diff options
Diffstat (limited to 'vendor/github.com/twitchyliquid64/golang-asm/objabi')
14 files changed, 0 insertions, 1300 deletions
diff --git a/vendor/github.com/twitchyliquid64/golang-asm/objabi/autotype.go b/vendor/github.com/twitchyliquid64/golang-asm/objabi/autotype.go deleted file mode 100644 index f9d17a3b9..000000000 --- a/vendor/github.com/twitchyliquid64/golang-asm/objabi/autotype.go +++ /dev/null @@ -1,38 +0,0 @@ -// Derived from Inferno utils/6l/l.h and related files. -// https://bitbucket.org/inferno-os/inferno-os/src/master/utils/6l/l.h -// -// Copyright © 1994-1999 Lucent Technologies Inc. All rights reserved. -// Portions Copyright © 1995-1997 C H Forsyth (forsyth@terzarima.net) -// Portions Copyright © 1997-1999 Vita Nuova Limited -// Portions Copyright © 2000-2007 Vita Nuova Holdings Limited (www.vitanuova.com) -// Portions Copyright © 2004,2006 Bruce Ellis -// Portions Copyright © 2005-2007 C H Forsyth (forsyth@terzarima.net) -// Revisions Copyright © 2000-2007 Lucent Technologies Inc. and others -// Portions Copyright © 2009 The Go Authors. All rights reserved. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package objabi - -// Auto.name -const ( - A_AUTO = 1 + iota - A_PARAM - A_DELETED_AUTO -) diff --git a/vendor/github.com/twitchyliquid64/golang-asm/objabi/flag.go b/vendor/github.com/twitchyliquid64/golang-asm/objabi/flag.go deleted file mode 100644 index 79ad2ccf7..000000000 --- a/vendor/github.com/twitchyliquid64/golang-asm/objabi/flag.go +++ /dev/null @@ -1,162 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package objabi - -import ( - "flag" - "fmt" - "io" - "io/ioutil" - "log" - "os" - "strconv" - "strings" -) - -func Flagcount(name, usage string, val *int) { - flag.Var((*count)(val), name, usage) -} - -func Flagfn1(name, usage string, f func(string)) { - flag.Var(fn1(f), name, usage) -} - -func Flagprint(w io.Writer) { - flag.CommandLine.SetOutput(w) - flag.PrintDefaults() -} - -func Flagparse(usage func()) { - flag.Usage = usage - os.Args = expandArgs(os.Args) - flag.Parse() -} - -// expandArgs expands "response files" arguments in the provided slice. -// -// A "response file" argument starts with '@' and the rest of that -// argument is a filename with CR-or-CRLF-separated arguments. Each -// argument in the named files can also contain response file -// arguments. See Issue 18468. -// -// The returned slice 'out' aliases 'in' iff the input did not contain -// any response file arguments. -// -// TODO: handle relative paths of recursive expansions in different directories? -// Is there a spec for this? Are relative paths allowed? -func expandArgs(in []string) (out []string) { - // out is nil until we see a "@" argument. - for i, s := range in { - if strings.HasPrefix(s, "@") { - if out == nil { - out = make([]string, 0, len(in)*2) - out = append(out, in[:i]...) - } - slurp, err := ioutil.ReadFile(s[1:]) - if err != nil { - log.Fatal(err) - } - args := strings.Split(strings.TrimSpace(strings.Replace(string(slurp), "\r", "", -1)), "\n") - out = append(out, expandArgs(args)...) - } else if out != nil { - out = append(out, s) - } - } - if out == nil { - return in - } - return -} - -func AddVersionFlag() { - flag.Var(versionFlag{}, "V", "print version and exit") -} - -var buildID string // filled in by linker - -type versionFlag struct{} - -func (versionFlag) IsBoolFlag() bool { return true } -func (versionFlag) Get() interface{} { return nil } -func (versionFlag) String() string { return "" } -func (versionFlag) Set(s string) error { - name := os.Args[0] - name = name[strings.LastIndex(name, `/`)+1:] - name = name[strings.LastIndex(name, `\`)+1:] - name = strings.TrimSuffix(name, ".exe") - - // If there's an active experiment, include that, - // to distinguish go1.10.2 with an experiment - // from go1.10.2 without an experiment. - p := Expstring() - if p == DefaultExpstring() { - p = "" - } - sep := "" - if p != "" { - sep = " " - } - - // The go command invokes -V=full to get a unique identifier - // for this tool. It is assumed that the release version is sufficient - // for releases, but during development we include the full - // build ID of the binary, so that if the compiler is changed and - // rebuilt, we notice and rebuild all packages. - if s == "full" { - if strings.HasPrefix(Version, "devel") { - p += " buildID=" + buildID - } - } - - fmt.Printf("%s version %s%s%s\n", name, Version, sep, p) - os.Exit(0) - return nil -} - -// count is a flag.Value that is like a flag.Bool and a flag.Int. -// If used as -name, it increments the count, but -name=x sets the count. -// Used for verbose flag -v. -type count int - -func (c *count) String() string { - return fmt.Sprint(int(*c)) -} - -func (c *count) Set(s string) error { - switch s { - case "true": - *c++ - case "false": - *c = 0 - default: - n, err := strconv.Atoi(s) - if err != nil { - return fmt.Errorf("invalid count %q", s) - } - *c = count(n) - } - return nil -} - -func (c *count) Get() interface{} { - return int(*c) -} - -func (c *count) IsBoolFlag() bool { - return true -} - -func (c *count) IsCountFlag() bool { - return true -} - -type fn1 func(string) - -func (f fn1) Set(s string) error { - f(s) - return nil -} - -func (f fn1) String() string { return "" } diff --git a/vendor/github.com/twitchyliquid64/golang-asm/objabi/funcdata.go b/vendor/github.com/twitchyliquid64/golang-asm/objabi/funcdata.go deleted file mode 100644 index c9480bf2f..000000000 --- a/vendor/github.com/twitchyliquid64/golang-asm/objabi/funcdata.go +++ /dev/null @@ -1,54 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package objabi - -// This file defines the IDs for PCDATA and FUNCDATA instructions -// in Go binaries. -// -// These must agree with ../../../runtime/funcdata.h and -// ../../../runtime/symtab.go. - -const ( - PCDATA_RegMapIndex = 0 // if !go115ReduceLiveness - PCDATA_UnsafePoint = 0 // if go115ReduceLiveness - PCDATA_StackMapIndex = 1 - PCDATA_InlTreeIndex = 2 - - FUNCDATA_ArgsPointerMaps = 0 - FUNCDATA_LocalsPointerMaps = 1 - FUNCDATA_RegPointerMaps = 2 // if !go115ReduceLiveness - FUNCDATA_StