. +Package xid is a globally unique id generator library, ready to safely be used directly in your server code. -Xid is using Mongo Object ID algorithm to generate globally unique ids with a different serialization (base64) to make it shorter when transported as a string: +Xid uses the Mongo Object ID algorithm to generate globally unique ids with a different serialization (base64) to make it shorter when transported as a string: https://docs.mongodb.org/manual/reference/object-id/ - 4-byte value representing the seconds since the Unix epoch, @@ -33,7 +33,7 @@ is required so it can be used directly in server's code. |-------------|-------------|----------------|---------------- | [UUID] | 16 bytes | 36 chars | configuration free, not sortable | [shortuuid] | 16 bytes | 22 chars | configuration free, not sortable -| [Snowflake] | 8 bytes | up to 20 chars | needs machin/DC configuration, needs central server, sortable +| [Snowflake] | 8 bytes | up to 20 chars | needs machine/DC configuration, needs central server, sortable | [MongoID] | 12 bytes | 24 chars | configuration free, sortable | xid | 12 bytes | 20 chars | configuration free, sortable @@ -57,7 +57,7 @@ Best used with [zerolog](https://github.com/rs/zerolog)'s Notes: -- Xid is dependent on the system time, a monotonic counter and so is not cryptographically secure. If unpredictability of IDs is important, you should not use Xids. It is worth noting that most of the other UUID like implementations are also not cryptographically secure. You shoud use libraries that rely on cryptographically secure sources (like /dev/urandom on unix, crypto/rand in golang), if you want a truly random ID generator. +- Xid is dependent on the system time, a monotonic counter and so is not cryptographically secure. If unpredictability of IDs is important, you should not use Xids. It is worth noting that most other UUID-like implementations are also not cryptographically secure. You should use libraries that rely on cryptographically secure sources (like /dev/urandom on unix, crypto/rand in golang), if you want a truly random ID generator. References: @@ -66,6 +66,10 @@ References: - https://blog.twitter.com/2010/announcing-snowflake - Python port by [Graham Abbott](https://github.com/graham): https://github.com/graham/python_xid - Scala port by [Egor Kolotaev](https://github.com/kolotaev): https://github.com/kolotaev/ride +- Rust port by [Jérôme Renard](https://github.com/jeromer/): https://github.com/jeromer/libxid +- Ruby port by [Valar](https://github.com/valarpirai/): https://github.com/valarpirai/ruby_xid +- Java port by [0xShamil](https://github.com/0xShamil/): https://github.com/0xShamil/java-xid +- Dart port by [Peter Bwire](https://github.com/pitabwire): https://pub.dev/packages/xid ## Install @@ -105,7 +109,7 @@ BenchmarkUUIDv4-2 1000000 1427 ns/op 64 B/op 2 allocs/op BenchmarkUUIDv4-4 1000000 1452 ns/op 64 B/op 2 allocs/op ``` -Note: UUIDv1 requires a global lock, hence the performence degrading as we add more CPUs. +Note: UUIDv1 requires a global lock, hence the performance degradation as we add more CPUs. ## Licenses diff --git a/vendor/github.com/rs/xid/error.go b/vendor/github.com/rs/xid/error.go new file mode 100644 index 000000000..ea2537493 --- /dev/null +++ b/vendor/github.com/rs/xid/error.go @@ -0,0 +1,11 @@ +package xid + +const ( + // ErrInvalidID is returned when trying to unmarshal an invalid ID. + ErrInvalidID strErr = "xid: invalid ID" +) + +// strErr allows declaring errors as constants. +type strErr string + +func (err strErr) Error() string { return string(err) } diff --git a/vendor/github.com/rs/xid/hostid_linux.go b/vendor/github.com/rs/xid/hostid_linux.go index 7d0c4a9ec..837b20436 100644 --- a/vendor/github.com/rs/xid/hostid_linux.go +++ b/vendor/github.com/rs/xid/hostid_linux.go @@ -5,6 +5,9 @@ package xid import "io/ioutil" func readPlatformMachineID() (string, error) { - b, err := ioutil.ReadFile("/sys/class/dmi/id/product_uuid") + b, err := ioutil.ReadFile("/etc/machine-id") + if err != nil || len(b) == 0 { + b, err = ioutil.ReadFile("/sys/class/dmi/id/product_uuid") + } return string(b), err } diff --git a/vendor/github.com/rs/xid/id.go b/vendor/github.com/rs/xid/id.go index 466faf262..1f536b415 100644 --- a/vendor/github.com/rs/xid/id.go +++ b/vendor/github.com/rs/xid/id.go @@ -47,7 +47,6 @@ import ( "crypto/rand" "database/sql/driver" "encoding/binary" - "errors" "fmt" "hash/crc32" "io/ioutil" @@ -55,6 +54,7 @@ import ( "sort" "sync/atomic" "time" + "unsafe" ) // Code inspired from mgo/bson ObjectId @@ -72,9 +72,6 @@ const ( ) var ( - // ErrInvalidID is returned when trying to unmarshal an invalid ID - ErrInvalidID = errors.New("xid: invalid ID") - // objectIDCounter is atomically incremented when generating a new ObjectId // using NewObjectId() function. It's used as a counter part of an id. // This id is initialized with a random value. @@ -177,7 +174,13 @@ func FromString(id string) (ID, error) { func (id ID) String() string { text := make([]byte, encodedLen) encode(text, id[:]) - return string(text) + return *(*string)(unsafe.Pointer(&text)) +} + +// Encode encodes the id using base32 encoding, writing 20 bytes to dst and return it. +func (id ID) Encode(dst []byte) []byte { + encode(dst, id[:]) + return dst } // MarshalText implements encoding/text TextMarshaler interface @@ -192,32 +195,37 @@ func (id ID) MarshalJSON() ([]byte, error) { if id.IsNil() { return []byte("null"), nil } - text, err := id.MarshalText() - return []byte(`"` + string(text) + `"`), err + text := make([]byte, encodedLen+2) + encode(text[1:encodedLen+1], id[:]) + text[0], text[encodedLen+1] = '"', '"' + return text, nil } // encode by unrolling the stdlib base32 algorithm + removing all safe checks func encode(dst, id []byte) { - dst[0] = encoding[id[0]>>3] - dst[1] = encoding[(id[1]>>6)&0x1F|(id[0]<<2)&0x1F] - dst[2] = encoding[(id[1]>>1)&0x1F] - dst[3] = encoding[(id[2]>>4)&0x1F|(id[1]<<4)&0x1F] - dst[4] = encoding[id[3]>>7|(id[2]<<1)&0x1F] - dst[5] = encoding[(id[3]>>2)&0x1F] - dst[6] = encoding[id[4]>>5|(id[3]<<3)&0x1F] - dst[7] = encoding[id[4]&0x1F] - dst[8] = encoding[id[5]>>3] - dst[9] = encoding[(id[6]>>6)&0x1F|(id[5]<<2)&0x1F] - dst[10] = encoding[(id[6]>>1)&0x1F] - dst[11] = encoding[(id[7]>>4)&0x1F|(id[6]<<4)&0x1F] - dst[12] = encoding[id[8]>>7|(id[7]<<1)&0x1F] - dst[13] = encoding[(id[8]>>2)&0x1F] - dst[14] = encoding[(id[9]>>5)|(id[8]<<3)&0x1F] - dst[15] = encoding[id[9]&0x1F] - dst[16] = encoding[id[10]>>3] - dst[17] = encoding[(id[11]>>6)&0x1F|(id[10]<<2)&0x1F] - dst[18] = encoding[(id[11]>>1)&0x1F] + _ = dst[19] + _ = id[11] + dst[19] = encoding[(id[11]<<4)&0x1F] + dst[18] = encoding[(id[11]>>1)&0x1F] + dst[17] = encoding[(id[11]>>6)&0x1F|(id[10]<<2)&0x1F] + dst[16] = encoding[id[10]>>3] + dst[15] = encoding[id[9]&0x1F] + dst[14] = encoding[(id[9]>>5)|(id[8]<<3)&0x1F] + dst[13] = encoding[(id[8]>>2)&0x1F] + dst[12] = encoding[id[8]>>7|(id[7]<<1)&0x1F] + dst[11] = encoding[(id[7]>>4)&0x1F|(id[6]<<4)&0x1F] + dst[10] = encoding[(id[6]>>1)&0x1F] + dst[9] = encoding[(id[6]>>6)&0x1F|(id[5]<<2)&0x1F] + dst[8] = encoding[id[5]>>3] + dst[7] = encoding[id[4]&0x1F] + dst[6] = encoding[id[4]>>5|(id[3]<<3)&0x1F] + dst[5] = encoding[(id[3]>>2)&0x1F] + dst[4] = encoding[id[3]>>7|(id[2]<<1)&0x1F] + dst[3] = encoding[(id[2]>>4)&0x1F|(id[1]<<4)&0x1F] + dst[2] = encoding[(id[1]>>1)&0x1F] + dst[1] = encoding[(id[1]>>6)&0x1F|(id[0]<<2)&0x1F] + dst[0] = encoding[id[0]>>3] } // UnmarshalText implements encoding/text TextUnmarshaler interface @@ -230,7 +238,9 @@ func (id *ID) UnmarshalText(text []byte) error { return ErrInvalidID } } - decode(id, text) + if !decode(id, text) { + return ErrInvalidID + } return nil } @@ -241,23 +251,40 @@ func (id *ID) UnmarshalJSON(b []byte) error { *id = nilID return nil } + // Check the slice length to prevent panic on passing it to UnmarshalText() + if len(b) < 2 { + return ErrInvalidID + } return id.UnmarshalText(b[1 : len(b)-1]) } -// decode by unrolling the stdlib base32 algorithm + removing all safe checks -func decode(id *ID, src []byte) { - id[0] = dec[src[0]]<<3 | dec[src[1]]>>2 - id[1] = dec[src[1]]<<6 | dec[src[2]]<<1 | dec[src[3]]>>4 - id[2] = dec[src[3]]<<4 | dec[src[4]]>>1 - id[3] = dec[src[4]]<<7 | dec[src[5]]<<2 | dec[src[6]]>>3 - id[4] = dec[src[6]]<<5 | dec[src[7]] - id[5] = dec[src[8]]<<3 | dec[src[9]]>>2 - id[6] = dec[src[9]]<<6 | dec[src[10]]<<1 | dec[src[11]]>>4 - id[7] = dec[src[11]]<<4 | dec[src[12]]>>1 - id[8] = dec[src[12]]<<7 | dec[src[13]]<<2 | dec[src[14]]>>3 - id[9] = dec[src[14]]<<5 | dec[src[15]] - id[10] = dec[src[16]]<<3 | dec[src[17]]>>2 +// decode by unrolling the stdlib base32 algorithm + customized safe check. +func decode(id *ID, src []byte) bool { + _ = src[19] + _ = id[11] + id[11] = dec[src[17]]<<6 | dec[src[18]]<<1 | dec[src[19]]>>4 + id[10] = dec[src[16]]<<3 | dec[src[17]]>>2 + id[9] = dec[src[14]]<<5 | dec[src[15]] + id[8] = dec[src[12]]<<7 | dec[src[13]]<<2 | dec[src[14]]>>3 + id[7] = dec[src[11]]<<4 | dec[src[12]]>>1 + id[6] = dec[src[9]]<<6 | dec[src[10]]<<1 | dec[src[11]]>>4 + id[5] = dec[src[8]]<<3 | dec[src[9]]>>2 + id[4] = dec[src[6]]<<5 | dec[src[7]] + id[3] = dec[src[4]]<<7 | dec[src[5]]<<2 | dec[src[6]]>>3 + id[2] = dec[src[3]]<<4 | dec[src[4]]>>1 + id[1] = dec[src[1]]<<6 | dec[src[2]]<<1 | dec[src[3]]>>4 + id[0] = dec[src[0]]<<3 | dec[src[1]]>>2 + + // Validate that there are no discarer bits (padding) in src that would + // cause the string-encoded id not to equal src. + var check [4]byte + + check[3] = encoding[(id[11]<<4)&0x1F] + check[2] = encoding[(id[11]>>1)&0x1F] + check[1] = encoding[(id[11]>>6)&0x1F|(id[10]<<2)&0x1F] + check[0] = encoding[id[10]>>3] + return bytes.Equal([]byte(src[16:20]), check[:]) } // Time returns the timestamp part of the id. diff --git a/vendor/github.com/sirupsen/logrus/README.md b/vendor/github.com/sirupsen/logrus/README.md index 5152b6aa4..b042c896f 100644 --- a/vendor/github.com/sirupsen/logrus/README.md +++ b/vendor/github.com/sirupsen/logrus/README.md @@ -1,4 +1,4 @@ -# Logrus <img src="http://i.imgur.com/hTeVwmJ.png" width="40" height="40" alt=":walrus:" class="emoji" title=":walrus:"/> [](https://travis-ci.org/sirupsen/logrus) [](https://godoc.org/github.com/sirupsen/logrus) +# Logrus <img src="http://i.imgur.com/hTeVwmJ.png" width="40" height="40" alt=":walrus:" class="emoji" title=":walrus:"/> [](https://github.com/sirupsen/logrus/actions?query=workflow%3ACI) [](https://travis-ci.org/sirupsen/logrus) [](https://pkg.go.dev/github.com/sirupsen/logrus) Logrus is a structured logger for Go (golang), completely API compatible with the standard library logger. @@ -341,7 +341,7 @@ import ( log "github.com/sirupsen/logrus" ) -init() { +func init() { // do something here to set environment depending on an environment variable // or command-line flag if Environment == "production" { diff --git a/vendor/github.com/sirupsen/logrus/buffer_pool.go b/vendor/github.com/sirupsen/logrus/buffer_pool.go index 4545dec07..c7787f77c 100644 --- a/vendor/github.com/sirupsen/logrus/buffer_pool.go +++ b/vendor/github.com/sirupsen/logrus/buffer_pool.go @@ -26,15 +26,6 @@ func (p *defaultPool) Get() *bytes.Buffer { return p.pool.Get().(*bytes.Buffer) } -func getBuffer() *bytes.Buffer { - return bufferPool.Get() -} - -func putBuffer(buf *bytes.Buffer) { - buf.Reset() - bufferPool.Put(buf) -} - // SetBufferPool allows to replace the default logrus buffer pool // to better meets the specific needs of an application. func SetBufferPool(bp BufferPool) { diff --git a/vendor/github.com/sirupsen/logrus/entry.go b/vendor/github.com/sirupsen/logrus/entry.go index 07a1e5fa7..71cdbbc35 100644 --- a/vendor/github.com/sirupsen/logrus/entry.go +++ b/vendor/github.com/sirupsen/logrus/entry.go @@ -232,6 +232,7 @@ func (entry *Entry) log(level Level, msg string) { newEntry.Logger.mu.Lock() reportCaller := newEntry.Logger.ReportCaller + bufPool := newEntry.getBufferPool() newEntry.Logger.mu.Unlock() if reportCaller { @@ -239,11 +240,11 @@ func (entry *Entry) log(level Level, msg string) { } newEntry.fireHooks() - - buffer = getBuffer() + buffer = bufPool.Get() defer func() { newEntry.Buffer = nil - putBuffer(buffer) + buffer.Reset() + bufPool.Put(buffer) }() buffer.Reset() newEntry.Buffer = buffer @@ -260,6 +261,13 @@ func (entry *Entry) log(level Level, msg string) { } } +func (entry *Entry) getBufferPool() (pool BufferPool) { + if entry.Logger.BufferPool != nil { + return entry.Logger.BufferPool + } + return bufferPool +} + func (entry *Entry) fireHooks() { var tmpHooks LevelHooks entry.Logger.mu.Lock() @@ -276,18 +284,21 @@ func (entry *Entry) fireHooks() { } func (entry *Entry) write() { + entry.Logger.mu.Lock() + defer entry.Logger.mu.Unlock() serialized, err := entry.Logger.Formatter.Format(entry) if err != nil { fmt.Fprintf(os.Stderr, "Failed to obtain reader, %v\n", err) return } - entry.Logger.mu.Lock() - defer entry.Logger.mu.Unlock() if _, err := entry.Logger.Out.Write(serialized); err != nil { fmt.Fprintf(os.Stderr, "Failed to write to log, %v\n", err) } } +// Log will log a message at the level given as parameter. +// Warning: using Log at Panic or Fatal level will not respectively Panic nor Exit. +// For this behaviour Entry.Panic or Entry.Fatal should be used instead. func (entry *Entry) Log(level Level, args ...interface{}) { if entry.Logger.IsLevelEnabled(level) { entry.log(level, fmt.Sprint(args...)) diff --git a/vendor/github.com/sirupsen/logrus/logger.go b/vendor/github.com/sirupsen/logrus/logger.go index 337704457..5ff0aef6d 100644 --- a/vendor/github.com/sirupsen/logrus/logger.go +++ b/vendor/github.com/sirupsen/logrus/logger.go @@ -44,6 +44,9 @@ type Logger struct { entryPool sync.Pool // Function to exit the application, defaults to `os.Exit()` ExitFunc exitFunc + // The buffer pool used to format the log. If it is nil, the default global + // buffer pool will be used. + BufferPool BufferPool } type exitFunc func(int) @@ -192,6 +195,9 @@ func (logger *Logger) Panicf(format string, args ...interface{}) { logger.Logf(PanicLevel, format, args...) } +// Log will log a message at the level given as parameter. +// Warning: using Log at Panic or Fatal level will not respectively Panic nor Exit. +// For this behaviour Logger.Panic or Logger.Fatal should be used instead. func (logger *Logger) Log(level Level, args ...interface{}) { if logger.IsLevelEnabled(level) { entry := logger.newEntry() @@ -402,3 +408,10 @@ func (logger *Logger) ReplaceHooks(hooks LevelHooks) LevelHooks { logger.mu.Unlock() return oldHooks } + +// SetBufferPool sets the logger buffer pool. +func (logger *Logger) SetBufferPool(pool BufferPool) { + logger.mu.Lock() + defer logger.mu.Unlock() + logger.BufferPool = pool +} diff --git a/vendor/github.com/spf13/afero/.travis.yml b/vendor/github.com/spf13/afero/.travis.yml deleted file mode 100644 index e944f5947..000000000 --- a/vendor/github.com/spf13/afero/.travis.yml +++ /dev/null @@ -1,26 +0,0 @@ -sudo: false -language: go -arch: - - amd64 - - ppc64e - -go: - - "1.14" - - "1.15" - - "1.16" - - tip - -os: - - linux - - osx - -matrix: - allow_failures: - - go: tip - fast_finish: true - -script: - - go build -v ./... - - go test -count=1 -cover -race -v ./... - - go vet ./... - - FILES=$(gofmt -s -l . zipfs sftpfs mem tarfs); if [[ -n "${FILES}" ]]; then echo "You have go format errors; gofmt your changes"; exit 1; fi diff --git a/vendor/github.com/spf13/afero/README.md b/vendor/github.com/spf13/afero/README.md index cab257f56..3bafbfdfc 100644 --- a/vendor/github.com/spf13/afero/README.md +++ b/vendor/github.com/spf13/afero/README.md @@ -2,7 +2,7 @@ A FileSystem Abstraction System for Go -[](https://travis-ci.org/spf13/afero) [](https://ci.appveyor.com/project/spf13/afero) [](https://godoc.org/github.com/spf13/afero) [](https://gitter.im/spf13/afero?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge&utm_content=badge) +[](https://github.com/spf13/afero/actions/workflows/test.yml) [](https://godoc.org/github.com/spf13/afero) [](https://gitter.im/spf13/afero?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge&utm_content=badge) # Overview diff --git a/vendor/github.com/spf13/afero/afero.go b/vendor/github.com/spf13/afero/afero.go index 469ff7d2d..199480cd0 100644 --- a/vendor/github.com/spf13/afero/afero.go +++ b/vendor/github.com/spf13/afero/afero.go @@ -103,8 +103,8 @@ type Fs interface { var ( ErrFileClosed = errors.New("File is closed") - ErrOutOfRange = errors.New("Out of range") - ErrTooLarge = errors.New("Too large") + ErrOutOfRange = errors.New("out of range") + ErrTooLarge = errors.New("too large") ErrFileNotFound = os.ErrNotExist ErrFileExists = os.ErrExist ErrDestinationExists = os.ErrExist diff --git a/vendor/github.com/spf13/afero/appveyor.yml b/vendor/github.com/spf13/afero/appveyor.yml index 5d2f34bf1..65e20e8ca 100644 --- a/vendor/github.com/spf13/afero/appveyor.yml +++ b/vendor/github.com/spf13/afero/appveyor.yml @@ -1,3 +1,5 @@ +# This currently does nothing. We have moved to GitHub action, but this is kept +# until spf13 has disabled this project in AppVeyor. version: '{build}' clone_folder: C:\gopath\src\github.com\spf13\afero environment: @@ -6,10 +8,3 @@ build_script: - cmd: >- go version - go env - - go get -v github.com/spf13/afero/... - - go build -v github.com/spf13/afero/... -test_script: -- cmd: go test -count=1 -cover -race -v github.com/spf13/afero/... diff --git a/vendor/github.com/spf13/afero/basepath.go b/vendor/github.com/spf13/afero/basepath.go index 4f9832829..70a1d9168 100644 --- a/vendor/github.com/spf13/afero/basepath.go +++ b/vendor/github.com/spf13/afero/basepath.go @@ -1,6 +1,7 @@ package afero import ( + "io/fs" "os" "path/filepath" "runtime" @@ -8,7 +9,10 @@ import ( "time" ) -var _ Lstater = (*BasePathFs)(nil) +var ( + _ Lstater = (*BasePathFs)(nil) + _ fs.ReadDirFile = (*BasePathFile)(nil) +) // The BasePathFs restricts all operations to a given path within an Fs. // The given file name to the operations on this Fs will be prepended with @@ -33,6 +37,14 @@ func (f *BasePathFile) Name() string { return strings.TrimPrefix(sourcename, filepath.Clean(f.path)) } +func (f *BasePathFile) ReadDir(n int) ([]fs.DirEntry, error) { + if rdf, ok := f.File.(fs.ReadDirFile); ok { + return rdf.ReadDir(n) + + } + return readDirFile{f.File}.ReadDir(n) +} + func NewBasePathFs(source Fs, path string) Fs { return &BasePathFs{source: source, path: path} } diff --git a/vendor/github.com/spf13/afero/const_bsds.go b/vendor/github.com/spf13/afero/const_bsds.go index 18b45824b..eed0f225f 100644 --- a/vendor/github.com/spf13/afero/const_bsds.go +++ b/vendor/github.com/spf13/afero/const_bsds.go @@ -11,6 +11,7 @@ // See the License for the specific language governing permissions and // limitations under the License. +//go:build aix || darwin || openbsd || freebsd || netbsd || dragonfly // +build aix darwin openbsd freebsd netbsd dragonfly package afero diff --git a/vendor/github.com/spf13/afero/const_win_unix.go b/vendor/github.com/spf13/afero/const_win_unix.go index 2b850e4dd..004d57e2f 100644 --- a/vendor/github.com/spf13/afero/const_win_unix.go +++ b/vendor/github.com/spf13/afero/const_win_unix.go @@ -10,12 +10,8 @@ // WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. // See the License for the specific language governing permissions and // limitations under the License. -// +build !darwin -// +build !openbsd -// +build !freebsd -// +build !dragonfly -// +build !netbsd -// +build !aix +//go:build !darwin && !openbsd && !freebsd && !dragonfly && !netbsd && !aix +// +build !darwin,!openbsd,!freebsd,!dragonfly,!netbsd,!aix package afero diff --git a/vendor/github.com/spf13/afero/httpFs.go b/vendor/github.com/spf13/afero/httpFs.go index 2b86e30d1..ac0de6d51 100644 --- a/vendor/github.com/spf13/afero/httpFs.go +++ b/vendor/github.com/spf13/afero/httpFs.go @@ -29,7 +29,7 @@ type httpDir struct { } func (d httpDir) Open(name string) (http.File, error) { - if filepath.Separator != '/' && strings.IndexRune(name, filepath.Separator) >= 0 || + if filepath.Separator != '/' && strings.ContainsRune(name, filepath.Separator) || strings.Contains(name, "\x00") { return nil, errors.New("http: invalid character in file path") } diff --git a/vendor/github.com/minio/sha256-simd/cpuid_arm.go b/vendor/github.com/spf13/afero/internal/common/adapters.go index 351dff4b6..60685caa5 100644 --- a/vendor/github.com/minio/sha256-simd/cpuid_arm.go +++ b/vendor/github.com/spf13/afero/internal/common/adapters.go @@ -1,32 +1,27 @@ -// Minio Cloud Storage, (C) 2016 Minio, Inc. +// Copyright © 2022 Steve Francia <spf@spf13.com>. // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. // You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 +// http://www.apache.org/licenses/LICENSE-2.0 // // Unless required by applicable law or agreed to in writing, software // distributed under the License is distributed on an "AS IS" BASIS, // WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. // See the License for the specific language governing permissions and // limitations under the License. -// -package sha256 +package common -func cpuid(op uint32) (eax, ebx, ecx, edx uint32) { - return 0, 0, 0, 0 -} +import "io/fs" -func cpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32) { - return 0, 0, 0, 0 +// FileInfoDirEntry provides an adapter from os.FileInfo to fs.DirEntry +type FileInfoDirEntry struct { + fs.FileInfo } -func xgetbv(index uint32) (eax, edx uint32) { - return 0, 0 -} +var _ fs.DirEntry = FileInfoDirEntry{} -func haveArmSha() bool { - return false -} +func (d FileInfoDirEntry) Type() fs.FileMode { return d.FileInfo.Mode().Type() } + +func (d FileInfoDirEntry) Info() (fs.FileInfo, error) { return d.FileInfo, nil } diff --git a/vendor/github.com/spf13/afero/iofs.go b/vendor/github.com/spf13/afero/iofs.go index c80345536..938b9316e 100644 --- a/vendor/github.com/spf13/afero/iofs.go +++ b/vendor/github.com/spf13/afero/iofs.go @@ -1,3 +1,4 @@ +//go:build go1.16 // +build go1.16 package afero @@ -7,7 +8,10 @@ import ( "io/fs" "os" "path" + "sort" "time" + + "github.com/spf13/afero/internal/common" ) // IOFS adopts afero.Fs to stdlib io/fs.FS @@ -66,14 +70,31 @@ func (iofs IOFS) Glob(pattern string) ([]string, error) { } func (iofs IOFS) ReadDir(name string) ([]fs.DirEntry, error) { - items, err := ReadDir(iofs.Fs, name) + f, err := iofs.Fs.Open(name) if err != nil { return nil, iofs.wrapError("readdir", name, err) } + defer f.Close() + + if rdf, ok := f.(fs.ReadDirFile); ok { + items, err := rdf.ReadDir(-1) + if err != nil { + return nil, iofs.wrapError("readdir", name, err) + } + sort.Slice(items, func(i, j int) bool { return items[i].Name() < items[j].Name() }) + return items, nil + } + + items, err := f.Readdir(-1) + if err != nil { + return nil, iofs.wrapError("readdir", name, err) + } + sort.Sort(byName(items)) + ret := make([]fs.DirEntry, len(items)) for i := range items { - ret[i] = dirEntry{items[i]} + ret[i] = common.FileInfoDirEntry{FileInfo: items[i]} } return ret, nil @@ -108,17 +129,6 @@ func (IOFS) wrapError(op, path string, err error) error { } } -// dirEntry provides adapter from os.FileInfo to fs.DirEntry -type dirEntry struct { - fs.FileInfo -} - -var _ fs.DirEntry = dirEntry{} - -func (d dirEntry) Type() fs.FileMode { return d.FileInfo.Mode().Type() } - -func (d dirEntry) Info() (fs.FileInfo, error) { return d.FileInfo, nil } - // readDirFile provides adapter from afero.File to fs.ReadDirFile needed for correct Open type readDirFile struct { File @@ -134,7 +144,7 @@ func (r readDirFile) ReadDir(n int) ([]fs.DirEntry, error) { ret := make([]fs.DirEntry, len(items)) for i := range items { - ret[i] = dirEntry{items[i]} + ret[i] = common.FileInfoDirEntry{FileInfo: items[i]} } return ret, nil diff --git a/vendor/github.com/spf13/afero/ioutil.go b/vendor/github.com/spf13/afero/ioutil.go index a403133e2..386c9cdc2 100644 --- a/vendor/github.com/spf13/afero/ioutil.go +++ b/vendor/github.com/spf13/afero/ioutil.go @@ -141,7 +141,7 @@ func WriteFile(fs Fs, filename string, data []byte, perm os.FileMode) error { // We generate random temporary file names so that there's a good // chance the file doesn't exist yet - keeps the number of tries in // TempFile to a minimum. -var rand uint32 +var randNum uint32 var randmu sync.Mutex func reseed() uint32 { @@ -150,12 +150,12 @@ func reseed() uint32 { func nextRandom() string { randmu.Lock() - r := rand + r := randNum if r == 0 { r = reseed() } r = r*1664525 + 1013904223 // constants from Numerical Recipes - rand = r + randNum = r randmu.Unlock() return strconv.Itoa(int(1e9 + r%1e9))[1:] } @@ -194,7 +194,7 @@ func TempFile(fs Fs, dir, pattern string) (f File, err error) { if os.IsExist(err) { if nconflict++; nconflict > 10 { randmu.Lock() - rand = reseed() + randNum = reseed() randmu.Unlock() } continue @@ -226,7 +226,7 @@ func TempDir(fs Fs, dir, prefix string) (name string, err error) { if os.IsExist(err) { if nconflict++; nconflict > 10 { randmu.Lock() - rand = reseed() + randNum = reseed() randmu.Unlock() } continue diff --git a/vendor/github.com/spf13/afero/mem/file.go b/vendor/github.com/spf13/afero/mem/file.go index 5ef8b6a39..3cf4693b5 100644 --- a/vendor/github.com/spf13/afero/mem/file.go +++ b/vendor/github.com/spf13/afero/mem/file.go @@ -18,15 +18,20 @@ import ( "bytes" "errors" "io" + "io/fs" "os" "path/filepath" "sync" "sync/atomic" "time" + + "github.com/spf13/afero/internal/common" ) const FilePathSeparator = string(filepath.Separator) +var _ fs.ReadDirFile = &File{} + type File struct { // atomic requires 64-bit alignment for struct field access at int64 @@ -183,10 +188,23 @@ func (f *File) Readdirnames(n int) (names []string, err error) { return names, err } +// Implements fs.ReadDirFile +func (f *File) ReadDir(n int) ([]fs.DirEntry, error) { + fi, err := f.Readdir(n) + if err != nil { + return nil, err + } + di := make([]fs.DirEntry, len(fi)) + for i, f := range fi { + di[i] = common.FileInfoDirEntry{FileInfo: f} + } + return di, nil +} + func (f *File) Read(b []byte) (n int, err error) { f.fileData.Lock() defer f.fileData.Unlock() - if f.closed == true { + if f.closed { return 0, ErrFileClosed } if len(b) > 0 && int(f.at) == len(f.fileData.data) { @@ -214,7 +232,7 @@ func (f *File) ReadAt(b []byte, off int64) (n int, err error) { } func (f *File) Truncate(size int64) error { - if f.closed == true { + if f.closed { return ErrFileClosed } if f.readOnly { @@ -236,7 +254,7 @@ func (f *File) Truncate(size int64) error { } func (f *File) Seek(offset int64, whence int) (int64, error) { - if f.closed == true { + if f.closed { return 0, ErrFileClosed } switch whence { @@ -251,7 +269,7 @@ func (f *File) Seek(offset int64, whence int) (int64, error) { } func (f *File) Write(b []byte) (n int, err error) { - if f.closed == true { + if f.closed { return 0, ErrFileClosed } if f.readOnly { @@ -330,8 +348,8 @@ func (s *FileInfo) Size() int64 { var ( ErrFileClosed = errors.New("File is closed") - ErrOutOfRange = errors.New("Out of range") - ErrTooLarge = errors.New("Too large") + ErrOutOfRange = errors.New("out of range") + ErrTooLarge = errors.New("too large") ErrFileNotFound = os.ErrNotExist ErrFileExists = os.ErrExist ErrDestinationExists = os.ErrExist diff --git a/vendor/github.com/spf13/afero/unionFile.go b/vendor/github.com/spf13/afero/unionFile.go index 34f99a40c..333d367f4 100644 --- a/vendor/github.com/spf13/afero/unionFile.go +++ b/vendor/github.com/spf13/afero/unionFile.go @@ -65,7 +65,7 @@ func (f *UnionFile) ReadAt(s []byte, o int64) (int, error) { if f.Layer != nil { n, err := f.Layer.ReadAt(s, o) if (err == nil || err == io.EOF) && f.Base != nil { - _, err = f.Base.Seek(o+int64(n), os.SEEK_SET) + _, err = f.Base.Seek(o+int64(n), io.SeekStart) } return n, err } diff --git a/vendor/github.com/spf13/afero/util.go b/vendor/github.com/spf13/afero/util.go index 4f253f481..cb7de23f2 100644 --- a/vendor/github.com/spf13/afero/util.go +++ b/vendor/github.com/spf13/afero/util.go @@ -25,6 +25,7 @@ import ( "strings" "unicode" + "golang.org/x/text/runes" "golang.org/x/text/transform" "golang.org/x/text/unicode/norm" ) @@ -158,16 +159,12 @@ func UnicodeSanitize(s string) string { // Transform characters with accents into plain forms. func NeuterAccents(s string) string { - t := transform.Chain(norm.NFD, transform.RemoveFunc(isMn), norm.NFC) + t := transform.Chain(norm.NFD, runes.Remove(runes.In(unicode.Mn)), norm.NFC) result, _, _ := transform.String(t, string(s)) return result } -func isMn(r rune) bool { - return unicode.Is(unicode.Mn, r) // Mn: nonspacing marks -} - func (a Afero) FileContainsBytes(filename string, subslice []byte) (bool, error) { return FileContainsBytes(a.Fs, filename, subslice) } @@ -299,6 +296,9 @@ func IsEmpty(fs Fs, path string) (bool, error) { } defer f.Close() list, err := f.Readdir(-1) + if err != nil { + return false, err + } return len(list) == 0, nil } return fi.Size() == 0, nil diff --git a/vendor/github.com/spf13/cast/caste.go b/vendor/github.com/spf13/cast/caste.go index c04af6a97..514d759bf 100644 --- a/vendor/github.com/spf13/cast/caste.go +++ b/vendor/github.com/spf13/cast/caste.go @@ -34,6 +34,12 @@ func ToTimeInDefaultLocationE(i interface{}, location *time.Location) (tim time. return v, nil case string: return StringToDateInDefaultLocation(v, location) + case json.Number: + s, err1 := ToInt64E(v) + if err1 != nil { + return time.Time{}, fmt.Errorf("unable to cast %#v of type %T to Time", i, i) + } + return time.Unix(s, 0), nil case int: return time.Unix(int64(v), 0), nil case int64: @@ -71,6 +77,11 @@ func ToDurationE(i interface{}) (d time.Duration, err error) { d, err = time.ParseDuration(s + "ns") } return + case json.Number: + var v float64 + v, err = s.Float64() + d = time.Duration(v) + return default: err = fmt.Errorf("unable to cast %#v of type %T to Duration", i, i) return @@ -93,6 +104,12 @@ func ToBoolE(i interface{}) (bool, error) { return false, nil case string: return strconv.ParseBool(i.(string)) + case json.Number: + v, err := ToInt64E(b) + if err == nil { + return v != 0, nil + } + return false, fmt.Errorf("unable to cast %#v of type %T to bool", i, i) default: return false, fmt.Errorf("unable to cast %#v of type %T to bool", i, i) } @@ -102,13 +119,16 @@ func ToBoolE(i interface{}) (bool, error) { func ToFloat64E(i interface{}) (float64, error) { i = indirect(i) + intv, ok := toInt(i) + if ok { + return float64(intv), nil + } + switch s := i.(type) { case float64: return s, nil case float32: return float64(s), nil - case int: - return float64(s), nil case int64: return float64(s), nil case int32: @@ -133,11 +153,19 @@ func ToFloat64E(i interface{}) (float64, error) { return v, nil } return 0, fmt.Errorf("unable to cast %#v of type %T to float64", i, i) + case json.Number: + v, err := s.Float64() + if err == nil { + return v, nil + } + return 0, fmt.Errorf("unable to cast %#v of type %T to float64", i, i) case bool: if s { return 1, nil } return 0, nil + case nil: + return 0, nil default: return 0, fmt.Errorf("unable to cast %#v of type %T to float64", i, i) } @@ -147,13 +175,16 @@ func ToFloat64E(i interface{}) (float64, error) { func ToFloat32E(i interface{}) (float32, error) { i = indirect(i) + intv, ok := toInt(i) + if ok { + return float32(intv), nil + } + switch s := i.(type) { case float64: return float32(s), nil case float32: return s, nil - case int: - return float32(s), nil case int64: return float32(s), nil case int32: @@ -178,11 +209,19 @@ func ToFloat32E(i interface{}) (float32, error) { return float32(v), nil } return 0, fmt.Errorf("unable to cast %#v of type %T to float32", i, i) + case json.Number: + v, err := s.Float64() + if err == nil { + return float32(v), nil + } + return 0, fmt.Errorf("unable to cast %#v of type %T to float32", i, i) case bool: if s { return 1, nil } return 0, nil + case nil: + return 0, nil default: return 0, fmt.Errorf("unable to cast %#v of type %T to float32", i, i) } @@ -192,9 +231,12 @@ func ToFloat32E(i interface{}) (float32, error) { func ToInt64E(i interface{}) (int64, error) { i = indirect(i) + intv, ok := toInt(i) + if ok { + return int64(intv), nil + } + switch s := i.(type) { - case int: - return int64(s), nil case int64: return s, nil case int32: @@ -218,11 +260,13 @@ func ToInt64E(i interface{}) (int64, error) { case float32: return int64(s), nil case string: - v, err := strconv.ParseInt(s, 0, 0) + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) if err == nil { return v, nil } return 0, fmt.Errorf("unable to cast %#v of type %T to int64", i, i) + case json.Number: + return ToInt64E(string(s)) case bool: if s { return 1, nil @@ -239,9 +283,12 @@ func ToInt64E(i interface{}) (int64, error) { func ToInt32E(i interface{}) (int32, error) { i = indirect(i) + intv, ok := toInt(i) + if ok { + return int32(intv), nil + } + switch s := i.(type) { - case int: - return int32(s), nil case int64: return int32(s), nil case int32: @@ -265,11 +312,13 @@ func ToInt32E(i interface{}) (int32, error) { case float32: return int32(s), nil case string: - v, err := strconv.ParseInt(s, 0, 0) + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) if err == nil { return int32(v), nil } return 0, fmt.Errorf("unable to cast %#v of type %T to int32", i, i) + case json.Number: + return ToInt32E(string(s)) case bool: if s { return 1, nil @@ -286,9 +335,12 @@ func ToInt32E(i interface{}) (int32, error) { func ToInt16E(i interface{}) (int16, error) { i = indirect(i) + intv, ok := toInt(i) + if ok { + return int16(intv), nil + } + switch s := i.(type) { - case int: - return int16(s), nil case int64: return int16(s), nil case int32: @@ -312,11 +364,13 @@ func ToInt16E(i interface{}) (int16, error) { case float32: return int16(s), nil case string: - v, err := strconv.ParseInt(s, 0, 0) + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) if err == nil { return int16(v), nil } return 0, fmt.Errorf("unable to cast %#v of type %T to int16", i, i) + case json.Number: + return ToInt16E(string(s)) case bool: if s { return 1, nil @@ -333,9 +387,12 @@ func ToInt16E(i interface{}) (int16, error) { func ToInt8E(i interface{}) (int8, error) { i = indirect(i) + intv, ok := toInt(i) + if ok { + return int8(intv), nil + } + switch s := i.(type) { - case int: - return int8(s), nil case int64: return int8(s), nil case int32: @@ -359,11 +416,13 @@ func ToInt8E(i interface{}) (int8, error) { case float32: return int8(s), nil case string: - v, err := strconv.ParseInt(s, 0, 0) + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) if err == nil { return int8(v), nil } return 0, fmt.Errorf("unable to cast %#v of type %T to int8", i, i) + case json.Number: + return ToInt8E(string(s)) case bool: if s { return 1, nil @@ -380,9 +439,12 @@ func ToInt8E(i interface{}) (int8, error) { func ToIntE(i interface{}) (int, error) { i = indirect(i) + intv, ok := toInt(i) + if ok { + return intv, nil + } + switch s := i.(type) { - case int: - return s, nil case int64: return int(s), nil case int32: @@ -406,11 +468,13 @@ func ToIntE(i interface{}) (int, error) { case float32: return int(s), nil case string: - v, err := strconv.ParseInt(s, 0, 0) + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) if err == nil { return int(v), nil } - return 0, fmt.Errorf("unable to cast %#v of type %T to int", i, i) + return 0, fmt.Errorf("unable to cast %#v of type %T to int64", i, i) + case json.Number: + return ToIntE(string(s)) case bool: if s { return 1, nil @@ -427,18 +491,26 @@ func ToIntE(i interface{}) (int, error) { func ToUintE(i interface{}) (uint, error) { i = indirect(i) + intv, ok := toInt(i) + if ok { + if intv < 0 { + return 0, errNegativeNotAllowed + } + return uint(intv), nil + } + switch s := i.(type) { case string: - v, err := strconv.ParseUint(s, 0, 0) + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) if err == nil { + if v < 0 { + return 0, errNegativeNotAllowed + } return uint(v), nil } - return 0, fmt.Errorf("unable to cast %#v to uint: %s", i, err) - case int: - if s < 0 { - return 0, errNegativeNotAllowed - } - return uint(s), nil + return 0, fmt.Errorf("unable to cast %#v of type %T to uint", i, i) + case json.Number: + return ToUintE(string(s)) case int64: if s < 0 { return 0, errNegativeNotAllowed @@ -495,18 +567,26 @@ func ToUintE(i interface{}) (uint, error) { func ToUint64E(i interface{}) (uint64, error) { i = indirect(i) + intv, ok := toInt(i) + if ok { + if intv < 0 { + return 0, errNegativeNotAllowed + } + return uint64(intv), nil + } + switch s := i.(type) { case string: - v, err := strconv.ParseUint(s, 0, 64) + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) if err == nil { - return v, nil - } - return 0, fmt.Errorf("unable to cast %#v to uint64: %s", i, err) - case int: - if s < 0 { - return 0, errNegativeNotAllowed + if v < 0 { + return 0, errNegativeNotAllowed + } + return uint64(v), nil } - return uint64(s), nil + return 0, fmt.Errorf("unable to cast %#v of type %T to uint64", i, i) + case json.Number: + return ToUint64E(string(s)) case int64: if s < 0 { return 0, errNegativeNotAllowed @@ -563,18 +643,26 @@ func ToUint64E(i interface{}) (uint64, error) { func ToUint32E(i interface{}) (uint32, error) { i = indirect(i) + intv, ok := toInt(i) + if ok { + if intv < 0 { + return 0, errNegativeNotAllowed + } + return uint32(intv), nil + } + switch s := i.(type) { case string: - v, err := strconv.ParseUint(s, 0, 32) + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) if err == nil { + if v < 0 { + return 0, errNegativeNotAllowed + } return uint32(v), nil } - return 0, fmt.Errorf("unable to cast %#v to uint32: %s", i, err) - case int: - if s < 0 { - return 0, errNegativeNotAllowed - } - return uint32(s), nil + return 0, fmt.Errorf("unable to cast %#v of type %T to uint32", i, i) + case json.Number: + return ToUint32E(string(s)) case int64: if s < 0 { return 0, errNegativeNotAllowed @@ -631,18 +719,26 @@ func ToUint32E(i interface{}) (uint32, error) { func ToUint16E(i interface{}) (uint16, error) { i = indirect(i) + intv, ok := toInt(i) + if ok { + if intv < 0 { + return 0, errNegativeNotAllowed + } + return uint16(intv), nil + } + switch s := i.(type) { case string: - v, err := strconv.ParseUint(s, 0, 16) + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) if err == nil { + if v < 0 { + return 0, errNegativeNotAllowed + } return uint16(v), nil } - return 0, fmt.Errorf("unable to cast %#v to uint16: %s", i, err) - case int: - if s < 0 { - return 0, errNegativeNotAllowed - } - return uint16(s), nil + return 0, fmt.Errorf("unable to cast %#v of type %T to uint16", i, i) + case json.Number: + return ToUint16E(string(s)) case int64: if s < 0 { return 0, errNegativeNotAllowed @@ -699,18 +795,26 @@ func ToUint16E(i interface{}) (uint16, error) { func ToUint8E(i interface{}) (uint8, error) { i = indirect(i) + intv, ok := toInt(i) + if ok { + if intv < 0 { + return 0, errNegativeNotAllowed + } + return uint8(intv), nil + } + switch s := i.(type) { case string: - v, err := strconv.ParseUint(s, 0, 8) + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) if err == nil { + if v < 0 { + return 0, errNegativeNotAllowed + } return uint8(v), nil } - return 0, fmt.Errorf("unable to cast %#v to uint8: %s", i, err) - case int: - if s < 0 { - return 0, errNegativeNotAllowed - } - return uint8(s), nil + return 0, fmt.Errorf("unable to cast %#v of type %T to uint8", i, i) + case json.Number: + return ToUint8E(string(s)) case int64: if s < 0 { return 0, errNegativeNotAllowed @@ -835,6 +939,8 @@ func ToStringE(i interface{}) (string, error) { return strconv.FormatUint(uint64(s), 10), nil case uint8: return strconv.FormatUint(uint64(s), 10), nil + case json.Number: + return s.String(), nil case []byte: return string(s), nil case template.HTML: @@ -1279,30 +1385,30 @@ func (f timeFormat) hasTimezone() bool { var ( timeFormats = []timeFormat{ - timeFormat{time.RFC3339, timeFormatNumericTimezone}, - timeFormat{"2006-01-02T15:04:05", timeFormatNoTimezone}, // iso8601 without timezone - timeFormat{time.RFC1123Z, timeFormatNumericTimezone}, - timeFormat{time.RFC1123, timeFormatNamedTimezone}, - timeFormat{time.RFC822Z, timeFormatNumericTimezone}, - timeFormat{time.RFC822, timeFormatNamedTimezone}, - timeFormat{time.RFC850, timeFormatNamedTimezone}, - timeFormat{"2006-01-02 15:04:05.999999999 -0700 MST", timeFormatNumericAndNamedTimezone}, // Time.String() - timeFormat{"2006-01-02T15:04:05-0700", timeFormatNumericTimezone}, // RFC3339 without timezone hh:mm colon - timeFormat{"2006-01-02 15:04:05Z0700", timeFormatNumericTimezone}, // RFC3339 without T or timezone hh:mm colon - timeFormat{"2006-01-02 15:04:05", timeFormatNoTimezone}, - timeFormat{time.ANSIC, timeFormatNoTimezone}, - timeFormat{time.UnixDate, timeFormatNamedTimezone}, - timeFormat{time.RubyDate, timeFormatNumericTimezone}, - timeFormat{"2006-01-02 15:04:05Z07:00", timeFormatNumericTimezone}, - timeFormat{"2006-01-02", timeFormatNoTimezone}, - timeFormat{"02 Jan 2006", timeFormatNoTimezone}, - timeFormat{"2006-01-02 15:04:05 -07:00", timeFormatNumericTimezone}, - timeFormat{"2006-01-02 15:04:05 -0700", timeFormatNumericTimezone}, - timeFormat{time.Kitchen, timeFormatTimeOnly}, - timeFormat{time.Stamp, timeFormatTimeOnly}, - timeFormat{time.StampMilli, timeFormatTimeOnly}, - timeFormat{time.StampMicro, timeFormatTimeOnly}, - timeFormat{time.StampNano, timeFormatTimeOnly}, + {time.RFC3339, timeFormatNumericTimezone}, + {"2006-01-02T15:04:05", timeFormatNoTimezone}, // iso8601 without timezone + {time.RFC1123Z, timeFormatNumericTimezone}, + {time.RFC1123, timeFormatNamedTimezone}, + {time.RFC822Z, timeFormatNumericTimezone}, + {time.RFC822, timeFormatNamedTimezone}, + {time.RFC850, timeFormatNamedTimezone}, + {"2006-01-02 15:04:05.999999999 -0700 MST", timeFormatNumericAndNamedTimezone}, // Time.String() + {"2006-01-02T15:04:05-0700", timeFormatNumericTimezone}, // RFC3339 without timezone hh:mm colon + {"2006-01-02 15:04:05Z0700", timeFormatNumericTimezone}, // RFC3339 without T or timezone hh:mm colon + {"2006-01-02 15:04:05", timeFormatNoTimezone}, + {time.ANSIC, timeFormatNoTimezone}, + {time.UnixDate, timeFormatNamedTimezone}, + {time.RubyDate, timeFormatNumericTimezone}, + {"2006-01-02 15:04:05Z07:00", timeFormatNumericTimezone}, + {"2006-01-02", timeFormatNoTimezone}, + {"02 Jan 2006", timeFormatNoTimezone}, + {"2006-01-02 15:04:05 -07:00", timeFormatNumericTimezone}, + {"2006-01-02 15:04:05 -0700", timeFormatNumericTimezone}, + {time.Kitchen, timeFormatTimeOnly}, + {time.Stamp, timeFormatTimeOnly}, + {time.StampMilli, timeFormatTimeOnly}, + {time.StampMicro, timeFormatTimeOnly}, + {time.StampNano, timeFormatTimeOnly}, } ) @@ -1335,3 +1441,36 @@ func jsonStringToObject(s string, v interface{}) error { data := []byte(s) return json.Unmarshal(data, v) } + +// toInt returns the int value of v if v or v's underlying type +// is an int. +// Note that this will return false for int64 etc. types. +func toInt(v interface{}) (int, bool) { + switch v := v.(type) { + case int: + return v, true + case time.Weekday: + return int(v), true + case time.Month: + return int(v), true + default: + return 0, false + } +} + +func trimZeroDecimal(s string) string { + var foundZero bool + for i := len(s); i > 0; i-- { + switch s[i-1] { + case '.': + if foundZero { + return s[:i-1] + } + case '0': + foundZero = true + default: + return s + } + } + return s +} diff --git a/vendor/github.com/spf13/cobra/CHANGELOG.md b/vendor/github.com/spf13/cobra/CHANGELOG.md deleted file mode 100644 index 8a23b4f85..000000000 --- a/vendor/github.com/spf13/cobra/CHANGELOG.md +++ /dev/null @@ -1,51 +0,0 @@ -# Cobra Changelog - -## v1.1.3 - -* **Fix:** release-branch.cobra1.1 only: Revert "Deprecate Go < 1.14" to maintain backward compatibility - -## v1.1.2 - -### Notable Changes - -* Bump license year to 2021 in golden files (#1309) @Bowbaq -* Enhance PowerShell completion with custom comp (#1208) @Luap99 -* Update gopkg.in/yaml.v2 to v2.4.0: The previous breaking change in yaml.v2 v2.3.0 has been reverted, see go-yaml/yaml#670 -* Documentation readability improvements (#1228 etc.) @zaataylor etc. -* Use golangci-lint: Repair warnings and errors resulting from linting (#1044) @umarcor - -## v1.1.1 - -* **Fix:** yaml.v2 2.3.0 contained a unintended breaking change. This release reverts to yaml.v2 v2.2.8 which has recent critical CVE fixes, but does not have the breaking changes. See https://github.com/spf13/cobra/pull/1259 for context. -* **Fix:** correct internal formatting for go-md2man v2 (which caused man page generation to be broken). See https://github.com/spf13/cobra/issues/1049 for context. - -## v1.1.0 - -### Notable Changes - -* Extend Go completions and revamp zsh comp (#1070) -* Fix man page doc generation - no auto generated tag when `cmd.DisableAutoGenTag = true` (#1104) @jpmcb -* Add completion for help command (#1136) -* Complete subcommands when TraverseChildren is set (#1171) -* Fix stderr printing functions (#894) -* fix: fish output redirection (#1247) - -## v1.0.0 - -Announcing v1.0.0 of Cobra. 🎉 - -### Notable Changes -* Fish completion (including support for Go custom completion) @marckhouzam -* API (urgent): Rename BashCompDirectives to ShellCompDirectives @marckhouzam -* Remove/replace SetOutput on Command - deprecated @jpmcb -* add support for autolabel stale PR @xchapter7x -* Add Labeler Actions @xchapter7x -* Custom completions coded in Go (instead of Bash) @marckhouzam -* Partial Revert of #922 @jharshman -* Add Makefile to project @jharshman -* Correct documentation for InOrStdin @desponda -* Apply formatting to templates @jharshman -* Revert change so help is printed on stdout again @marckhouzam -* Update md2man to v2.0.0 @pdf -* update viper to v1.4.0 @umarcor -* Update cmd/root.go example in README.md @jharshman diff --git a/vendor/github.com/spf13/cobra/README.md b/vendor/github.com/spf13/cobra/README.md index 7adef143b..2bf152082 100644 --- a/vendor/github.com/spf13/cobra/README.md +++ b/vendor/github.com/spf13/cobra/README.md @@ -2,7 +2,7 @@ Cobra is a library for creating powerful modern CLI applications. -Cobra is used in many Go projects such as [Kubernetes](http://kubernetes.io/), +Cobra is used in many Go projects such as [Kubernetes](https://kubernetes.io/), [Hugo](https://gohugo.io), and [Github CLI](https://github.com/cli/cli) to name a few. [This list](./projects_using_cobra.md) contains a more extensive list of projects using Cobra. @@ -28,7 +28,7 @@ Cobra provides: * Automatically generated man pages for your application * Command aliases so you can change things without breaking them * The flexibility to define your own help, usage, etc. -* Optional seamless integration with [viper](http://github.com/spf13/viper) for 12-factor apps +* Optional seamless integration with [viper](https://github.com/spf13/viper) for 12-factor apps # Concepts @@ -102,7 +102,7 @@ It can be installed by running: go install github.com/spf13/cobra-cli@latest ``` -For complete details on using the Cobra-CLI generator, please read [The Cobra Generator README](https://github.com/spf13/cobra-cli/blob/master/README.md) +For complete details on using the Cobra-CLI generator, please read [The Cobra Generator README](https://github.com/spf13/cobra-cli/blob/main/README.md) For complete details on using the Cobra library, please read the [The Cobra User Guide](user_guide.md). diff --git a/vendor/github.com/spf13/cobra/active_help.go b/vendor/github.com/spf13/cobra/active_help.go new file mode 100644 index 000000000..0c631913d --- /dev/null +++ b/vendor/github.com/spf13/cobra/active_help.go @@ -0,0 +1,49 @@ +package cobra + +import ( + "fmt" + "os" + "strings" +) + +const ( + activeHelpMarker = "_activeHelp_ " + // The below values should not be changed: programs will be using them explicitly + // in their user documentation, and users will be using them explicitly. + activeHelpEnvVarSuffix = "_ACTIVE_HELP" + activeHelpGlobalEnvVar = "COBRA_ACTIVE_HELP" + activeHelpGlobalDisable = "0" +) + +// AppendActiveHelp adds the specified string to the specified array to be used as ActiveHelp. +// Such strings will be processed by the completion script and will be shown as ActiveHelp +// to the user. +// The array parameter should be the array that will contain the completions. +// This function can be called multiple times before and/or after completions are added to +// the array. Each time this function is called with the same array, the new +// ActiveHelp line will be shown below the previous ones when completion is triggered. +func AppendActiveHelp(compArray []string, activeHelpStr string) []string { + return append(compArray, fmt.Sprintf("%s%s", activeHelpMarker, activeHelpStr)) +} + +// GetActiveHelpConfig returns the value of the ActiveHelp environment variable +// <PROGRAM>_ACTIVE_HELP where <PROGRAM> is the name of the root command in upper +// case, with all - replaced by _. +// It will always return "0" if the global environment variable COBRA_ACTIVE_HELP +// is set to "0". +func GetActiveHelpConfig(cmd *Command) string { + activeHelpCfg := os.Getenv(activeHelpGlobalEnvVar) + if activeHelpCfg != activeHelpGlobalDisable { + activeHelpCfg = os.Getenv(activeHelpEnvVar(cmd.Root().Name())) + } + return activeHelpCfg +} + +// activeHelpEnvVar returns the name of the program-specific ActiveHelp environment +// variable. It has the format <PROGRAM>_ACTIVE_HELP where <PROGRAM> is the name of the +// root command in upper case, with all - replaced by _. +func activeHelpEnvVar(name string) string { + // This format should not be changed: users will be using it explicitly. + activeHelpEnvVar := strings.ToUpper(fmt.Sprintf("%s%s", name, activeHelpEnvVarSuffix)) + return strings.ReplaceAll(activeHelpEnvVar, "-", "_") +} diff --git a/vendor/github.com/spf13/cobra/active_help.md b/vendor/github.com/spf13/cobra/active_help.md new file mode 100644 index 000000000..5e7f59af3 --- /dev/null +++ b/vendor/github.com/spf13/cobra/active_help.md @@ -0,0 +1,157 @@ +# Active Help + +Active Help is a framework provided by Cobra which allows a program to define messages (hints, warnings, etc) that will be printed during program usage. It aims to make it easier for your users to learn how to use your program. If configured by the program, Active Help is printed when the user triggers shell completion. + +For example, +``` +bash-5.1$ helm repo add [tab] +You must choose a name for the repo you are adding. + +bash-5.1$ bin/helm package [tab] +Please specify the path to the chart to package + +bash-5.1$ bin/helm package [tab][tab] +bin/ internal/ scripts/ pkg/ testdata/ +``` + +**Hint**: A good place to use Active Help messages is when the normal completion system does not provide any suggestions. In such cases, Active Help nicely supplements the normal shell completions to guide the user in knowing what is expected by the program. +## Supported shells + +Active Help is currently only supported for the following shells: +- Bash (using [bash completion V2](shell_completions.md#bash-completion-v2) only). Note that bash 4.4 or higher is required for the prompt to appear when an Active Help message is printed. +- Zsh + +## Adding Active Help messages + +As Active Help uses the shell completion system, the implementation of Active Help messages is done by enhancing custom dynamic completions. If you are not familiar with dynamic completions, please refer to [Shell Completions](shell_completions.md). + +Adding Active Help is done through the use of the `cobra.AppendActiveHelp(...)` function, where the program repeatedly adds Active Help messages to the list of completions. Keep reading for details. + +### Active Help for nouns + +Adding Active Help when completing a noun is done within the `ValidArgsFunction(...)` of a command. Please notice the use of `cobra.AppendActiveHelp(...)` in the following example: + +```go +cmd := &cobra.Command{ + Use: "add [NAME] [URL]", + Short: "add a chart repository", + Args: require.ExactArgs(2), + RunE: func(cmd *cobra.Command, args []string) error { + return addRepo(args) + }, + ValidArgsFunction: func(cmd *cobra.Command, args []string, toComplete string) ([]string, cobra.ShellCompDirective) { + var comps []string + if len(args) == 0 { + comps = cobra.AppendActiveHelp(comps, "You must choose a name for the repo you are adding") + } else if len(args) == 1 { + comps = cobra.AppendActiveHelp(comps, "You must specify the URL for the repo you are adding") + } else { + comps = cobra.AppendActiveHelp(comps, "This command does not take any more arguments") + } + return comps, cobra.ShellCompDirectiveNoFileComp + }, +} +``` +The example above defines the completions (none, in this specific example) as well as the Active Help messages for the `helm repo add` command. It yields the following behavior: +``` +bash-5.1$ helm repo add [tab] +You must choose a name for the repo you are adding + +bash-5.1$ helm repo add grafana [tab] +You must specify the URL for the repo you are adding + +bash-5.1$ helm repo add grafana https://grafana.github.io/helm-charts [tab] +This command does not take any more arguments +``` +**Hint**: As can be seen in the above example, a good place to use Active Help messages is when the normal completion system does not provide any suggestions. In such cases, Active Help nicely supplements the normal shell completions. + +### Active Help for flags + +Providing Active Help for flags is done in the same fashion as for nouns, but using the completion function registered for the flag. For example: +```go +_ = cmd.RegisterFlagCompletionFunc("version", func(cmd *cobra.Command, args []string, toComplete string) ([]string, cobra.ShellCompDirective) { + if len(args) != 2 { + return cobra.AppendActiveHelp(nil, "You must first specify the chart to install before the --version flag can be completed"), cobra.ShellCompDirectiveNoFileComp + } + return compVersionFlag(args[1], toComplete) + }) +``` +The example above prints an Active Help message when not enough information was given by the user to complete the `--version` flag. +``` +bash-5.1$ bin/helm install myrelease --version 2.0.[tab] +You must first specify the chart to install before the --version flag can be completed + +bash-5.1$ bin/helm install myrelease bitnami/solr --version 2.0.[tab][tab] +2.0.1 2.0.2 2.0.3 +``` + +## User control of Active Help + +You may want to allow your users to disable Active Help or choose between different levels of Active Help. It is entirely up to the program to define the type of configurability of Active Help that it wants to offer, if any. +Allowing to configure Active Help is entirely optional; you can use Active Help in your program without doing anything about Active Help configuration. + +The way to configure Active Help is to use the program's Active Help environment +variable. That variable is named `<PROGRAM>_ACTIVE_HELP` where `<PROGRAM>` is the name of your +program in uppercase with any `-` replaced by an `_`. The variable should be set by the user to whatever +Active Help configuration values are supported by the program. + +For example, say `helm` has chosen to support three levels for Active Help: `on`, `off`, `local`. Then a user +would set the desired behavior to `local` by doing `export HELM_ACTIVE_HELP=local` in their shell. + +For simplicity, when in `cmd.ValidArgsFunction(...)` or a flag's completion function, the program should read the +Active Help configuration using the `cobra.GetActiveHelpConfig(cmd)` function and select what Active Help messages +should or should not be added (instead of reading the environment variable directly). + +For example: +```go +ValidArgsFunction: func(cmd *cobra.Command, args []string, toComplete string) ([]string, cobra.ShellCompDirective) { + activeHelpLevel := cobra.GetActiveHelpConfig(cmd) + + var comps []string + if len(args) == 0 { + if activeHelpLevel != "off" { + comps = cobra.AppendActiveHelp(comps, "You must choose a name for the repo you are adding") + } + } else if len(args) == 1 { + if activeHelpLevel != "off" { + comps = cobra.AppendActiveHelp(comps, "You must specify the URL for the repo you are adding") + } + } else { + if activeHelpLevel == "local" { + comps = cobra.AppendActiveHelp(comps, "This command does not take any more arguments") + } + } + return comps, cobra.ShellCompDirectiveNoFileComp +}, +``` +**Note 1**: If the `<PROGRAM>_ACTIVE_HELP` environment variable is set to the string "0", Cobra will automatically disable all Active Help output (even if some output was specified by the program using the `cobra.AppendActiveHelp(...)` function). Using "0" can simplify your code in situations where you want to blindly disable Active Help without having to call `cobra.GetActiveHelpConfig(cmd)` explicitly. + +**Note 2**: If a user wants to disable Active Help for every single program based on Cobra, she can set the environment variable `COBRA_ACTIVE_HELP` to "0". In this case `cobra.GetActiveHelpConfig(cmd)` will return "0" no matter what the variable `<PROGRAM>_ACTIVE_HELP` is set to. + +**Note 3**: If the user does not set `<PROGRAM>_ACTIVE_HELP` or `COBRA_ACTIVE_HELP` (which will be a common case), the default value for the Active Help configuration returned by `cobra.GetActiveHelpConfig(cmd)` will be the empty string. +## Active Help with Cobra's default completion command + +Cobra provides a default `completion` command for programs that wish to use it. +When using the default `completion` command, Active Help is configurable in the same +fashion as described above using environment variables. You may wish to document this in more +details for your users. + +## Debugging Active Help + +Debugging your Active Help code is done in the same way as debugging your dynamic completion code, which is with Cobra's hidden `__complete` command. Please refer to [debugging shell completion](shell_completions.md#debugging) for details. + +When debugging with the `__complete` command, if you want to specify different Active Help configurations, you should use the active help environment variable. That variable is named `<PROGRAM>_ACTIVE_HELP` where any `-` is replaced by an `_`. For example, we can test deactivating some Active Help as shown below: +``` +$ HELM_ACTIVE_HELP=1 bin/helm __complete install wordpress bitnami/h<ENTER> +bitnami/haproxy +bitnami/harbor +_activeHelp_ WARNING: cannot re-use a name that is still in use +:0 +Completion ended with directive: ShellCompDirectiveDefault + +$ HELM_ACTIVE_HELP=0 bin/helm __complete install wordpress bitnami/h<ENTER> +bitnami/haproxy +bitnami/harbor +:0 +Completion ended with directive: ShellCompDirectiveDefault +``` diff --git a/vendor/github.com/spf13/cobra/bash_completions.go b/vendor/github.com/spf13/cobra/bash_completions.go index 6c360c595..cb7e19537 100644 --- a/vendor/github.com/spf13/cobra/bash_completions.go +++ b/vendor/github.com/spf13/cobra/bash_completions.go @@ -73,7 +73,8 @@ __%[1]s_handle_go_custom_completion() # Prepare the command to request completions for the program. # Calling ${words[0]} instead of directly %[1]s allows to handle aliases args=("${words[@]:1}") - requestComp="${words[0]} %[2]s ${args[*]}" + # Disable ActiveHelp which is not supported for bash completion v1 + requestComp="%[8]s=0 ${words[0]} %[2]s ${args[*]}" lastParam=${words[$((${#words[@]}-1))]} lastChar=${lastParam:$((${#lastParam}-1)):1} @@ -99,7 +100,7 @@ __%[1]s_handle_go_custom_completion() directive=0 fi __%[1]s_debug "${FUNCNAME[0]}: the completion directive is: ${directive}" - __%[1]s_debug "${FUNCNAME[0]}: the completions are: ${out[*]}" + __%[1]s_debug "${FUNCNAME[0]}: the completions are: ${out}" if [ $((directive & shellCompDirectiveError)) -ne 0 ]; then # Error code. No completion. @@ -125,7 +126,7 @@ __%[1]s_handle_go_custom_completion() local fullFilter filter filteringCmd # Do not use quotes around the $out variable or else newline # characters will be kept. - for filter in ${out[*]}; do + for filter in ${out}; do fullFilter+="$filter|" done @@ -136,7 +137,7 @@ __%[1]s_handle_go_custom_completion() # File completion for directories only local subdir # Use printf to strip any trailing newline - subdir=$(printf "%%s" "${out[0]}") + subdir=$(printf "%%s" "${out}") if [ -n "$subdir" ]; then __%[1]s_debug "Listing directories in $subdir" __%[1]s_handle_subdirs_in_dir_flag "$subdir" @@ -147,7 +148,7 @@ __%[1]s_handle_go_custom_completion() else while IFS='' read -r comp; do COMPREPLY+=("$comp") - done < <(compgen -W "${out[*]}" -- "$cur") + done < <(compgen -W "${out}" -- "$cur") fi } @@ -383,11 +384,11 @@ __%[1]s_handle_word() `, name, ShellCompNoDescRequestCmd, ShellCompDirectiveError, ShellCompDirectiveNoSpace, ShellCompDirectiveNoFileComp, - ShellCompDirectiveFilterFileExt, ShellCompDirectiveFilterDirs)) + ShellCompDirectiveFilterFileExt, ShellCompDirectiveFilterDirs, activeHelpEnvVar(name))) } func writePostscript(buf io.StringWriter, name string) { - name = strings.Replace(name, ":", "__", -1) + name = strings.ReplaceAll(name, ":", "__") WriteStringAndCheck(buf, fmt.Sprintf("__start_%s()\n", name)) WriteStringAndCheck(buf, fmt.Sprintf(`{ local cur prev words cword split @@ -645,8 +646,8 @@ func gen(buf io.StringWriter, cmd *Command) { gen(buf, c) } commandName := cmd.CommandPath() - commandName = strings.Replace(commandName, " ", "_", -1) - commandName = strings.Replace(commandName, ":", "__", -1) + commandName = strings.ReplaceAll(commandName, " ", "_") + commandName = strings.ReplaceAll(commandName, ":", "__") if cmd.Root() == cmd { WriteStringAndCheck(buf, fmt.Sprintf("_%s_root_command()\n{\n", commandName)) diff --git a/vendor/github.com/spf13/cobra/bash_completionsV2.go b/vendor/github.com/spf13/cobra/bash_completionsV2.go index 82d26c175..767bf0312 100644 --- a/vendor/github.com/spf13/cobra/bash_completionsV2.go +++ b/vendor/github.com/spf13/cobra/bash_completionsV2.go @@ -78,7 +78,7 @@ __%[1]s_get_completion_results() { directive=0 fi __%[1]s_debug "The completion directive is: ${directive}" - __%[1]s_debug "The completions are: ${out[*]}" + __%[1]s_debug "The completions are: ${out}" } __%[1]s_process_completion_results() { @@ -111,13 +111,18 @@ __%[1]s_process_completion_results() { fi fi + # Separate activeHelp from normal completions + local completions=() + local activeHelp=() + __%[1]s_extract_activeHelp + if [ $((directive & shellCompDirectiveFilterFileExt)) -ne 0 ]; then # File extension filtering local fullFilter filter filteringCmd - # Do not use quotes around the $out variable or else newline + # Do not use quotes around the $completions variable or else newline # characters will be kept. - for filter in ${out[*]}; do + for filter in ${completions[*]}; do fullFilter+="$filter|" done @@ -129,7 +134,7 @@ __%[1]s_process_completion_results() { # Use printf to strip any trailing newline local subdir - subdir=$(printf "%%s" "${out[0]}") + subdir=$(printf "%%s" "${completions[0]}") if [ -n "$subdir" ]; then __%[1]s_debug "Listing directories in $subdir" pushd "$subdir" >/dev/null 2>&1 && _filedir -d && popd >/dev/null 2>&1 || return @@ -143,6 +148,43 @@ __%[1]s_process_completion_results() { __%[1]s_handle_special_char "$cur" : __%[1]s_handle_special_char "$cur" = + + # Print the activeHelp statements before we finish + if [ ${#activeHelp} -ne 0 ]; then + printf "\n"; + printf "%%s\n" "${activeHelp[@]}" + printf "\n" + + # The prompt format is only available from bash 4.4. + # We test if it is available before using it. + if (x=${PS1@P}) 2> /dev/null; then + printf "%%s" "${PS1@P}${COMP_LINE[@]}" + else + # Can't print the prompt. Just print the + # text the user had typed, it is workable enough. + printf "%%s" "${COMP_LINE[@]}" + fi + fi +} + +# Separate activeHelp lines from real completions. +# Fills the $activeHelp and $completions arrays. +__%[1]s_extract_activeHelp() { + local activeHelpMarker="%[8]s" + local endIndex=${#activeHelpMarker} + + while IFS='' read -r comp; do + if [ "${comp:0:endIndex}" = "$activeHelpMarker" ]; then + comp=${comp:endIndex} + __%[1]s_debug "ActiveHelp found: $comp" + if [ -n "$comp" ]; then + activeHelp+=("$comp") + fi + else + # Not an activeHelp line but a normal completion + completions+=("$comp") + fi + done < <(printf "%%s\n" "${out}") } __%[1]s_handle_completion_types() { @@ -154,17 +196,16 @@ __%[1]s_handle_completion_types() { # If the user requested inserting one completion at a time, or all # completions at once on the command-line we must remove the descriptions. # https://github.com/spf13/cobra/issues/1508 - local tab comp - tab=$(printf '\t') + local tab=$'\t' comp while IFS='' read -r comp; do + [[ -z $comp ]] && continue # Strip any description comp=${comp%%%%$tab*} # Only consider the completions that match - comp=$(compgen -W "$comp" -- "$cur") - if [ -n "$comp" ]; then + if [[ $comp == "$cur"* ]]; then COMPREPLY+=("$comp") fi - done < <(printf "%%s\n" "${out[@]}") + done < <(printf "%%s\n" "${completions[@]}") ;; *) @@ -175,44 +216,37 @@ __%[1]s_handle_completion_types() { } __%[1]s_handle_standard_completion_case() { - local tab comp - tab=$(printf '\t') + local tab=$'\t' comp + + # Short circuit to optimize if we don't have descriptions + if [[ "${completions[*]}" != *$tab* ]]; then + IFS=$'\n' read -ra COMPREPLY -d '' < <(compgen -W "${completions[*]}" -- "$cur") + return 0 + fi local longest=0 + local compline # Look for the longest completion so that we can format things nicely - while IFS='' read -r comp; do + while IFS='' read -r compline; do + [[ -z $compline ]] && continue # Strip any description before checking the length - comp=${comp%%%%$tab*} + comp=${compline%%%%$tab*} # Only consider the completions that match - comp=$(compgen -W "$comp" -- "$cur") + [[ $comp == "$cur"* ]] || continue + COMPREPLY+=("$compline") if ((${#comp}>longest)); then longest=${#comp} fi - done < <(printf "%%s\n" "${out[@]}") - - local completions=() - while IFS='' read -r comp; do - if [ -z "$comp" ]; then - continue - fi - - __%[1]s_debug "Original comp: $comp" - comp="$(__%[1]s_format_comp_descriptions "$comp" "$longest")" - __%[1]s_debug "Final comp: $comp" - completions+=("$comp") - done < <(printf "%%s\n" "${out[@]}") - - while IFS='' read -r comp; do - COMPREPLY+=("$comp") - done < <(compgen -W "${completions[*]}" -- "$cur") + done < <(printf "%%s\n" "${completions[@]}") # If there is a single completion left, remove the description text if [ ${#COMPREPLY[*]} -eq 1 ]; then __%[1]s_debug "COMPREPLY[0]: ${COMPREPLY[0]}" - comp="${COMPREPLY[0]%%%% *}" + comp="${COMPREPLY[0]%%%%$tab*}" __%[1]s_debug "Removed description from single completion, which is now: ${comp}" - COMPREPLY=() - COMPREPLY+=("$comp") + COMPREPLY[0]=$comp + else # Format the descriptions + __%[1]s_format_comp_descriptions $longest fi } @@ -231,45 +265,48 @@ __%[1]s_handle_special_char() __%[1]s_format_comp_descriptions() { - local tab - tab=$(printf '\t') - local comp="$1" - local longest=$2 - - # Properly format the description string which follows a tab character if there is one - if [[ "$comp" == *$tab* ]]; then - desc=${comp#*$tab} - comp=${comp%%%%$tab*} - - # $COLUMNS stores the current shell width. - # Remove an extra 4 because we add 2 spaces and 2 parentheses. - maxdesclength=$(( COLUMNS - longest - 4 )) - - # Make sure we can fit a description of at least 8 characters - # if we are to align the descriptions. - if [[ $maxdesclength -gt 8 ]]; then - # Add the proper number of spaces to align the descriptions - for ((i = ${#comp} ; i < longest ; i++)); do - comp+=" " - done - else - # Don't pad the descriptions so we can fit more text after the completion - maxdesclength=$(( COLUMNS - ${#comp} - 4 )) - fi + local tab=$'\t' + local comp desc maxdesclength + local longest=$1 + + local i ci + for ci in ${!COMPREPLY[*]}; do + comp=${COMPREPLY[ci]} + # Properly format the description string which follows a tab character if there is one + if [[ "$comp" == *$tab* ]]; then + __%[1]s_debug "Original comp: $comp" + desc=${comp#*$tab} + comp=${comp%%%%$tab*} + + # $COLUMNS stores the current shell width. + # Remove an extra 4 because we add 2 spaces and 2 parentheses. + maxdesclength=$(( COLUMNS - longest - 4 )) + + # Make sure we can fit a description of at least 8 characters + # if we are to align the descriptions. + if [[ $maxdesclength -gt 8 ]]; then + # Add the proper number of spaces to align the descriptions + for ((i = ${#comp} ; i < longest ; i++)); do + comp+=" " + done + else + # Don't pad the descriptions so we can fit more text after the completion + maxdesclength=$(( COLUMNS - ${#comp} - 4 )) + fi - # If there is enough space for any description text, - # truncate the descriptions that are too long for the shell width - if [ $maxdesclength -gt 0 ]; then - if [ ${#desc} -gt $maxdesclength ]; then - desc=${desc:0:$(( maxdesclength - 1 ))} - desc+="…" + # If there is enough space for any description text, + # truncate the descriptions that are too long for the shell width + if [ $maxdesclength -gt 0 ]; then + if [ ${#desc} -gt $maxdesclength ]; then + desc=${desc:0:$(( maxdesclength - 1 ))} + desc+="…" + fi + comp+=" ($desc)" fi - comp+=" ($desc)" + COMPREPLY[ci]=$comp + __%[1]s_debug "Final comp: $comp" fi - fi - - # Must use printf to escape all special characters - printf "%%q" "${comp}" + done } __start_%[1]s() @@ -310,7 +347,8 @@ fi # ex: ts=4 sw=4 et filetype=sh `, name, compCmd, ShellCompDirectiveError, ShellCompDirectiveNoSpace, ShellCompDirectiveNoFileComp, - ShellCompDirectiveFilterFileExt, ShellCompDirectiveFilterDirs)) + ShellCompDirectiveFilterFileExt, ShellCompDirectiveFilterDirs, + activeHelpMarker)) } // GenBashCompletionFileV2 generates Bash completion version 2. diff --git a/vendor/github.com/spf13/cobra/command.go b/vendor/github.com/spf13/cobra/command.go index 2cc18891d..675bb1340 100644 --- a/vendor/github.com/spf13/cobra/command.go +++ b/vendor/github.com/spf13/cobra/command.go @@ -18,6 +18,7 @@ package cobra import ( "bytes" "context" + "errors" "fmt" "io" "os" @@ -166,7 +167,7 @@ type Command struct { // errWriter is a writer defined by the user that replaces stderr errWriter io.Writer - //FParseErrWhitelist flag parse errors to be ignored + // FParseErrWhitelist flag parse errors to be ignored FParseErrWhitelist FParseErrWhitelist // CompletionOptions is a set of options to control the handling of shell completion @@ -224,12 +225,23 @@ type Command struct { SuggestionsMinimumDistance int } -// Context returns underlying command context. If command wasn't -// executed with ExecuteContext Context returns Background context. +// Context returns underlying command context. If command was executed +// with ExecuteContext or the context was set with SetContext, the +// previously set context will be returned. Otherwise, nil is returned. +// +// Notice that a call to Execute and ExecuteC will replace a nil context of +// a command with a context.Background, so a background context will be +// returned by Context after one of these functions has been called. func (c *Command) Context() context.Context { return c.ctx } +// SetContext sets context for the command. It is set to context.Background by default and will be overwritten by +// Command.ExecuteContext or Command.ExecuteContextC +func (c *Command) SetContext(ctx context.Context) { + c.ctx = ctx +} + // SetArgs sets arguments for the command. It is set to os.Args[1:] by default, if desired, can be overridden // particularly useful when testing. func (c *Command) SetArgs(a []string) { @@ -852,6 +864,10 @@ func (c *Command) execute(a []string) (err error) { if err := c.validateRequiredFlags(); err != nil { return err } + if err := c.validateFlagGroups(); err != nil { + return err + } + if c.RunE != nil { if err := c.RunE(c, argWoFlags); err != nil { return err @@ -975,7 +991,7 @@ func (c *Command) ExecuteC() (cmd *Command, err error) { if err != nil { // Always show help if requested, even if SilenceErrors is in // effect - if err == flag.ErrHelp { + if errors.Is(err, flag.ErrHelp) { cmd.HelpFunc()(cmd, args) return cmd, nil } @@ -997,7 +1013,7 @@ func (c *Command) ExecuteC() (cmd *Command, err error) { func (c *Command) ValidateArgs(args []string) error { if c.Args == nil { - return nil + return ArbitraryArgs(c, args) } return c.Args(c, args) } diff --git a/vendor/github.com/spf13/cobra/completions.go b/vendor/github.com/spf13/cobra/completions.go index 9ecd56a47..2c2483998 100644 --- a/vendor/github.com/spf13/cobra/completions.go +++ b/vendor/github.com/spf13/cobra/completions.go @@ -103,6 +103,14 @@ func NoFileCompletions(cmd *Command, args []string, toComplete string) ([]string return nil, ShellCompDirectiveNoFileComp } +// FixedCompletions can be used to create a completion function which always +// returns the same results. +func FixedCompletions(choices []string, directive ShellCompDirective) func(cmd *Command, args []string, toComplete string) ([]string, ShellCompDirective) { + return func(cmd *Command, args []string, toComplete string) ([]string, ShellCompDirective) { + return choices, directive + } +} + // RegisterFlagCompletionFunc should be called to register a function to provide completion for a flag. func (c *Command) RegisterFlagCompletionFunc(flagName string, f func(cmd *Command, args []string, toComplete string) ([]string, ShellCompDirective)) error { flag := c.Flag(flagName) @@ -170,6 +178,12 @@ func (c *Command) initCompleteCmd(args []string) { noDescriptions := (cmd.CalledAs() == ShellCompNoDescRequestCmd) for _, comp := range completions { + if GetActiveHelpConfig(finalCmd) == activeHelpGlobalDisable { + // Remove all activeHelp entries in this case + if strings.HasPrefix(comp, activeHelpMarker) { + continue + } + } if noDescriptions { // Remove any description that may be included following a tab character. comp = strings.Split(comp, "\t")[0] @@ -311,8 +325,11 @@ func (c *Command) getCompletions(args []string) (*Command, []string, ShellCompDi var completions []string var directive ShellCompDirective + // Enforce flag groups before doing flag completions + finalCmd.enforceFlagGroupsForCompletion() + // Note that we want to perform flagname completion even if finalCmd.DisableFlagParsing==true; - // doing this allows for completion of persistant flag names even for commands that disable flag parsing. + // doing this allows for completion of persistent flag names even for commands that disable flag parsing. // // When doing completion of a flag name, as soon as an argument starts with // a '-' we know it is a flag. We cannot use isFlagArg() here as it requires @@ -644,7 +661,7 @@ To load completions for every new session, execute once: #### macOS: - %[1]s completion bash > /usr/local/etc/bash_completion.d/%[1]s + %[1]s completion bash > $(brew --prefix)/etc/bash_completion.d/%[1]s You will need to start a new shell for this setup to take effect. `, c.Root().Name()), @@ -669,6 +686,10 @@ to enable it. You can execute the following once: echo "autoload -U compinit; compinit" >> ~/.zshrc +To load completions in your current shell session: + + source <(%[1]s completion zsh); compdef _%[1]s %[1]s + To load completions for every new session, execute once: #### Linux: @@ -677,7 +698,7 @@ To load completions for every new session, execute once: #### macOS: - %[1]s completion zsh > /usr/local/share/zsh/site-functions/_%[1]s + %[1]s completion zsh > $(brew --prefix)/share/zsh/site-functions/_%[1]s You will need to start a new shell for this setup to take effect. `, c.Root().Name()), diff --git a/vendor/github.com/spf13/cobra/fish_completions.go b/vendor/github.com/spf13/cobra/fish_completions.go index bb57fd568..005ee6be7 100644 --- a/vendor/github.com/spf13/cobra/fish_completions.go +++ b/vendor/github.com/spf13/cobra/fish_completions.go @@ -11,8 +11,8 @@ import ( func genFishComp(buf io.StringWriter, name string, includeDesc bool) { // Variables should not contain a '-' or ':' character nameForVar := name - nameForVar = strings.Replace(nameForVar, "-", "_", -1) - nameForVar = strings.Replace(nameForVar, ":", "_", -1) + nameForVar = strings.ReplaceAll(nameForVar, "-", "_") + nameForVar = strings.ReplaceAll(nameForVar, ":", "_") compCmd := ShellCompRequestCmd if !includeDesc { @@ -38,7 +38,8 @@ function __%[1]s_perform_completion __%[1]s_debug "args: $args" __%[1]s_debug "last arg: $lastArg" - set -l requestComp "$args[1] %[3]s $args[2..-1] $lastArg" + # Disable ActiveHelp which is not supported for fish shell + set -l requestComp "%[9]s=0 $args[1] %[3]s $args[2..-1] $lastArg" __%[1]s_debug "Calling $requestComp" set -l results (eval $requestComp 2> /dev/null) @@ -196,7 +197,7 @@ complete -c %[2]s -n '__%[1]s_prepare_completions' -f -a '$__%[1]s_comp_results' `, nameForVar, name, compCmd, ShellCompDirectiveError, ShellCompDirectiveNoSpace, ShellCompDirectiveNoFileComp, - ShellCompDirectiveFilterFileExt, ShellCompDirectiveFilterDirs)) + ShellCompDirectiveFilterFileExt, ShellCompDirectiveFilterDirs, activeHelpEnvVar(name))) } // GenFishCompletion generates fish completion file and writes to the passed writer. diff --git a/vendor/github.com/spf13/cobra/flag_groups.go b/vendor/github.com/spf13/cobra/flag_groups.go new file mode 100644 index 000000000..dc7843119 --- /dev/null +++ b/vendor/github.com/spf13/cobra/flag_groups.go @@ -0,0 +1,223 @@ +// Copyright © 2022 Steve Francia <spf@spf13.com>. +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package cobra + +import ( + "fmt" + "sort" + "strings" + + flag "github.com/spf13/pflag" +) + +const ( + requiredAsGroup = "cobra_annotation_required_if_others_set" + mutuallyExclusive = "cobra_annotation_mutually_exclusive" +) + +// MarkFlagsRequiredTogether marks the given flags with annotations so that Cobra errors +// if the command is invoked with a subset (but not all) of the given flags. +func (c *Command) MarkFlagsRequiredTogether(flagNames ...string) { + c.mergePersistentFlags() + for _, v := range flagNames { + f := c.Flags().Lookup(v) + if f == nil { + panic(fmt.Sprintf("Failed to find flag %q and mark it as being required in a flag group", v)) + } + if err := c.Flags().SetAnnotation(v, requiredAsGroup, append(f.Annotations[requiredAsGroup], strings.Join(flagNames, " "))); err != nil { + // Only errs if the flag isn't found. + panic(err) + } + } +} + +// MarkFlagsMutuallyExclusive marks the given flags with annotations so that Cobra errors +// if the command is invoked with more than one flag from the given set of flags. +func (c *Command) MarkFlagsMutuallyExclusive(flagNames ...string) { + c.mergePersistentFlags() + for _, v := range flagNames { + f := c.Flags().Lookup(v) + if f == nil { + panic(fmt.Sprintf("Failed to find flag %q and mark it as being in a mutually exclusive flag group", v)) + } + // Each time this is called is a single new entry; this allows it to be a member of multiple groups if needed. + if err := c.Flags().SetAnnotation(v, mutuallyExclusive, append(f.Annotations[mutuallyExclusive], strings.Join(flagNames, " "))); err != nil { + panic(err) + } + } +} + +// validateFlagGroups validates the mutuallyExclusive/requiredAsGroup logic and returns the +// first error encountered. +func (c *Command) validateFlagGroups() error { + if c.DisableFlagParsing { + return nil + } + + flags := c.Flags() + + // groupStatus format is the list of flags as a unique ID, + // then a map of each flag name and whether it is set or not. + groupStatus := map[string]map[string]bool{} + mutuallyExclusiveGroupStatus := map[string]map[string]bool{} + flags.VisitAll(func(pflag *flag.Flag) { + processFlagForGroupAnnotation(flags, pflag, requiredAsGroup, groupStatus) + processFlagForGroupAnnotation(flags, pflag, mutuallyExclusive, mutuallyExclusiveGroupStatus) + }) + + if err := validateRequiredFlagGroups(groupStatus); err != nil { + return err + } + if err := validateExclusiveFlagGroups(mutuallyExclusiveGroupStatus); err != nil { + return err + } + return nil +} + +func hasAllFlags(fs *flag.FlagSet, flagnames ...string) bool { + for _, fname := range flagnames { + f := fs.Lookup(fname) + if f == nil { + return false + } + } + return true +} + +func processFlagForGroupAnnotation(flags *flag.FlagSet, pflag *flag.Flag, annotation string, groupStatus map[string]map[string]bool) { + groupInfo, found := pflag.Annotations[annotation] + if found { + for _, group := range groupInfo { + if groupStatus[group] == nil { + flagnames := strings.Split(group, " ") + + // Only consider this flag group at all if all the flags are defined. + if !hasAllFlags(flags, flagnames...) { + continue + } + + groupStatus[group] = map[string]bool{} + for _, name := range flagnames { + groupStatus[group][name] = false + } + } + + groupStatus[group][pflag.Name] = pflag.Changed + } + } +} + +func validateRequiredFlagGroups(data map[string]map[string]bool) error { + keys := sortedKeys(data) + for _, flagList := range keys { + flagnameAndStatus := data[flagList] + + unset := []string{} + for flagname, isSet := range flagnameAndStatus { + if !isSet { + unset = append(unset, flagname) + } + } + if len(unset) == len(flagnameAndStatus) || len(unset) == 0 { + continue + } + + // Sort values, so they can be tested/scripted against consistently. + sort.Strings(unset) + return fmt.Errorf("if any flags in the group [%v] are set they must all be set; missing %v", flagList, unset) + } + + return nil +} + +func validateExclusiveFlagGroups(data map[string]map[string]bool) error { + keys := sortedKeys(data) + for _, flagList := range keys { + flagnameAndStatus := data[flagList] + var set []string + for flagname, isSet := range flagnameAndStatus { + if isSet { + set = append(set, flagname) + } + } + if len(set) == 0 || len(set) == 1 { + continue + } + + // Sort values, so they can be tested/scripted against consistently. + sort.Strings(set) + return fmt.Errorf("if any flags in the group [%v] are set none of the others can be; %v were all set", flagList, set) + } + return nil +} + +func sortedKeys(m map[string]map[string]bool) []string { + keys := make([]string, len(m)) + i := 0 + for k := range m { + keys[i] = k + i++ + } + sort.Strings(keys) + return keys +} + +// enforceFlagGroupsForCompletion will do the following: +// - when a flag in a group is present, other flags in the group will be marked required +// - when a flag in a mutually exclusive group is present, other flags in the group will be marked as hidden +// This allows the standard completion logic to behave appropriately for flag groups +func (c *Command) enforceFlagGroupsForCompletion() { + if c.DisableFlagParsing { + return + } + + flags := c.Flags() + groupStatus := map[string]map[string]bool{} + mutuallyExclusiveGroupStatus := map[string]map[string]bool{} + c.Flags().VisitAll(func(pflag *flag.Flag) { + processFlagForGroupAnnotation(flags, pflag, requiredAsGroup, groupStatus) + processFlagForGroupAnnotation(flags, pflag, mutuallyExclusive, mutuallyExclusiveGroupStatus) + }) + + // If a flag that is part of a group is present, we make all the other flags + // of that group required so that the shell completion suggests them automatically + for flagList, flagnameAndStatus := range groupStatus { + for _, isSet := range flagnameAndStatus { + if isSet { + // One of the flags of the group is set, mark the other ones as required + for _, fName := range strings.Split(flagList, " ") { + _ = c.MarkFlagRequired(fName) + } + } + } + } + + // If a flag that is mutually exclusive to others is present, we hide the other + // flags of that group so the shell completion does not suggest them + for flagList, flagnameAndStatus := range mutuallyExclusiveGroupStatus { + for flagName, isSet := range flagnameAndStatus { + if isSet { + // One of the flags of the mutually exclusive group is set, mark the other ones as hidden + // Don't mark the flag that is already set as hidden because it may be an + // array or slice flag and therefore must continue being suggested + for _, fName := range strings.Split(flagList, " ") { + if fName != flagName { + flag := c.Flags().Lookup(fName) + flag.Hidden = true + } + } + } + } + } +} diff --git a/vendor/github.com/spf13/cobra/powershell_completions.go b/vendor/github.com/spf13/cobra/powershell_completions.go index 62d719f0b..379e7c088 100644 --- a/vendor/github.com/spf13/cobra/powershell_completions.go +++ b/vendor/github.com/spf13/cobra/powershell_completions.go @@ -61,6 +61,7 @@ Register-ArgumentCompleter -CommandName '%[1]s' -ScriptBlock { # Prepare the command to request completions for the program. # Split the command at the first space to separate the program and arguments. $Program,$Arguments = $Command.Split(" ",2) + $RequestComp="$Program %[2]s $Arguments" __%[1]s_debug "RequestComp: $RequestComp" @@ -90,11 +91,13 @@ Register-ArgumentCompleter -CommandName '%[1]s' -ScriptBlock { } __%[1]s_debug "Calling $RequestComp" + # First disable ActiveHelp which is not supported for Powershell + $env:%[8]s=0 + #call the command store the output in $out and redirect stderr and stdout to null # $Out is an array contains each line per element Invoke-Expression -OutVariable out "$RequestComp" 2>&1 | Out-Null - # get directive from last line [int]$Directive = $Out[-1].TrimStart(':') if ($Directive -eq "") { @@ -242,7 +245,7 @@ Register-ArgumentCompleter -CommandName '%[1]s' -ScriptBlock { } `, name, compCmd, ShellCompDirectiveError, ShellCompDirectiveNoSpace, ShellCompDirectiveNoFileComp, - ShellCompDirectiveFilterFileExt, ShellCompDirectiveFilterDirs)) + ShellCompDirectiveFilterFileExt, ShellCompDirectiveFilterDirs, activeHelpEnvVar(name))) } func (c *Command) genPowerShellCompletion(w io.Writer, includeDesc bool) error { diff --git a/vendor/github.com/spf13/cobra/projects_using_cobra.md b/vendor/github.com/spf13/cobra/projects_using_cobra.md index 9674c348c..ac680118e 100644 --- a/vendor/github.com/spf13/cobra/projects_using_cobra.md +++ b/vendor/github.com/spf13/cobra/projects_using_cobra.md @@ -1,8 +1,8 @@ ## Projects using Cobra - [Arduino CLI](https://github.com/arduino/arduino-cli) -- [Bleve](http://www.blevesearch.com/) -- [CockroachDB](http://www.cockroachlabs.com/) +- [Bleve](https://blevesearch.com/) +- [CockroachDB](https://www.cockroachlabs.com/) - [Cosmos SDK](https://github.com/cosmos/cosmos-sdk) - [Datree](https://github.com/datreeio/datree) - [Delve](https://github.com/derekparker/delve) @@ -14,14 +14,15 @@ - [Github CLI](https://github.com/cli/cli) - [GitHub Labeler](https://github.com/erdaltsksn/gh-label) - [Golangci-lint](https://golangci-lint.run) -- [GopherJS](http://www.gopherjs.org/) +- [GopherJS](https://github.com/gopherjs/gopherjs) - [GoReleaser](https://goreleaser.com) - [Helm](https://helm.sh) - [Hugo](https://gohugo.io) - [Infracost](https://github.com/infracost/infracost) - [Istio](https://istio.io) - [Kool](https://github.com/kool-dev/kool) -- [Kubernetes](http://kubernetes.io/) +- [Kubernetes](https://kubernetes.io/) +- [Kubescape](https://github.com/armosec/kubescape) - [Linkerd](https://linkerd.io/) - [Mattermost-server](https://github.com/mattermost/mattermost-server) - [Mercure](https://mercure.rocks/) @@ -36,9 +37,11 @@ - [Ory Hydra](https://github.com/ory/hydra) - [Ory Kratos](https://github.com/ory/kratos) - [Pixie](https://github.com/pixie-io/pixie) +- [Polygon Edge](https://github.com/0xPolygon/polygon-edge) - [Pouch](https://github.com/alibaba/pouch) -- [ProjectAtomic (enterprise)](http://www.projectatomic.io/) +- [ProjectAtomic (enterprise)](https://www.projectatomic.io/) - [Prototool](https://github.com/uber/prototool) +- [Pulumi](https://www.pulumi.com) - [QRcp](https://github.com/claudiodangelis/qrcp) - [Random](https://github.com/erdaltsksn/random) - [Rclone](https://rclone.org/) diff --git a/vendor/github.com/spf13/cobra/shell_completions.md b/vendor/github.com/spf13/cobra/shell_completions.md index 33a4c65a5..1e2058ed6 100644 --- a/vendor/github.com/spf13/cobra/shell_completions.md +++ b/vendor/github.com/spf13/cobra/shell_completions.md @@ -40,7 +40,7 @@ Bash: # Linux: $ %[1]s completion bash > /etc/bash_completion.d/%[1]s # macOS: - $ %[1]s completion bash > /usr/local/etc/bash_completion.d/%[1]s + $ %[1]s completion bash > $(brew --prefix)/etc/bash_completion.d/%[1]s Zsh: @@ -122,7 +122,7 @@ For example, if you want `kubectl get [tab][tab]` to show a list of valid "nouns Some simplified code from `kubectl get` looks like: ```go -validArgs []string = { "pod", "node", "service", "replicationcontroller" } +validArgs = []string{ "pod", "node", "service", "replicationcontroller" } cmd := &cobra.Command{ Use: "get [(-o|--output=)json|yaml|template|...] (RESOURCE [NAME] | RESOURCE/NAME ...)", @@ -148,7 +148,7 @@ node pod replicationcontroller service If your nouns have aliases, you can define them alongside `ValidArgs` using `ArgAliases`: ```go -argAliases []string = { "pods", "nodes", "services", "svc", "replicationcontrollers", "rc" } +argAliases = []string { "pods", "nodes", "services", "svc", "replicationcontrollers", "rc" } cmd := &cobra.Command{ ... diff --git a/vendor/github.com/spf13/cobra/user_guide.md b/vendor/github.com/spf13/cobra/user_guide.md index 4a3c2b0da..5a7acf88e 100644 --- a/vendor/github.com/spf13/cobra/user_guide.md +++ b/vendor/github.com/spf13/cobra/user_guide.md @@ -32,7 +32,7 @@ func main() { Cobra-CLI is its own program that will create your application and add any commands you want. It's the easiest way to incorporate Cobra into your application. -For complete details on using the Cobra generator, please refer to [The Cobra-CLI Generator README](https://github.com/spf13/cobra-cli/blob/master/README.md) +For complete details on using the Cobra generator, please refer to [The Cobra-CLI Generator README](https://github.com/spf13/cobra-cli/blob/main/README.md) ## Using the Cobra Library @@ -51,7 +51,7 @@ var rootCmd = &cobra.Command{ Short: "Hugo is a very fast static site generator", Long: `A Fast and Flexible Static Site Generator built with love by spf13 and friends in Go. - Complete documentation is available at http://hugo.spf13.com`, + Complete documentation is available at https://gohugo.io/documentation/`, Run: func(cmd *cobra.Command, args []string) { // Do Stuff Here }, @@ -300,10 +300,34 @@ rootCmd.PersistentFlags().StringVarP(&Region, "region", "r", "", "AWS region (re rootCmd.MarkPersistentFlagRequired("region") ``` +### Flag Groups + +If you have different flags that must be provided together (e.g. if they provide the `--username` flag they MUST provide the `--password` flag as well) then +Cobra can enforce that requirement: +```go +rootCmd.Flags().StringVarP(&u, "username", "u", "", "Username (required if password is set)") +rootCmd.Flags().StringVarP(&pw, "password", "p", "", "Password (required if username is set)") +rootCmd.MarkFlagsRequiredTogether("username", "password") +``` + +You can also prevent different flags from being provided together if they represent mutually +exclusive options such as specifying an output format as either `--json` or `--yaml` but never both: +```go +rootCmd.Flags().BoolVar(&u, "json", false, "Output in JSON") +rootCmd.Flags().BoolVar(&pw, "yaml", false, "Output in YAML") +rootCmd.MarkFlagsMutuallyExclusive("json", "yaml") +``` + +In both of these cases: + - both local and persistent flags can be used + - **NOTE:** the group is only enforced on commands where every flag is defined + - a flag may appear in multiple groups + - a group may contain any number of flags + ## Positional and Custom Arguments -Validation of positional arguments can be specified using the `Args` field -of `Command`. +Validation of positional arguments can be specified using the `Args` field of `Command`. +If `Args` is undefined or `nil`, it defaults to `ArbitraryArgs`. The following validators are built in: @@ -405,7 +429,7 @@ a count and a string.`, } ``` -For a more complete example of a larger application, please checkout [Hugo](http://gohugo.io/). +For a more complete example of a larger application, please checkout [Hugo](https://gohugo.io/). ## Help Command @@ -603,7 +627,7 @@ Did you mean this? Run 'hugo --help' for usage. ``` -Suggestions are automatic based on every subcommand registered and use an implementation of [Levenshtein distance](http://en.wikipedia.org/wiki/Levenshtein_distance). Every registered command that matches a minimum distance of 2 (ignoring case) will be displayed as a suggestion. +Suggestions are automatic based on every subcommand registered and use an implementation of [Levenshtein distance](https://en.wikipedia.org/wiki/Levenshtein_distance). Every registered command that matches a minimum distance of 2 (ignoring case) will be displayed as a suggestion. If you need to disable suggestions or tweak the string distance in your command, use: @@ -636,3 +660,7 @@ Cobra can generate documentation based on subcommands, flags, etc. Read more abo ## Generating shell completions Cobra can generate a shell-completion file for the following shells: bash, zsh, fish, PowerShell. If you add more information to your commands, these completions can be amazingly powerful and flexible. Read more about it in [Shell Completions](shell_completions.md). + +## Providing Active Help + +Cobra makes use of the shell-completion system to define a framework allowing you to provide Active Help to your users. Active Help are messages (hints, warnings, etc) printed as the program is being used. Read more about it in [Active Help](active_help.md). diff --git a/vendor/github.com/spf13/cobra/zsh_completions.go b/vendor/github.com/spf13/cobra/zsh_completions.go index 624adab53..65cd94c60 100644 --- a/vendor/github.com/spf13/cobra/zsh_completions.go +++ b/vendor/github.com/spf13/cobra/zsh_completions.go @@ -75,7 +75,7 @@ func genZshComp(buf io.StringWriter, name string, includeDesc bool) { if !includeDesc { compCmd = ShellCompNoDescRequestCmd } - WriteStringAndCheck(buf, fmt.Sprintf(`#compdef _%[1]s %[1]s + WriteStringAndCheck(buf, fmt.Sprintf(`#compdef %[1]s # zsh completion for %-36[1]s -*- shell-script -*- @@ -163,7 +163,24 @@ _%[1]s() return fi + local activeHelpMarker="%[8]s" + local endIndex=${#activeHelpMarker} + local startIndex=$((${#activeHelpMarker}+1)) + local hasActiveHelp=0 while IFS='\n' read -r comp; do + # Check if this is an activeHelp statement (i.e., prefixed with $activeHelpMarker) + if [ "${comp[1,$endIndex]}" = "$activeHelpMarker" ];then + __%[1]s_debug "ActiveHelp found: $comp" + comp="${comp[$startIndex,-1]}" + if [ -n "$comp" ]; then + compadd -x "${comp}" + __%[1]s_debug "ActiveHelp will need delimiter" + hasActiveHelp=1 + fi + + continue + fi + if [ -n "$comp" ]; then # If requested, completions are returned with a description. # The description is preceded by a TAB character. @@ -171,7 +188,7 @@ _%[1]s() # We first need to escape any : as part of the completion itself. comp=${comp//:/\\:} - local tab=$(printf '\t') + local tab="$(printf '\t')" comp=${comp//$tab/:} __%[1]s_debug "Adding completion: ${comp}" @@ -180,6 +197,17 @@ _%[1]s() fi done < <(printf "%%s\n" "${out[@]}") + # Add a delimiter after the activeHelp statements, but only if: + # - there are completions following the activeHelp statements, or + # - file completion will be performed (so there will be choices after the activeHelp) + if [ $hasActiveHelp -eq 1 ]; then + if [ ${#completions} -ne 0 ] || [ $((directive & shellCompDirectiveNoFileComp)) -eq 0 ]; then + __%[1]s_debug "Adding activeHelp delimiter" + compadd -x "--" + hasActiveHelp=0 + fi + fi + if [ $((directive & shellCompDirectiveNoSpace)) -ne 0 ]; then __%[1]s_debug "Activating nospace." noSpace="-S ''" @@ -254,5 +282,6 @@ if [ "$funcstack[1]" = "_%[1]s" ]; then fi `, name, compCmd, ShellCompDirectiveError, ShellCompDirectiveNoSpace, ShellCompDirectiveNoFileComp, - ShellCompDirectiveFilterFileExt, ShellCompDirectiveFilterDirs)) + ShellCompDirectiveFilterFileExt, ShellCompDirectiveFilterDirs, + activeHelpMarker)) } diff --git a/vendor/github.com/spf13/viper/.editorconfig b/vendor/github.com/spf13/viper/.editorconfig index 63afcbcdd..6d0b6d356 100644 --- a/vendor/github.com/spf13/viper/.editorconfig +++ b/vendor/github.com/spf13/viper/.editorconfig @@ -11,5 +11,5 @@ trim_trailing_whitespace = true [*.go] indent_style = tab -[{Makefile, *.mk}] +[{Makefile,*.mk}] indent_style = tab diff --git a/vendor/github.com/spf13/viper/.golangci.yml b/vendor/github.com/spf13/viper/.golangci.yaml index 16e039652..16e039652 100644 --- a/vendor/github.com/spf13/viper/.golangci.yml +++ b/vendor/github.com/spf13/viper/.golangci.yaml diff --git a/vendor/github.com/spf13/viper/Makefile b/vendor/github.com/spf13/viper/Makefile index 02d3e3715..130c427e8 100644 --- a/vendor/github.com/spf13/viper/Makefile +++ b/vendor/github.com/spf13/viper/Makefile @@ -16,7 +16,7 @@ endif # Dependency versions GOTESTSUM_VERSION = 1.8.0 -GOLANGCI_VERSION = 1.45.2 +GOLANGCI_VERSION = 1.49.0 # Add the ability to override some variables # Use with care @@ -48,7 +48,7 @@ bin/golangci-lint: bin/golangci-lint-${GOLANGCI_VERSION} @ln -sf golangci-lint-${GOLANGCI_VERSION} bin/golangci-lint bin/golangci-lint-${GOLANGCI_VERSION}: @mkdir -p bin - curl -sfL https://install.goreleaser.com/github.com/golangci/golangci-lint.sh | bash -s -- -b ./bin/ v${GOLANGCI_VERSION} + curl -sfL https://raw.githubusercontent.com/golangci/golangci-lint/master/install.sh | bash -s -- -b ./bin/ v${GOLANGCI_VERSION} @mv bin/golangci-lint "$@" .PHONY: lint diff --git a/vendor/github.com/spf13/viper/README.md b/vendor/github.com/spf13/viper/README.md index c14e8927a..5701422c8 100644 --- a/vendor/github.com/spf13/viper/README.md +++ b/vendor/github.com/spf13/viper/README.md @@ -119,7 +119,7 @@ viper.AddConfigPath("$HOME/.appname") // call multiple times to add many search viper.AddConfigPath(".") // optionally look for config in the working directory err := viper.ReadInConfig() // Find and read the config file if err != nil { // Handle errors reading the config file - panic(fmt.Errorf("Fatal error config file: %w \n", err)) + panic(fmt.Errorf("fatal error config file: %w", err)) } ``` @@ -447,6 +447,13 @@ viper.SetConfigType("json") // because there is no file extension in a stream of err := viper.ReadRemoteConfig() ``` +#### etcd3 +```go +viper.AddRemoteProvider("etcd3", "http://127.0.0.1:4001","/config/hugo.json") +viper.SetConfigType("json") // because there is no file extension in a stream of bytes, supported extensions are "json", "toml", "yaml", "yml", "properties", "props", "prop", "env", "dotenv" +err := viper.ReadRemoteConfig() +``` + #### Consul You need to set a key to Consul key/value storage with JSON value containing your desired config. For example, create a Consul key/value store key `MY_CONSUL_KEY` with value: @@ -594,7 +601,7 @@ configuration level. Viper can access array indices by using numbers in the path. For example: -```json +```jsonc { "host": { "address": "localhost", @@ -622,7 +629,7 @@ GetInt("host.ports.1") // returns 6029 Lastly, if there exists a key that matches the delimited key path, its value will be returned instead. E.g. -```json +```jsonc { "datastore.metric.host": "0.0.0.0", "host": { diff --git a/vendor/github.com/spf13/viper/internal/encoding/toml/codec.go b/vendor/github.com/spf13/viper/internal/encoding/toml/codec.go index ff1112cac..45fddc8b5 100644 --- a/vendor/github.com/spf13/viper/internal/encoding/toml/codec.go +++ b/vendor/github.com/spf13/viper/internal/encoding/toml/codec.go @@ -1,5 +1,5 @@ -//go:build !viper_toml2 -// +build !viper_toml2 +//go:build viper_toml1 +// +build viper_toml1 package toml diff --git a/vendor/github.com/spf13/viper/internal/encoding/toml/codec2.go b/vendor/github.com/spf13/viper/internal/encoding/toml/codec2.go index 566b70628..112c6d372 100644 --- a/vendor/github.com/spf13/viper/internal/encoding/toml/codec2.go +++ b/vendor/github.com/spf13/viper/internal/encoding/toml/codec2.go @@ -1,5 +1,5 @@ -//go:build viper_toml2 -// +build viper_toml2 +//go:build !viper_toml1 +// +build !viper_toml1 package toml diff --git a/vendor/github.com/spf13/viper/internal/encoding/yaml/yaml2.go b/vendor/github.com/spf13/viper/internal/encoding/yaml/yaml2.go index ca29b84db..4c398c2f4 100644 --- a/vendor/github.com/spf13/viper/internal/encoding/yaml/yaml2.go +++ b/vendor/github.com/spf13/viper/internal/encoding/yaml/yaml2.go @@ -1,5 +1,5 @@ -//go:build !viper_yaml3 -// +build !viper_yaml3 +//go:build viper_yaml2 +// +build viper_yaml2 package yaml diff --git a/vendor/github.com/spf13/viper/internal/encoding/yaml/yaml3.go b/vendor/github.com/spf13/viper/internal/encoding/yaml/yaml3.go index 96b8957fa..3a4775ced 100644 --- a/vendor/github.com/spf13/viper/internal/encoding/yaml/yaml3.go +++ b/vendor/github.com/spf13/viper/internal/encoding/yaml/yaml3.go @@ -1,5 +1,5 @@ -//go:build viper_yaml3 -// +build viper_yaml3 +//go:build !viper_yaml2 +// +build !viper_yaml2 package yaml diff --git a/vendor/github.com/spf13/viper/logger.go b/vendor/github.com/spf13/viper/logger.go index 0115067ae..a64e1446c 100644 --- a/vendor/github.com/spf13/viper/logger.go +++ b/vendor/github.com/spf13/viper/logger.go @@ -7,8 +7,8 @@ import ( ) // Logger is a unified interface for various logging use cases and practices, including: -// - leveled logging -// - structured logging +// - leveled logging +// - structured logging type Logger interface { // Trace logs a Trace event. // diff --git a/vendor/github.com/spf13/viper/util.go b/vendor/github.com/spf13/viper/util.go index ee7a86d9d..64e657505 100644 --- a/vendor/github.com/spf13/viper/util.go +++ b/vendor/github.com/spf13/viper/util.go @@ -64,18 +64,25 @@ func copyAndInsensitiviseMap(m map[string]interface{}) map[string]interface{} { return nm } +func insensitiviseVal(val interface{}) interface{} { + switch val.(type) { + case map[interface{}]interface{}: + // nested map: cast and recursively insensitivise + val = cast.ToStringMap(val) + insensitiviseMap(val.(map[string]interface{})) + case map[string]interface{}: + // nested map: recursively insensitivise + insensitiviseMap(val.(map[string]interface{})) + case []interface{}: + // nested array: recursively insensitivise + insensitiveArray(val.([]interface{})) + } + return val +} + func insensitiviseMap(m map[string]interface{}) { for key, val := range m { - switch val.(type) { - case map[interface{}]interface{}: - // nested map: cast and recursively insensitivise - val = cast.ToStringMap(val) - insensitiviseMap(val.(map[string]interface{})) - case map[string]interface{}: - // nested map: recursively insensitivise - insensitiviseMap(val.(map[string]interface{})) - } - + val = insensitiviseVal(val) lower := strings.ToLower(key) if key != lower { // remove old key (not lower-cased) @@ -86,6 +93,12 @@ func insensitiviseMap(m map[string]interface{}) { } } +func insensitiveArray(a []interface{}) { + for i, val := range a { + a[i] = insensitiviseVal(val) + } +} + func absPathify(logger Logger, inPath string) string { logger.Info("trying to resolve absolute path", "path", inPath) diff --git a/vendor/github.com/spf13/viper/viper.go b/vendor/github.com/spf13/viper/viper.go index 4a9dac9d4..5f76cc095 100644 --- a/vendor/github.com/spf13/viper/viper.go +++ b/vendor/github.com/spf13/viper/viper.go @@ -132,10 +132,10 @@ type DecoderConfigOption func(*mapstructure.DecoderConfig) // DecodeHook returns a DecoderConfigOption which overrides the default // DecoderConfig.DecodeHook value, the default is: // -// mapstructure.ComposeDecodeHookFunc( -// mapstructure.StringToTimeDurationHookFunc(), -// mapstructure.StringToSliceHookFunc(","), -// ) +// mapstructure.ComposeDecodeHookFunc( +// mapstructure.StringToTimeDurationHookFunc(), +// mapstructure.StringToSliceHookFunc(","), +// ) func DecodeHook(hook mapstructure.DecodeHookFunc) DecoderConfigOption { return func(c *mapstructure.DecoderConfig) { c.DecodeHook = hook @@ -156,18 +156,18 @@ func DecodeHook(hook mapstructure.DecodeHookFunc) DecoderConfigOption { // // For example, if values from the following sources were loaded: // -// Defaults : { -// "secret": "", -// "user": "default", -// "endpoint": "https://localhost" -// } -// Config : { -// "user": "root" -// "secret": "defaultsecret" -// } -// Env : { -// "secret": "somesecretkey" -// } +// Defaults : { +// "secret": "", +// "user": "default", +// "endpoint": "https://localhost" +// } +// Config : { +// "user": "root" +// "secret": "defaultsecret" +// } +// Env : { +// "secret": "somesecretkey" +// } // // The resulting config will have the following values: // @@ -300,7 +300,7 @@ func NewWithOptions(opts ...Option) *Viper { func Reset() { v = New() SupportedExts = []string{"json", "toml", "yaml", "yml", "properties", "props", "prop", "hcl", "tfvars", "dotenv", "env", "ini"} - SupportedRemoteProviders = []string{"etcd", "consul", "firestore"} + SupportedRemoteProviders = []string{"etcd", "etcd3", "consul", "firestore"} } // TODO: make this lazy initialization instead @@ -419,7 +419,7 @@ type RemoteProvider interface { var SupportedExts = []string{"json", "toml", "yaml", "yml", "properties", "props", "prop", "hcl", "tfvars", "dotenv", "env", "ini"} // SupportedRemoteProviders are universally supported remote providers. -var SupportedRemoteProviders = []string{"etcd", "consul", "firestore"} +var SupportedRemoteProviders = []string{"etcd", "etcd3", "consul", "firestore"} func OnConfigChange(run func(in fsnotify.Event)) { v.OnConfigChange(run) } func (v *Viper) OnConfigChange(run func(in fsnotify.Event)) { @@ -573,7 +573,7 @@ func (v *Viper) AddConfigPath(in string) { // AddRemoteProvider adds a remote configuration source. // Remote Providers are searched in the order they are added. -// provider is a string value: "etcd", "consul" or "firestore" are currently supported. +// provider is a string value: "etcd", "etcd3", "consul" or "firestore" are currently supported. // endpoint is the url. etcd requires http://ip:port consul requires ip:port // path is the path in the k/v store to retrieve configuration // To retrieve a config file called myapp.json from /configs/myapp.json @@ -604,7 +604,7 @@ func (v *Viper) AddRemoteProvider(provider, endpoint, path string) error { // AddSecureRemoteProvider adds a remote configuration source. // Secure Remote Providers are searched in the order they are added. -// provider is a string value: "etcd", "consul" or "firestore" are currently supported. +// provider is a string value: "etcd", "etcd3", "consul" or "firestore" are currently supported. // endpoint is the url. etcd requires http://ip:port consul requires ip:port // secretkeyring is the filepath to your openpgp secret keyring. e.g. /etc/secrets/myring.gpg // path is the path in the k/v store to retrieve configuration @@ -785,7 +785,8 @@ func (v *Viper) searchMapWithPathPrefixes( // isPathShadowedInDeepMap makes sure the given path is not shadowed somewhere // on its path in the map. // e.g., if "foo.bar" has a value in the given map, it “shadows” -// "foo.bar.baz" in a lower-priority map +// +// "foo.bar.baz" in a lower-priority map func (v *Viper) isPathShadowedInDeepMap(path []string, m map[string]interface{}) string { var parentVal interface{} for i := 1; i < len(path); i++ { @@ -810,7 +811,8 @@ func (v *Viper) isPathShadowedInDeepMap(path []string, m map[string]interface{}) // isPathShadowedInFlatMap makes sure the given path is not shadowed somewhere // in a sub-path of the map. // e.g., if "foo.bar" has a value in the given map, it “shadows” -// "foo.bar.baz" in a lower-priority map +// +// "foo.bar.baz" in a lower-priority map func (v *Viper) isPathShadowedInFlatMap(path []string, mi interface{}) string { // unify input map var m map[string]interface{} @@ -835,7 +837,8 @@ func (v *Viper) isPathShadowedInFlatMap(path []string, mi interface{}) string { // isPathShadowedInAutoEnv makes sure the given path is not shadowed somewhere // in the environment, when automatic env is on. // e.g., if "foo.bar" has a value in the environment, it “shadows” -// "foo.bar.baz" in a lower-priority map +// +// "foo.bar.baz" in a lower-priority map func (v *Viper) isPathShadowedInAutoEnv(path []string) string { var parentKey string for i := 1; i < len(path); i++ { @@ -856,11 +859,11 @@ func (v *Viper) isPathShadowedInAutoEnv(path []string) string { // would return a string slice for the key if the key's type is inferred by // the default value and the Get function would return: // -// []string {"a", "b", "c"} +// []string {"a", "b", "c"} // // Otherwise the Get function would return: // -// "a b c" +// "a b c" func SetTypeByDefaultValue(enable bool) { v.SetTypeByDefaultValue(enable) } func (v *Viper) SetTypeByDefaultValue(enable bool) { @@ -988,6 +991,13 @@ func (v *Viper) GetUint(key string) uint { return cast.ToUint(v.Get(key)) } +// GetUint16 returns the value associated with the key as an unsigned integer. +func GetUint16(key string) uint16 { return v.GetUint16(key) } + +func (v *Viper) GetUint16(key string) uint16 { + return cast.ToUint16(v.Get(key)) +} + // GetUint32 returns the value associated with the key as an unsigned integer. func GetUint32(key string) uint32 { return v.GetUint32(key) } @@ -1137,9 +1147,8 @@ func (v *Viper) BindPFlags(flags *pflag.FlagSet) error { // BindPFlag binds a specific key to a pflag (as used by cobra). // Example (where serverCmd is a Cobra instance): // -// serverCmd.Flags().Int("port", 1138, "Port to run Application server on") -// Viper.BindPFlag("port", serverCmd.Flags().Lookup("port")) -// +// serverCmd.Flags().Int("port", 1138, "Port to run Application server on") +// Viper.BindPFlag("port", serverCmd.Flags().Lookup("port")) func BindPFlag(key string, flag *pflag.Flag) error { return v.BindPFlag(key, flag) } func (v *Viper) BindPFlag(key string, flag *pflag.Flag) error { @@ -1197,6 +1206,17 @@ func (v *Viper) BindEnv(input ...string) error { return nil } +// MustBindEnv wraps BindEnv in a panic. +// If there is an error binding an environment variable, MustBindEnv will +// panic. +func MustBindEnv(input ...string) { v.MustBindEnv(input...) } + +func (v *Viper) MustBindEnv(input ...string) { + if err := v.BindEnv(input...); err != nil { + panic(fmt.Sprintf("error while binding environment variable: %v", err)) + } +} + // Given a key, find the value. // // Viper will check to see if an alias exists first. @@ -1798,8 +1818,13 @@ func mergeMaps( tsv, ok := sv.(map[interface{}]interface{}) if !ok { v.logger.Error( - "Could not cast sv to map[interface{}]interface{}; key=%s, st=%v, tt=%v, sv=%v, tv=%v", - sk, svType, tvType, sv, tv) + "Could not cast sv to map[interface{}]interface{}", + "key", sk, + "st", svType, + "tt", tvType, + "sv", sv, + "tv", tv, + ) continue } @@ -1811,8 +1836,13 @@ func mergeMaps( tsv, ok := sv.(map[string]interface{}) if !ok { v.logger.Error( - "Could not cast sv to map[string]interface{}; key=%s, st=%v, tt=%v, sv=%v, tv=%v", - sk, svType, tvType, sv, tv) + "Could not cast sv to map[string]interface{}", + "key", sk, + "st", svType, + "tt", tvType, + "sv", sv, + "tv", tv, + ) continue } mergeMaps(tsv, ttv, nil) @@ -1849,6 +1879,10 @@ func (v *Viper) getKeyValueConfig() error { return RemoteConfigError("Enable the remote features by doing a blank import of the viper/remote package: '_ github.com/spf13/viper/remote'") } + if len(v.remoteProviders) == 0 { + return RemoteConfigError("No Remote Providers") + } + for _, rp := range v.remoteProviders { val, err := v.getRemoteConfig(rp) if err != nil { @@ -1875,6 +1909,10 @@ func (v *Viper) getRemoteConfig(provider RemoteProvider) (map[string]interface{} // Retrieve the first found remote configuration. func (v *Viper) watchKeyValueConfigOnChannel() error { + if len(v.remoteProviders) == 0 { + return RemoteConfigError("No Remote Providers") + } + for _, rp := range v.remoteProviders { respc, _ := RemoteConfig.WatchChannel(rp) // Todo: Add quit channel @@ -1892,9 +1930,15 @@ func (v *Viper) watchKeyValueConfigOnChannel() error { // Retrieve the first found remote configuration. func (v *Viper) watchKeyValueConfig() error { + if len(v.remoteProviders) == 0 { + return RemoteConfigError("No Remote Providers") + } + for _, rp := range v.remoteProviders { val, err := v.watchRemoteConfig(rp) if err != nil { + v.logger.Error(fmt.Errorf("watch remote config: %w", err).Error()) + continue } v.kvstore = val @@ -1937,9 +1981,10 @@ func (v *Viper) AllKeys() []string { // flattenAndMergeMap recursively flattens the given map into a map[string]bool // of key paths (used as a set, easier to manipulate than a []string): -// - each path is merged into a single key string, delimited with v.keyDelim -// - if a path is shadowed by an earlier value in the initial shadow map, -// it is skipped. +// - each path is merged into a single key string, delimited with v.keyDelim +// - if a path is shadowed by an earlier value in the initial shadow map, +// it is skipped. +// // The resulting set of paths is merged to the given shadow set at the same time. func (v *Viper) flattenAndMergeMap(shadow map[string]bool, m map[string]interface{}, prefix string) map[string]bool { if shadow != nil && prefix != "" && shadow[prefix] { @@ -2090,14 +2135,17 @@ func (v *Viper) getConfigFile() (string, error) { // Debug prints all configuration registries for debugging // purposes. -func Debug() { v.Debug() } - -func (v *Viper) Debug() { - fmt.Printf("Aliases:\n%#v\n", v.aliases) - fmt.Printf("Override:\n%#v\n", v.override) - fmt.Printf("PFlags:\n%#v\n", v.pflags) - fmt.Printf("Env:\n%#v\n", v.env) - fmt.Printf("Key/Value Store:\n%#v\n", v.kvstore) - fmt.Printf("Config:\n%#v\n", v.config) - fmt.Printf("Defaults:\n%#v\n", v.defaults) +func Debug() { v.Debug() } +func DebugTo(w io.Writer) { v.DebugTo(w) } + +func (v *Viper) Debug() { v.DebugTo(os.Stdout) } + +func (v *Viper) DebugTo(w io.Writer) { + fmt.Fprintf(w, "Aliases:\n%#v\n", v.aliases) + fmt.Fprintf(w, "Override:\n%#v\n", v.override) + fmt.Fprintf(w, "PFlags:\n%#v\n", v.pflags) + fmt.Fprintf(w, "Env:\n%#v\n", v.env) + fmt.Fprintf(w, "Key/Value Store:\n%#v\n", v.kvstore) + fmt.Fprintf(w, "Config:\n%#v\n", v.config) + fmt.Fprintf(w, "Defaults:\n%#v\n", v.defaults) } diff --git a/vendor/github.com/subosito/gotenv/.gitignore b/vendor/github.com/subosito/gotenv/.gitignore index 2b8d45610..7db37c1db 100644 --- a/vendor/github.com/subosito/gotenv/.gitignore +++ b/vendor/github.com/subosito/gotenv/.gitignore @@ -1,3 +1,4 @@ *.test *.out annotate.json +profile.cov diff --git a/vendor/github.com/subosito/gotenv/.golangci.yaml b/vendor/github.com/subosito/gotenv/.golangci.yaml new file mode 100644 index 000000000..8c82a762e --- /dev/null +++ b/vendor/github.com/subosito/gotenv/.golangci.yaml @@ -0,0 +1,7 @@ +# Options for analysis running. +run: + timeout: 1m + +linters-settings: + gofmt: + simplify: true diff --git a/vendor/github.com/subosito/gotenv/.travis.yml b/vendor/github.com/subosito/gotenv/.travis.yml deleted file mode 100644 index 3370d5f40..000000000 --- a/vendor/github.com/subosito/gotenv/.travis.yml +++ /dev/null @@ -1,10 +0,0 @@ -language: go -go: - - 1.x -os: - - linux - - osx -script: - - go test -test.v -coverprofile=coverage.out -covermode=count -after_success: - - bash <(curl -s https://codecov.io/bash) diff --git a/vendor/github.com/subosito/gotenv/CHANGELOG.md b/vendor/github.com/subosito/gotenv/CHANGELOG.md index 67f687382..757caad26 100644 --- a/vendor/github.com/subosito/gotenv/CHANGELOG.md +++ b/vendor/github.com/subosito/gotenv/CHANGELOG.md @@ -1,5 +1,26 @@ # Changelog +## [1.4.0] - 2022-06-02 + +### Added + +- Add `Marshal` and `Unmarshal` helpers + +### Changed + +- The CI will now run a linter and the tests on PRs. + +## [1.3.0] - 2022-05-23 + +### Added + +- Support = within double-quoted strings +- Add support for multiline values + +### Changed + +- `OverLoad` prefer environment variables over local variables + ## [1.2.0] - 2019-08-03 ### Added @@ -30,7 +51,7 @@ ### Added - Supports carriage return in env -- Handle files with UTF-8 BOM +- Handle files with UTF-8 BOM ### Changed diff --git a/vendor/github.com/subosito/gotenv/README.md b/vendor/github.com/subosito/gotenv/README.md index d610cdf0b..fc9616e3b 100644 --- a/vendor/github.com/subosito/gotenv/README.md +++ b/vendor/github.com/subosito/gotenv/README.md @@ -1,12 +1,11 @@ # gotenv -[](https://travis-ci.org/subosito/gotenv) -[](https://ci.appveyor.com/project/subosito/gotenv/branch/master) +[](https://github.com/subosito/gotenv/actions) [](https://codecov.io/gh/subosito/gotenv) [](https://goreportcard.com/report/github.com/subosito/gotenv) [](https://godoc.org/github.com/subosito/gotenv) -Load environment variables dynamically in Go. +Load environment variables from `.env` or `io.Reader` in Go. ## Usage @@ -29,7 +28,7 @@ Once loaded you can use `os.Getenv()` to get the value of the variable. Let's say you have `.env` file: -``` +```sh APP_ID=1234567 APP_SECRET=abcdef ``` @@ -79,7 +78,6 @@ Besides above functions, `gotenv` also provides another functions that overrides - `gotenv.OverLoad` - `gotenv.OverApply` - Here's the example of this overrides behavior: ```go @@ -120,7 +118,7 @@ Just in case you want to parse environment variables from any `io.Reader`, goten pairs := gotenv.Parse(strings.NewReader("FOO=test\nBAR=$FOO")) // gotenv.Env{"FOO": "test", "BAR": "test"} -err, pairs = gotenv.StrictParse(strings.NewReader(`FOO="bar"`)) +pairs, err := gotenv.StrictParse(strings.NewReader(`FOO="bar"`)) // gotenv.Env{"FOO": "bar"} ``` diff --git a/vendor/github.com/subosito/gotenv/appveyor.yml b/vendor/github.com/subosito/gotenv/appveyor.yml deleted file mode 100644 index 33b4c4046..000000000 --- a/vendor/github.com/subosito/gotenv/appveyor.yml +++ /dev/null @@ -1,9 +0,0 @@ -build: off -clone_folder: c:\gopath\src\github.com\subosito\gotenv -environment: - GOPATH: c:\gopath -stack: go 1.10 -before_test: - - go get -t -test_script: - - go test -v -cover -race diff --git a/vendor/github.com/subosito/gotenv/gotenv.go b/vendor/github.com/subosito/gotenv/gotenv.go index 745a34489..7b1186e1f 100644 --- a/vendor/github.com/subosito/gotenv/gotenv.go +++ b/vendor/github.com/subosito/gotenv/gotenv.go @@ -6,7 +6,10 @@ import ( "fmt" "io" "os" + "path/filepath" "regexp" + "sort" + "strconv" "strings" ) @@ -16,46 +19,39 @@ const ( // Pattern for detecting valid variable within a value variablePattern = `(\\)?(\$)(\{?([A-Z0-9_]+)?\}?)` + + // Byte order mark character + bom = "\xef\xbb\xbf" ) // Env holds key/value pair of valid environment variable type Env map[string]string -/* -Load is a function to load a file or multiple files and then export the valid variables into environment variables if they do not exist. -When it's called with no argument, it will load `.env` file on the current path and set the environment variables. -Otherwise, it will loop over the filenames parameter and set the proper environment variables. -*/ +// Load is a function to load a file or multiple files and then export the valid variables into environment variables if they do not exist. +// When it's called with no argument, it will load `.env` file on the current path and set the environment variables. +// Otherwise, it will loop over the filenames parameter and set the proper environment variables. func Load(filenames ...string) error { return loadenv(false, filenames...) } -/* -OverLoad is a function to load a file or multiple files and then export and override the valid variables into environment variables. -*/ +// OverLoad is a function to load a file or multiple files and then export and override the valid variables into environment variables. func OverLoad(filenames ...string) error { return loadenv(true, filenames...) } -/* -Must is wrapper function that will panic when supplied function returns an error. -*/ +// Must is wrapper function that will panic when supplied function returns an error. func Must(fn func(filenames ...string) error, filenames ...string) { if err := fn(filenames...); err != nil { panic(err.Error()) } } -/* -Apply is a function to load an io Reader then export the valid variables into environment variables if they do not exist. -*/ +// Apply is a function to load an io Reader then export the valid variables into environment variables if they do not exist. func Apply(r io.Reader) error { return parset(r, false) } -/* -OverApply is a function to load an io Reader then export and override the valid variables into environment variables. -*/ +// OverApply is a function to load an io Reader then export and override the valid variables into environment variables. func OverApply(r io.Reader) error { return parset(r, true) } @@ -72,11 +68,10 @@ func loadenv(override bool, filenames ...string) error { } err = parset(f, override) + f.Close() if err != nil { return err } - - f.Close() } return nil @@ -84,7 +79,7 @@ func loadenv(override bool, filenames ...string) error { // parse and set :) func parset(r io.Reader, override bool) error { - env, err := StrictParse(r) + env, err := strictParse(r, override) if err != nil { return err } @@ -110,7 +105,7 @@ func setenv(key, val string, override bool) { // It expands the value of a variable from the environment variable but does not set the value to the environment itself. // This function is skipping any invalid lines and only processing the valid one. func Parse(r io.Reader) Env { - env, _ := StrictParse(r) + env, _ := strictParse(r, false) return env } @@ -118,22 +113,123 @@ func Parse(r io.Reader) Env { // It expands the value of a variable from the environment variable but does not set the value to the environment itself. // This function is returning an error if there are any invalid lines. func StrictParse(r io.Reader) (Env, error) { + return strictParse(r, false) +} + +// Read is a function to parse a file line by line and returns the valid Env key/value pair of valid variables. +// It expands the value of a variable from the environment variable but does not set the value to the environment itself. +// This function is skipping any invalid lines and only processing the valid one. +func Read(filename string) (Env, error) { + f, err := os.Open(filename) + if err != nil { + return nil, err + } + defer f.Close() + return strictParse(f, false) +} + +// Unmarshal reads a string line by line and returns the valid Env key/value pair of valid variables. +// It expands the value of a variable from the environment variable but does not set the value to the environment itself. +// This function is returning an error if there are any invalid lines. +func Unmarshal(str string) (Env, error) { + return strictParse(strings.NewReader(str), false) +} + +// Marshal outputs the given environment as a env file. +// Variables will be sorted by name. +func Marshal(env Env) (string, error) { + lines := make([]string, 0, len(env)) + for k, v := range env { + if d, err := strconv.Atoi(v); err == nil { + lines = append(lines, fmt.Sprintf(`%s=%d`, k, d)) + } else { + lines = append(lines, fmt.Sprintf(`%s=%q`, k, v)) + } + } + sort.Strings(lines) + return strings.Join(lines, "\n"), nil +} + +// Write serializes the given environment and writes it to a file +func Write(env Env, filename string) error { + content, err := Marshal(env) + if err != nil { + return err + } + // ensure the path exists + if err := os.MkdirAll(filepath.Dir(filename), 0o775); err != nil { + return err + } + // create or truncate the file + file, err := os.Create(filename) + if err != nil { + return err + } + defer file.Close() + _, err = file.WriteString(content + "\n") + if err != nil { + return err + } + + return file.Sync() +} + +func strictParse(r io.Reader, override bool) (Env, error) { env := make(Env) scanner := bufio.NewScanner(r) - i := 1 - bom := string([]byte{239, 187, 191}) + firstLine := true for scanner.Scan() { - line := scanner.Text() + line := strings.TrimSpace(scanner.Text()) - if i == 1 { + if firstLine { line = strings.TrimPrefix(line, bom) + firstLine = false + } + + if line == "" || line[0] == '#' { + continue + } + + quote := "" + // look for the delimiter character + idx := strings.Index(line, "=") + if idx == -1 { + idx = strings.Index(line, ":") + } + // look for a quote character + if idx > 0 && idx < len(line)-1 { + val := strings.TrimSpace(line[idx+1:]) + if val[0] == '"' || val[0] == '\'' { + quote = val[:1] + // look for the closing quote character within the same line + idx = strings.LastIndex(strings.TrimSpace(val[1:]), quote) + if idx >= 0 && val[idx] != '\\' { + quote = "" + } + } + } + // look for the closing quote character + for quote != "" && scanner.Scan() { + l := scanner.Text() + line += "\n" + l + idx := strings.LastIndex(l, quote) + if idx > 0 && l[idx-1] == '\\' { + // foud a matching quote character but it's escaped + continue + } + if idx >= 0 { + // foud a matching quote + quote = "" + } } - i++ + if quote != "" { + return env, fmt.Errorf("missing quotes") + } - err := parseLine(line, env) + err := parseLine(line, env, override) if err != nil { return env, err } @@ -142,47 +238,54 @@ func StrictParse(r io.Reader) (Env, error) { return env, nil } -func parseLine(s string, env Env) error { - rl := regexp.MustCompile(linePattern) - rm := rl.FindStringSubmatch(s) +var ( + lineRgx = regexp.MustCompile(linePattern) + unescapeRgx = regexp.MustCompile(`\\([^$])`) + varRgx = regexp.MustCompile(variablePattern) +) + +func parseLine(s string, env Env, override bool) error { + rm := lineRgx.FindStringSubmatch(s) if len(rm) == 0 { return checkFormat(s, env) } - key := rm[1] - val := rm[2] + key := strings.TrimSpace(rm[1]) + val := strings.TrimSpace(rm[2]) - // determine if string has quote prefix - hdq := strings.HasPrefix(val, `"`) + var hsq, hdq bool - // determine if string has single quote prefix - hsq := strings.HasPrefix(val, `'`) + // check if the value is quoted + if l := len(val); l >= 2 { + l -= 1 + // has double quotes + hdq = val[0] == '"' && val[l] == '"' + // has single quotes + hsq = val[0] == '\'' && val[l] == '\'' - // trim whitespace - val = strings.Trim(val, " ") - - // remove quotes '' or "" - rq := regexp.MustCompile(`\A(['"])(.*)(['"])\z`) - val = rq.ReplaceAllString(val, "$2") + // remove quotes '' or "" + if hsq || hdq { + val = val[1:l] + } + } if hdq { - val = strings.Replace(val, `\n`, "\n", -1) - val = strings.Replace(val, `\r`, "\r", -1) + val = strings.ReplaceAll(val, `\n`, "\n") + val = strings.ReplaceAll(val, `\r`, "\r") // Unescape all characters except $ so variables can be escaped properly - re := regexp.MustCompile(`\\([^$])`) - val = re.ReplaceAllString(val, "$1") + val = unescapeRgx.ReplaceAllString(val, "$1") } - rv := regexp.MustCompile(variablePattern) - fv := func(s string) string { - return varReplacement(s, hsq, env) + if !hsq { + fv := func(s string) string { + return varReplacement(s, hsq, env, override) + } + val = varRgx.ReplaceAllStringFunc(val, fv) + val = parseVal(val, env, hdq, override) } - val = rv.ReplaceAllStringFunc(val, fv) - val = parseVal(val, env) - env[key] = val return nil } @@ -201,18 +304,23 @@ func parseExport(st string, env Env) error { return nil } -func varReplacement(s string, hsq bool, env Env) string { - if strings.HasPrefix(s, "\\") { - return strings.TrimPrefix(s, "\\") +var varNameRgx = regexp.MustCompile(`(\$)(\{?([A-Z0-9_]+)\}?)`) + +func varReplacement(s string, hsq bool, env Env, override bool) string { + if s == "" { + return s + } + + if s[0] == '\\' { + // the dollar sign is escaped + return s[1:] } if hsq { return s } - sn := `(\$)(\{?([A-Z0-9_]+)\}?)` - rn := regexp.MustCompile(sn) - mn := rn.FindStringSubmatch(s) + mn := varNameRgx.FindStringSubmatch(s) if len(mn) == 0 { return s @@ -220,18 +328,21 @@ func varReplacement(s string, hsq bool, env Env) string { v := mn[3] - replace, ok := env[v] - if !ok { - replace = os.Getenv(v) + if replace, ok := os.LookupEnv(v); ok && !override { + return replace + } + + if replace, ok := env[v]; ok { + return replace } - return replace + return os.Getenv(v) } func checkFormat(s string, env Env) error { st := strings.TrimSpace(s) - if (st == "") || strings.HasPrefix(st, "#") { + if st == "" || st[0] == '#' { return nil } @@ -242,21 +353,14 @@ func checkFormat(s string, env Env) error { return fmt.Errorf("line `%s` doesn't match format", s) } -func parseVal(val string, env Env) string { - if strings.Contains(val, "=") { - if !(val == "\n" || val == "\r") { - kv := strings.Split(val, "\n") +func parseVal(val string, env Env, ignoreNewlines bool, override bool) string { + if strings.Contains(val, "=") && !ignoreNewlines { + kv := strings.Split(val, "\r") - if len(kv) == 1 { - kv = strings.Split(val, "\r") - } - - if len(kv) > 1 { - val = kv[0] - - for i := 1; i < len(kv); i++ { - parseLine(kv[i], env) - } + if len(kv) > 1 { + val = kv[0] + for _, l := range kv[1:] { + _ = parseLine(l, env, override) } } } diff --git a/vendor/github.com/tdewolff/minify/v2/.gitignore b/vendor/github.com/tdewolff/minify/v2/.gitignore index 341023d5e..68ba5e0bb 100644 --- a/vendor/github.com/tdewolff/minify/v2/.gitignore +++ b/vendor/github.com/tdewolff/minify/v2/.gitignore @@ -21,6 +21,8 @@ bindings/js/node_modules bindings/js/example/package-lock.json bindings/js/example/node_modules bindings/js/example/test.min.html +bindings/py/go.mod +bindings/py/go.sum bindings/py/minify.h bindings/py/minify.so bindings/py/tdewolff_minify.egg-info diff --git a/vendor/github.com/tdewolff/minify/v2/README.md b/vendor/github.com/tdewolff/minify/v2/README.md index 51917f776..d2bfff407 100644 --- a/vendor/github.com/tdewolff/minify/v2/README.md +++ b/vendor/github.com/tdewolff/minify/v2/README.md @@ -59,6 +59,7 @@ Please see https://www.patreon.com/tdewolff for ways to contribute, otherwise pl - [Custom minifier](#custom-minifier-example) - [ResponseWriter](#responsewriter) - [Templates](#templates) + - [FAQ](#faq) - [License](#license) ### Roadmap @@ -717,6 +718,14 @@ Example usage: templates := template.Must(compileTemplates("view.html", "home.html")) ``` +## FAQ +### Newlines remain in minified output +While you might expect the minified output to be on a single line for it to be fully minified, this is not true. In many cases, using a literal newline doesn't affect the file size, and in some cases it may even reduce the file size. + +A typical example is HTML. Whitespace is significant in HTML, meaning that spaces and newlines between or around tags may affect how they are displayed. There is no distinction between a space or a newline and they may be interchanged without affecting the displayed HTML. Remember that a space (0x20) and a newline (0x0A) are both one byte long, so that there is no difference in file size when interchanging them. This minifier removes unnecessary whitespace by replacing stretches of spaces and newlines by a single whitespace character. Specifically, if the stretch of white space characters contains a newline, it will replace it by a newline and otherwise by a space. This doesn't affect the file size, but may help somewhat for debugging or file transmission objectives. + +Another example is JavaScript. Single or double quoted string literals may not contain newline characters but instead need to escape them as `\n`. These are two bytes instead of a single newline byte. Using template literals it is allowed to have literal newline characters and we can use that fact to shave-off one byte! The result is that the minified output contains newlines instead of escaped newline characters, which makes the final file size smaller. Of course, changing from single or double quotes to template literals depends on other factors as well, and this minifier makes a calculation whether the template literal results in a shorter file size or not before converting a string literal. + ## License Released under the [MIT license](LICENSE.md). diff --git a/vendor/github.com/tdewolff/minify/v2/minify.go b/vendor/github.com/tdewolff/minify/v2/minify.go index db747e397..8e2e3fdb0 100644 --- a/vendor/github.com/tdewolff/minify/v2/minify.go +++ b/vendor/github.com/tdewolff/minify/v2/minify.go @@ -284,7 +284,7 @@ func (w *writer) Close() error { // Writer wraps a Writer interface and minifies the stream. // Errors from the minifier are returned by Close on the writer. // The writer must be closed explicitly. -func (m *M) Writer(mediatype string, w io.Writer) *writer { +func (m *M) Writer(mediatype string, w io.Writer) io.WriteCloser { pr, pw := io.Pipe() mw := &writer{pw, sync.WaitGroup{}, nil, false} mw.wg.Add(1) @@ -324,7 +324,7 @@ func (w *responseWriter) Write(b []byte) (int, error) { if mediatype := w.ResponseWriter.Header().Get("Content-Type"); mediatype != "" { w.mediatype = mediatype } - w.writer = w.m.Writer(w.mediatype, w.ResponseWriter) + w.writer = w.m.Writer(w.mediatype, w.ResponseWriter).(*writer) } return w.writer.Write(b) } diff --git a/vendor/github.com/uptrace/bun/CHANGELOG.md b/vendor/github.com/uptrace/bun/CHANGELOG.md index 1738c901a..5271a43ca 100644 --- a/vendor/github.com/uptrace/bun/CHANGELOG.md +++ b/vendor/github.com/uptrace/bun/CHANGELOG.md @@ -1,3 +1,25 @@ +## [1.1.8](https://github.com/uptrace/bun/compare/v1.1.7...v1.1.8) (2022-08-29) + + +### Bug Fixes + +* **bunotel:** handle option attributes ([#656](https://github.com/uptrace/bun/issues/656)) ([9f1e0bd](https://github.com/uptrace/bun/commit/9f1e0bd19fc0300f12996b3e6595f093024e06b6)) +* driver.Valuer returns itself causes stackoverflow ([c9f51d3](https://github.com/uptrace/bun/commit/c9f51d3e2dabed0c29c26a4221abbc426a7206f3)), closes [#657](https://github.com/uptrace/bun/issues/657) +* **pgdriver:** return FATAL and PANIC errors immediately ([4595e38](https://github.com/uptrace/bun/commit/4595e385d3706116e47bf9dc295186ec7a2ab0f9)) +* quote m2m table name fixes [#649](https://github.com/uptrace/bun/issues/649) ([61a634e](https://github.com/uptrace/bun/commit/61a634e4cd5c18df4b75f756d4b0f06ea94bc3c8)) +* support multi-level embed column ([177ec4c](https://github.com/uptrace/bun/commit/177ec4c6e04f92957614ad4724bc82c422649a4b)), closes [#643](https://github.com/uptrace/bun/issues/643) + + +### Features + +* conditions not supporting composite in ([e5d78d4](https://github.com/uptrace/bun/commit/e5d78d464b94b78438cf275b4c35f713d129961d)) +* **idb:** support raw query ([be4e688](https://github.com/uptrace/bun/commit/be4e6886ad94b4b6ca42f24f73d79a15b1ac3188)) +* **migrate:** add MissingMigrations ([42567d0](https://github.com/uptrace/bun/commit/42567d052280f2c412d4796df7178915e537e6d9)) +* **pgdriver:** implement database/sql/driver.SessionResetter ([bda298a](https://github.com/uptrace/bun/commit/bda298ac66305e5b00ba67d72d3973625930c6b9)) +* **pgdriver:** provide access to the underlying net.Conn ([d07ea0e](https://github.com/uptrace/bun/commit/d07ea0ed1541225b5f08e59a4c87383811f7f051)) + + + ## [1.1.7](https://github.com/uptrace/bun/compare/v1.1.6...v1.1.7) (2022-07-29) diff --git a/vendor/github.com/uptrace/bun/Makefile b/vendor/github.com/uptrace/bun/Makefile index 690958de0..4961a8abf 100644 --- a/vendor/github.com/uptrace/bun/Makefile +++ b/vendor/github.com/uptrace/bun/Makefile @@ -11,12 +11,12 @@ test: done go_mod_tidy: - go get -u && go mod tidy -go=1.17 + go get -u && go mod tidy -go=1.18 set -e; for dir in $(ALL_GO_MOD_DIRS); do \ echo "go mod tidy in $${dir}"; \ (cd "$${dir}" && \ go get -u ./... && \ - go mod tidy -go=1.17); \ + go mod tidy -go=1.18); \ done fmt: diff --git a/vendor/github.com/uptrace/bun/README.md b/vendor/github.com/uptrace/bun/README.md index 0d1c2c6c2..c5c264f6b 100644 --- a/vendor/github.com/uptrace/bun/README.md +++ b/vendor/github.com/uptrace/bun/README.md @@ -34,209 +34,24 @@ Resources: - [Reference](https://pkg.go.dev/github.com/uptrace/bun) - [Starter kit](https://github.com/go-bun/bun-starter-kit) -Projects using Bun: +Featured projects using Bun: +- [uptrace](https://github.com/uptrace/uptrace) - Distributed tracing and metrics. +- [paralus](https://github.com/paralus/paralus) - All-in-one Kubernetes access manager. +- [inovex/scrumlr.io](https://github.com/inovex/scrumlr.io) - Webapp for collaborative online + retrospectives. - [gotosocial](https://github.com/superseriousbusiness/gotosocial) - Golang fediverse server. -- [alexedwards/scs](https://github.com/alexedwards/scs) - HTTP Session Management for Go. +- [lorawan-stack](https://github.com/TheThingsNetwork/lorawan-stack) - The Things Stack, an Open + Source LoRaWAN Network Server. +- [anti-phishing-bot](https://github.com/Benricheson101/anti-phishing-bot) - Discord bot for + deleting Steam/Discord phishing links. - [emerald-web3-gateway](https://github.com/oasisprotocol/emerald-web3-gateway) - Web3 Gateway for the Oasis Emerald paratime. - [lndhub.go](https://github.com/getAlby/lndhub.go) - accounting wrapper for the Lightning Network. -- [RealWorld app](https://github.com/go-bun/bun-realworld-app) -- And hundreds more. - -## Benchmark - -[https://github.com/davars/dbeval](https://github.com/davars/dbeval) - -<details> -<summary>results</summary> - -``` -BenchmarkInsert -BenchmarkInsert/*dbeval.Memory/Authors -BenchmarkInsert/*dbeval.Memory/Authors-4 84450 12104 ns/op 2623 B/op 70 allocs/op -BenchmarkInsert/*dbeval.Xorm/Authors -BenchmarkInsert/*dbeval.Xorm/Authors-4 7291 153505 ns/op 9024 B/op 311 allocs/op -BenchmarkInsert/*dbeval.UpperDB/Authors -BenchmarkInsert/*dbeval.UpperDB/Authors-4 4608 223672 ns/op 24160 B/op 1100 allocs/op -BenchmarkInsert/*dbeval.Bun/Authors -BenchmarkInsert/*dbeval.Bun/Authors-4 6034 186439 ns/op 6818 B/op 80 allocs/op -BenchmarkInsert/*dbeval.PQ/Authors -BenchmarkInsert/*dbeval.PQ/Authors-4 1141 907494 ns/op 6487 B/op 193 allocs/op -BenchmarkInsert/*dbeval.SQLX/Authors -BenchmarkInsert/*dbeval.SQLX/Authors-4 1165 916987 ns/op 10089 B/op 271 allocs/op -BenchmarkInsert/*dbeval.Ozzo/Authors -BenchmarkInsert/*dbeval.Ozzo/Authors-4 1105 1058082 ns/op 27826 B/op 588 allocs/op -BenchmarkInsert/*dbeval.PGXStdlib/Authors -BenchmarkInsert/*dbeval.PGXStdlib/Authors-4 1228 900207 ns/op 6032 B/op 180 allocs/op -BenchmarkInsert/*dbeval.Gorm/Authors -BenchmarkInsert/*dbeval.Gorm/Authors-4 946 1184285 ns/op 35634 B/op 918 allocs/op -BenchmarkInsert/*dbeval.PGX/Authors -BenchmarkInsert/*dbeval.PGX/Authors-4 1116 923728 ns/op 3839 B/op 130 allocs/op -BenchmarkInsert/*dbeval.DBR/Authors -BenchmarkInsert/*dbeval.DBR/Authors-4 5800 183982 ns/op 8646 B/op 230 allocs/op -BenchmarkInsert/*dbeval.GoPG/Authors -BenchmarkInsert/*dbeval.GoPG/Authors-4 6110 173923 ns/op 2906 B/op 87 allocs/op - -BenchmarkInsert/*dbeval.DBR/Articles -BenchmarkInsert/*dbeval.DBR/Articles-4 1706 684466 ns/op 133346 B/op 1614 allocs/op -BenchmarkInsert/*dbeval.PQ/Articles -BenchmarkInsert/*dbeval.PQ/Articles-4 884 1249791 ns/op 100403 B/op 1491 allocs/op -BenchmarkInsert/*dbeval.PGX/Articles -BenchmarkInsert/*dbeval.PGX/Articles-4 916 1288143 ns/op 83539 B/op 1392 allocs/op -BenchmarkInsert/*dbeval.GoPG/Articles -BenchmarkInsert/*dbeval.GoPG/Articles-4 1726 622639 ns/op 78638 B/op 1359 allocs/op -BenchmarkInsert/*dbeval.SQLX/Articles -BenchmarkInsert/*dbeval.SQLX/Articles-4 860 1262599 ns/op 92030 B/op 1574 allocs/op -BenchmarkInsert/*dbeval.Gorm/Articles -BenchmarkInsert/*dbeval.Gorm/Articles-4 782 1421550 ns/op 136534 B/op 2411 allocs/op -BenchmarkInsert/*dbeval.PGXStdlib/Articles -BenchmarkInsert/*dbeval.PGXStdlib/Articles-4 938 1230576 ns/op 86743 B/op 1441 allocs/op -BenchmarkInsert/*dbeval.Bun/Articles -BenchmarkInsert/*dbeval.Bun/Articles-4 1843 626681 ns/op 101610 B/op 1323 allocs/op -BenchmarkInsert/*dbeval.Xorm/Articles -BenchmarkInsert/*dbeval.Xorm/Articles-4 1677 650244 ns/op 126677 B/op 1752 allocs/op -BenchmarkInsert/*dbeval.Memory/Articles -BenchmarkInsert/*dbeval.Memory/Articles-4 1988 1223308 ns/op 77576 B/op 1310 allocs/op -BenchmarkInsert/*dbeval.UpperDB/Articles -BenchmarkInsert/*dbeval.UpperDB/Articles-4 1696 687130 ns/op 139680 B/op 2862 allocs/op -BenchmarkInsert/*dbeval.Ozzo/Articles -BenchmarkInsert/*dbeval.Ozzo/Articles-4 697 1496859 ns/op 114780 B/op 1950 allocs/op - -BenchmarkFindAuthorByID -BenchmarkFindAuthorByID/*dbeval.UpperDB -BenchmarkFindAuthorByID/*dbeval.UpperDB-4 10184 117527 ns/op 9953 B/op 441 allocs/op -BenchmarkFindAuthorByID/*dbeval.Bun -BenchmarkFindAuthorByID/*dbeval.Bun-4 20716 54261 ns/op 5096 B/op 15 allocs/op -BenchmarkFindAuthorByID/*dbeval.Ozzo -BenchmarkFindAuthorByID/*dbeval.Ozzo-4 11166 91043 ns/op 3088 B/op 64 allocs/op -BenchmarkFindAuthorByID/*dbeval.PQ -BenchmarkFindAuthorByID/*dbeval.PQ-4 13875 86171 ns/op 844 B/op 24 allocs/op -BenchmarkFindAuthorByID/*dbeval.PGX -BenchmarkFindAuthorByID/*dbeval.PGX-4 13846 79983 ns/op 719 B/op 15 allocs/op -BenchmarkFindAuthorByID/*dbeval.Memory -BenchmarkFindAuthorByID/*dbeval.Memory-4 14113720 82.33 ns/op 0 B/op 0 allocs/op -BenchmarkFindAuthorByID/*dbeval.Xorm -BenchmarkFindAuthorByID/*dbeval.Xorm-4 12027 98519 ns/op 3633 B/op 106 allocs/op -BenchmarkFindAuthorByID/*dbeval.Gorm -BenchmarkFindAuthorByID/*dbeval.Gorm-4 11521 102241 ns/op 6592 B/op 143 allocs/op -BenchmarkFindAuthorByID/*dbeval.PGXStdlib -BenchmarkFindAuthorByID/*dbeval.PGXStdlib-4 13933 82626 ns/op 1174 B/op 28 allocs/op -BenchmarkFindAuthorByID/*dbeval.DBR -BenchmarkFindAuthorByID/*dbeval.DBR-4 21920 51175 ns/op 1756 B/op 39 allocs/op -BenchmarkFindAuthorByID/*dbeval.SQLX -BenchmarkFindAuthorByID/*dbeval.SQLX-4 13603 80788 ns/op 1327 B/op 32 allocs/op -BenchmarkFindAuthorByID/*dbeval.GoPG -BenchmarkFindAuthorByID/*dbeval.GoPG-4 23174 50042 ns/op 869 B/op 17 allocs/op - -BenchmarkFindAuthorByName -BenchmarkFindAuthorByName/*dbeval.SQLX -BenchmarkFindAuthorByName/*dbeval.SQLX-4 1070 1065272 ns/op 126348 B/op 4018 allocs/op -BenchmarkFindAuthorByName/*dbeval.Bun -BenchmarkFindAuthorByName/*dbeval.Bun-4 877 1231377 ns/op 115803 B/op 5005 allocs/op -BenchmarkFindAuthorByName/*dbeval.Xorm -BenchmarkFindAuthorByName/*dbeval.Xorm-4 471 2345445 ns/op 455711 B/op 19080 allocs/op -BenchmarkFindAuthorByName/*dbeval.DBR -BenchmarkFindAuthorByName/*dbeval.DBR-4 954 1089977 ns/op 120070 B/op 6023 allocs/op -BenchmarkFindAuthorByName/*dbeval.PQ -BenchmarkFindAuthorByName/*dbeval.PQ-4 1333 784400 ns/op 87159 B/op 4006 allocs/op -BenchmarkFindAuthorByName/*dbeval.GoPG -BenchmarkFindAuthorByName/*dbeval.GoPG-4 1580 770966 ns/op 87525 B/op 3028 allocs/op -BenchmarkFindAuthorByName/*dbeval.UpperDB -BenchmarkFindAuthorByName/*dbeval.UpperDB-4 789 1314164 ns/op 190689 B/op 6428 allocs/op -BenchmarkFindAuthorByName/*dbeval.Ozzo -BenchmarkFindAuthorByName/*dbeval.Ozzo-4 948 1255282 ns/op 238764 B/op 6053 allocs/op -BenchmarkFindAuthorByName/*dbeval.PGXStdlib -BenchmarkFindAuthorByName/*dbeval.PGXStdlib-4 1279 920391 ns/op 126163 B/op 4014 allocs/op -BenchmarkFindAuthorByName/*dbeval.PGX -BenchmarkFindAuthorByName/*dbeval.PGX-4 1364 780970 ns/op 101967 B/op 2028 allocs/op -BenchmarkFindAuthorByName/*dbeval.Gorm -BenchmarkFindAuthorByName/*dbeval.Gorm-4 340 3445818 ns/op 1573637 B/op 27102 allocs/op -BenchmarkFindAuthorByName/*dbeval.Memory -BenchmarkFindAuthorByName/*dbeval.Memory-4 38081223 31.24 ns/op 0 B/op 0 allocs/op - -BenchmarkRecentArticles -BenchmarkRecentArticles/*dbeval.PGXStdlib -BenchmarkRecentArticles/*dbeval.PGXStdlib-4 358 3344119 ns/op 3425578 B/op 14177 allocs/op -BenchmarkRecentArticles/*dbeval.GoPG -BenchmarkRecentArticles/*dbeval.GoPG-4 364 3156372 ns/op 1794091 B/op 10032 allocs/op -BenchmarkRecentArticles/*dbeval.Xorm -BenchmarkRecentArticles/*dbeval.Xorm-4 157 7567835 ns/op 5018011 B/op 81425 allocs/op -BenchmarkRecentArticles/*dbeval.Gorm -BenchmarkRecentArticles/*dbeval.Gorm-4 139 7980084 ns/op 6776277 B/op 85418 allocs/op -BenchmarkRecentArticles/*dbeval.SQLX -BenchmarkRecentArticles/*dbeval.SQLX-4 338 3289802 ns/op 3425890 B/op 14181 allocs/op -BenchmarkRecentArticles/*dbeval.Ozzo -BenchmarkRecentArticles/*dbeval.Ozzo-4 320 3508322 ns/op 4025966 B/op 18207 allocs/op -BenchmarkRecentArticles/*dbeval.DBR -BenchmarkRecentArticles/*dbeval.DBR-4 237 5248644 ns/op 3331003 B/op 21370 allocs/op -BenchmarkRecentArticles/*dbeval.Bun -BenchmarkRecentArticles/*dbeval.Bun-4 280 4528582 ns/op 1864362 B/op 15965 allocs/op -BenchmarkRecentArticles/*dbeval.UpperDB -BenchmarkRecentArticles/*dbeval.UpperDB-4 297 3704663 ns/op 3607287 B/op 18542 allocs/op -BenchmarkRecentArticles/*dbeval.PQ -BenchmarkRecentArticles/*dbeval.PQ-4 308 3489229 ns/op 3277050 B/op 17359 allocs/op -BenchmarkRecentArticles/*dbeval.Memory -BenchmarkRecentArticles/*dbeval.Memory-4 29590380 42.27 ns/op 0 B/op 0 allocs/op -BenchmarkRecentArticles/*dbeval.PGX -BenchmarkRecentArticles/*dbeval.PGX-4 356 3345500 ns/op 3297316 B/op 6226 allocs/op -``` - -</details> - -[https://github.com/frederikhors/orm-benchmark](https://github.com/frederikhors/orm-benchmark) - -<details> -<summary>results</summary> - -``` - 4000 times - Insert - raw_stmt: 0.38s 94280 ns/op 718 B/op 14 allocs/op - raw: 0.39s 96719 ns/op 718 B/op 13 allocs/op - beego_orm: 0.48s 118994 ns/op 2411 B/op 56 allocs/op - bun: 0.57s 142285 ns/op 918 B/op 12 allocs/op - pg: 0.58s 145496 ns/op 1235 B/op 12 allocs/op - gorm: 0.70s 175294 ns/op 6665 B/op 88 allocs/op - xorm: 0.76s 189533 ns/op 3032 B/op 94 allocs/op - - 4000 times - MultiInsert 100 row - raw: 4.59s 1147385 ns/op 135155 B/op 916 allocs/op - raw_stmt: 4.59s 1148137 ns/op 131076 B/op 916 allocs/op - beego_orm: 5.50s 1375637 ns/op 179962 B/op 2747 allocs/op - bun: 6.18s 1544648 ns/op 4265 B/op 214 allocs/op - pg: 7.01s 1753495 ns/op 5039 B/op 114 allocs/op - gorm: 9.52s 2379219 ns/op 293956 B/op 3729 allocs/op - xorm: 11.66s 2915478 ns/op 286140 B/op 7422 allocs/op - - 4000 times - Update - raw_stmt: 0.26s 65781 ns/op 773 B/op 14 allocs/op - raw: 0.31s 77209 ns/op 757 B/op 13 allocs/op - beego_orm: 0.43s 107064 ns/op 1802 B/op 47 allocs/op - bun: 0.56s 139839 ns/op 589 B/op 4 allocs/op - pg: 0.60s 149608 ns/op 896 B/op 11 allocs/op - gorm: 0.74s 185970 ns/op 6604 B/op 81 allocs/op - xorm: 0.81s 203240 ns/op 2994 B/op 119 allocs/op - - 4000 times - Read - raw: 0.33s 81671 ns/op 2081 B/op 49 allocs/op - raw_stmt: 0.34s 85847 ns/op 2112 B/op 50 allocs/op - beego_orm: 0.38s 94777 ns/op 2106 B/op 75 allocs/op - pg: 0.42s 106148 ns/op 1526 B/op 22 allocs/op - bun: 0.43s 106904 ns/op 1319 B/op 18 allocs/op - gorm: 0.65s 162221 ns/op 5240 B/op 108 allocs/op - xorm: 1.13s 281738 ns/op 8326 B/op 237 allocs/op - - 4000 times - MultiRead limit 100 - raw: 1.52s 380351 ns/op 38356 B/op 1037 allocs/op - raw_stmt: 1.54s 385541 ns/op 38388 B/op 1038 allocs/op - pg: 1.86s 465468 ns/op 24045 B/op 631 allocs/op - bun: 2.58s 645354 ns/op 30009 B/op 1122 allocs/op - beego_orm: 2.93s 732028 ns/op 55280 B/op 3077 allocs/op - gorm: 4.97s 1241831 ns/op 71628 B/op 3877 allocs/op - xorm: doesn't work -``` - -</details> +- [penguin-statistics](https://github.com/penguin-statistics/backend-next) - Penguin Statistics v3 + Backend. +- And + [hundreds more](https://github.com/uptrace/bun/network/dependents?package_id=UGFja2FnZS0yMjkxOTc4OTA4). ## Why another database client? diff --git a/vendor/github.com/uptrace/bun/db.go b/vendor/github.com/uptrace/bun/db.go index 47e654655..9b8e391dc 100644 --- a/vendor/github.com/uptrace/bun/db.go +++ b/vendor/github.com/uptrace/bun/db.go @@ -98,6 +98,10 @@ func (db *DB) NewDelete() *DeleteQuery { return NewDeleteQuery(db) } +func (db *DB) NewRaw(query string, args ...interface{}) *RawQuery { + return NewRawQuery(db, query, args...) +} + func (db *DB) NewCreateTable() *CreateTableQuery { return NewCreateTableQuery(db) } @@ -342,6 +346,10 @@ func (c Conn) NewDelete() *DeleteQuery { return NewDeleteQuery(c.db).Conn(c) } +func (c Conn) NewRaw(query string, args ...interface{}) *RawQuery { + return NewRawQuery(c.db, query, args...).Conn(c) +} + func (c Conn) NewCreateTable() *CreateTableQuery { return NewCreateTableQuery(c.db).Conn(c) } @@ -648,6 +656,10 @@ func (tx Tx) NewDelete() *DeleteQuery { return NewDeleteQuery(tx.db).Conn(tx) } +func (tx Tx) NewRaw(query string, args ...interface{}) *RawQuery { + return NewRawQuery(tx.db, query, args...).Conn(tx) +} + func (tx Tx) NewCreateTable() *CreateTableQuery { return NewCreateTableQuery(tx.db).Conn(tx) } diff --git a/vendor/github.com/uptrace/bun/dialect/feature/feature.go b/vendor/github.com/uptrace/bun/dialect/feature/feature.go index 956dc4985..e311394d5 100644 --- a/vendor/github.com/uptrace/bun/dialect/feature/feature.go +++ b/vendor/github.com/uptrace/bun/dialect/feature/feature.go @@ -31,4 +31,5 @@ const ( UpdateFromTable MSSavepoint GeneratedIdentity + CompositeIn // ... WHERE (A,B) IN ((N, NN), (N, NN)...) ) diff --git a/vendor/github.com/uptrace/bun/dialect/pgdialect/dialect.go b/vendor/github.com/uptrace/bun/dialect/pgdialect/dialect.go index d524f0a1a..6ff85e166 100644 --- a/vendor/github.com/uptrace/bun/dialect/pgdialect/dialect.go +++ b/vendor/github.com/uptrace/bun/dialect/pgdialect/dialect.go @@ -47,7 +47,8 @@ func New() *Dialect { feature.TableNotExists | feature.InsertOnConflict | feature.SelectExists | - feature.GeneratedIdentity + feature.GeneratedIdentity | + feature.CompositeIn return d } diff --git a/vendor/github.com/uptrace/bun/dialect/pgdialect/version.go b/vendor/github.com/uptrace/bun/dialect/pgdialect/version.go index 8ab18b7a7..60837dd40 100644 --- a/vendor/github.com/uptrace/bun/dialect/pgdialect/version.go +++ b/vendor/github.com/uptrace/bun/dialect/pgdialect/version.go @@ -2,5 +2,5 @@ package pgdialect // Version is the current release version. func Version() string { - return "1.1.7" + return "1.1.8" } diff --git a/vendor/github.com/uptrace/bun/dialect/sqlitedialect/dialect.go b/vendor/github.com/uptrace/bun/dialect/sqlitedialect/dialect.go index e79dcb004..720e979f5 100644 --- a/vendor/github.com/uptrace/bun/dialect/sqlitedialect/dialect.go +++ b/vendor/github.com/uptrace/bun/dialect/sqlitedialect/dialect.go @@ -38,7 +38,8 @@ func New() *Dialect { feature.DeleteTableAlias | feature.InsertOnConflict | feature.TableNotExists | - feature.SelectExists + feature.SelectExists | + feature.CompositeIn return d } diff --git a/vendor/github.com/uptrace/bun/dialect/sqlitedialect/version.go b/vendor/github.com/uptrace/bun/dialect/sqlitedialect/version.go index 8f9def8d0..af57055cf 100644 --- a/vendor/github.com/uptrace/bun/dialect/sqlitedialect/version.go +++ b/vendor/github.com/uptrace/bun/dialect/sqlitedialect/version.go @@ -2,5 +2,5 @@ package sqlitedialect // Version is the current release version. func Version() string { - return "1.1.7" + return "1.1.8" } diff --git a/vendor/github.com/uptrace/bun/migrate/migration.go b/vendor/github.com/uptrace/bun/migrate/migration.go index ae649446d..a581098a3 100644 --- a/vendor/github.com/uptrace/bun/migrate/migration.go +++ b/vendor/github.com/uptrace/bun/migrate/migration.go @@ -18,6 +18,7 @@ type Migration struct { ID int64 `bun:",pk,autoincrement"` Name string + Comment string `bun:"-"` GroupID int64 MigratedAt time.Time `bun:",notnull,nullzero,default:current_timestamp"` @@ -26,7 +27,7 @@ type Migration struct { } func (m Migration) String() string { - return m.Name + return fmt.Sprintf("%s_%s", m.Name, m.Comment) } func (m Migration) IsApplied() bool { diff --git a/vendor/github.com/uptrace/bun/migrate/migrations.go b/vendor/github.com/uptrace/bun/migrate/migrations.go index 9af861048..0e26a09cc 100644 --- a/vendor/github.com/uptrace/bun/migrate/migrations.go +++ b/vendor/github.com/uptrace/bun/migrate/migrations.go @@ -50,15 +50,16 @@ func (m *Migrations) MustRegister(up, down MigrationFunc) { func (m *Migrations) Register(up, down MigrationFunc) error { fpath := migrationFile() - name, err := extractMigrationName(fpath) + name, comment, err := extractMigrationName(fpath) if err != nil { return err } m.Add(Migration{ - Name: name, - Up: up, - Down: down, + Name: name, + Comment: comment, + Up: up, + Down: down, }) return nil @@ -89,7 +90,7 @@ func (m *Migrations) Discover(fsys fs.FS) error { return nil } - name, err := extractMigrationName(path) + name, comment, err := extractMigrationName(path) if err != nil { return err } @@ -98,6 +99,8 @@ func (m *Migrations) Discover(fsys fs.FS) error { if err != nil { return err } + + migration.Comment = comment migrationFunc := NewSQLMigrationFunc(fsys, path) if strings.HasSuffix(path, ".up.sql") { @@ -154,15 +157,15 @@ func migrationFile() string { return "" } -var fnameRE = regexp.MustCompile(`^(\d{14})_[0-9a-z_\-]+\.`) +var fnameRE = regexp.MustCompile(`^(\d{14})_([0-9a-z_\-]+)\.`) -func extractMigrationName(fpath string) (string, error) { +func extractMigrationName(fpath string) (string, string, error) { fname := filepath.Base(fpath) matches := fnameRE.FindStringSubmatch(fname) if matches == nil { - return "", fmt.Errorf("migrate: unsupported migration name format: %q", fname) + return "", "", fmt.Errorf("migrate: unsupported migration name format: %q", fname) } - return matches[1], nil + return matches[1], matches[2], nil } diff --git a/vendor/github.com/uptrace/bun/migrate/migrator.go b/vendor/github.com/uptrace/bun/migrate/migrator.go index d0efca2fc..98d8f434e 100644 --- a/vendor/github.com/uptrace/bun/migrate/migrator.go +++ b/vendor/github.com/uptrace/bun/migrate/migrator.go @@ -74,7 +74,7 @@ func (m *Migrator) MigrationsWithStatus(ctx context.Context) (MigrationSlice, er func (m *Migrator) migrationsWithStatus(ctx context.Context) (MigrationSlice, int64, error) { sorted := m.migrations.Sorted() - applied, err := m.selectAppliedMigrations(ctx) + applied, err := m.AppliedMigrations(ctx) if err != nil { return nil, 0, err } @@ -338,8 +338,31 @@ func (m *Migrator) MarkUnapplied(ctx context.Context, migration *Migration) erro return err } -// selectAppliedMigrations selects applied (applied) migrations in descending order. -func (m *Migrator) selectAppliedMigrations(ctx context.Context) (MigrationSlice, error) { +func (m *Migrator) TruncateTable(ctx context.Context) error { + _, err := m.db.NewTruncateTable().TableExpr(m.table).Exec(ctx) + return err +} + +// MissingMigrations returns applied migrations that can no longer be found. +func (m *Migrator) MissingMigrations(ctx context.Context) (MigrationSlice, error) { + applied, err := m.AppliedMigrations(ctx) + if err != nil { + return nil, err + } + + existing := migrationMap(m.migrations.ms) + for i := len(applied) - 1; i >= 0; i-- { + m := &applied[i] + if _, ok := existing[m.Name]; ok { + applied = append(applied[:i], applied[i+1:]...) + } + } + + return applied, nil +} + +// AppliedMigrations selects applied (applied) migrations in descending order. +func (m *Migrator) AppliedMigrations(ctx context.Context) (MigrationSlice, error) { var ms MigrationSlice if err := m.db.NewSelect(). ColumnExpr("*"). diff --git a/vendor/github.com/uptrace/bun/package.json b/vendor/github.com/uptrace/bun/package.json index 9428ddcd5..de5f45a6a 100644 --- a/vendor/github.com/uptrace/bun/package.json +++ b/vendor/github.com/uptrace/bun/package.json @@ -1,6 +1,6 @@ { "name": "gobun", - "version": "1.1.7", + "version": "1.1.8", "main": "index.js", "repository": "git@github.com:uptrace/bun.git", "author": "Vladimir Mihailenco <vladimir.webdev@gmail.com>", diff --git a/vendor/github.com/uptrace/bun/query_base.go b/vendor/github.com/uptrace/bun/query_base.go index 45b77f028..b140ca24d 100644 --- a/vendor/github.com/uptrace/bun/query_base.go +++ b/vendor/github.com/uptrace/bun/query_base.go @@ -50,6 +50,7 @@ type IDB interface { NewInsert() *InsertQuery NewUpdate() *UpdateQuery NewDelete() *DeleteQuery + NewRaw(query string, args ...interface{}) *RawQuery NewCreateTable() *CreateTableQuery NewDropTable() *DropTableQuery NewCreateIndex() *CreateIndexQuery @@ -649,6 +650,10 @@ func (q *baseQuery) NewDelete() *DeleteQuery { return NewDeleteQuery(q.db).Conn(q.conn) } +func (q *baseQuery) NewRaw(query string, args ...interface{}) *RawQuery { + return NewRawQuery(q.db, query, args...).Conn(q.conn) +} + func (q *baseQuery) NewCreateTable() *CreateTableQuery { return NewCreateTableQuery(q.db).Conn(q.conn) } diff --git a/vendor/github.com/uptrace/bun/query_raw.go b/vendor/github.com/uptrace/bun/query_raw.go index 30ae77508..afbe12130 100644 --- a/vendor/github.com/uptrace/bun/query_raw.go +++ b/vendor/github.com/uptrace/bun/query_raw.go @@ -13,6 +13,7 @@ type RawQuery struct { args []interface{} } +// Deprecated: Use NewRaw instead. When add it to IDB, it conflicts with the sql.Conn#Raw func (db *DB) Raw(query string, args ...interface{}) *RawQuery { return &RawQuery{ baseQuery: baseQuery{ @@ -24,6 +25,22 @@ func (db *DB) Raw(query string, args ...interface{}) *RawQuery { } } +func NewRawQuery(db *DB, query string, args ...interface{}) *RawQuery { + return &RawQuery{ + baseQuery: baseQuery{ + db: db, + conn: db.DB, + }, + query: query, + args: args, + } +} + +func (q *RawQuery) Conn(db IConn) *RawQuery { + q.setConn(db) + return q +} + func (q *RawQuery) Scan(ctx context.Context, dest ...interface{}) error { if q.err != nil { return q.err diff --git a/vendor/github.com/uptrace/bun/relation_join.go b/vendor/github.com/uptrace/bun/relation_join.go index e8074e0c6..19dda774e 100644 --- a/vendor/github.com/uptrace/bun/relation_join.go +++ b/vendor/github.com/uptrace/bun/relation_join.go @@ -4,6 +4,7 @@ import ( "context" "reflect" + "github.com/uptrace/bun/dialect/feature" "github.com/uptrace/bun/internal" "github.com/uptrace/bun/schema" ) @@ -60,6 +61,14 @@ func (j *relationJoin) manyQuery(q *SelectQuery) *SelectQuery { q = q.Model(hasManyModel) var where []byte + + if q.db.dialect.Features().Has(feature.CompositeIn) { + return j.manyQueryCompositeIn(where, q) + } + return j.manyQueryMulti(where, q) +} + +func (j *relationJoin) manyQueryCompositeIn(where []byte, q *SelectQuery) *SelectQuery { if len(j.Relation.JoinFields) > 1 { where = append(where, '(') } @@ -88,6 +97,29 @@ func (j *relationJoin) manyQuery(q *SelectQuery) *SelectQuery { return q } +func (j *relationJoin) manyQueryMulti(where []byte, q *SelectQuery) *SelectQuery { + where = appendMultiValues( + q.db.Formatter(), + where, + j.JoinModel.rootValue(), + j.JoinModel.parentIndex(), + j.Relation.BaseFields, + j.Relation.JoinFields, + j.JoinModel.Table().SQLAlias, + ) + + q = q.Where(internal.String(where)) + + if j.Relation.PolymorphicField != nil { + q = q.Where("? = ?", j.Relation.PolymorphicField.SQLName, j.Relation.PolymorphicValue) + } + + j.applyTo(q) + q = q.Apply(j.hasManyColumns) + + return q +} + func (j *relationJoin) hasManyColumns(q *SelectQuery) *SelectQuery { b := make([]byte, 0, 32) @@ -151,7 +183,7 @@ func (j *relationJoin) m2mQuery(q *SelectQuery) *SelectQuery { //nolint var join []byte join = append(join, "JOIN "...) - join = fmter.AppendQuery(join, string(j.Relation.M2MTable.Name)) + join = fmter.AppendQuery(join, string(j.Relation.M2MTable.SQLName)) join = append(join, " AS "...) join = append(join, j.Relation.M2MTable.SQLAlias...) join = append(join, " ON ("...) @@ -312,3 +344,55 @@ func appendChildValues( } return b } + +// appendMultiValues is an alternative to appendChildValues that doesn't use the sql keyword ID +// but instead use a old style ((k1=v1) AND (k2=v2)) OR (...) of conditions. +func appendMultiValues( + fmter schema.Formatter, b []byte, v reflect.Value, index []int, baseFields, joinFields []*schema.Field, joinTable schema.Safe, +) []byte { + // This is based on a mix of appendChildValues and query_base.appendColumns + + // These should never missmatch in length but nice to know if it does + if len(joinFields) != len(baseFields) { + panic("not reached") + } + + // walk the relations + b = append(b, '(') + seen := make(map[string]struct{}) + walk(v, index, func(v reflect.Value) { + start := len(b) + for i, f := range baseFields { + if i > 0 { + b = append(b, " AND "...) + } + if len(baseFields) > 1 { + b = append(b, '(') + } + // Field name + b = append(b, joinTable...) + b = append(b, '.') + b = append(b, []byte(joinFields[i].SQLName)...) + + // Equals value + b = append(b, '=') + b = f.AppendValue(fmter, b, v) + if len(baseFields) > 1 { + b = append(b, ')') + } + } + + b = append(b, ") OR ("...) + + if _, ok := seen[string(b[start:])]; ok { + b = b[:start] + } else { + seen[string(b[start:])] = struct{}{} + } + }) + if len(seen) > 0 { + b = b[:len(b)-6] // trim ") OR (" + } + b = append(b, ')') + return b +} diff --git a/vendor/github.com/uptrace/bun/schema/append_value.go b/vendor/github.com/uptrace/bun/schema/append_value.go index 7e9c451db..93c892082 100644 --- a/vendor/github.com/uptrace/bun/schema/append_value.go +++ b/vendor/github.com/uptrace/bun/schema/append_value.go @@ -274,6 +274,9 @@ func appendDriverValue(fmter Formatter, b []byte, v reflect.Value) []byte { if err != nil { return dialect.AppendError(b, err) } + if _, ok := value.(driver.Valuer); ok { + return dialect.AppendError(b, fmt.Errorf("driver.Valuer returns unsupported type %T", value)) + } return Append(fmter, b, value) } diff --git a/vendor/github.com/uptrace/bun/schema/table.go b/vendor/github.com/uptrace/bun/schema/table.go index 9791f8ff1..ed8c517c1 100644 --- a/vendor/github.com/uptrace/bun/schema/table.go +++ b/vendor/github.com/uptrace/bun/schema/table.go @@ -287,17 +287,17 @@ func (t *Table) processBaseModelField(f reflect.StructField) { } } -//nolint +// nolint func (t *Table) newField(f reflect.StructField, prefix string, index []int) *Field { tag := tagparser.Parse(f.Tag.Get("bun")) - if prefix, ok := tag.Option("embed"); ok { + if nextPrefix, ok := tag.Option("embed"); ok { fieldType := indirectType(f.Type) if fieldType.Kind() != reflect.Struct { panic(fmt.Errorf("bun: embed %s.%s: got %s, wanted reflect.Struct", t.TypeName, f.Name, fieldType.Kind())) } - t.addFields(fieldType, prefix, withIndex(index, f.Index)) + t.addFields(fieldType, prefix+nextPrefix, withIndex(index, f.Index)) return nil } diff --git a/vendor/github.com/uptrace/bun/version.go b/vendor/github.com/uptrace/bun/version.go index 8d17c97b3..a9b3897c5 100644 --- a/vendor/github.com/uptrace/bun/version.go +++ b/vendor/github.com/uptrace/bun/version.go @@ -2,5 +2,5 @@ package bun // Version is the current release version. func Version() string { - return "1.1.7" + return "1.1.8" } |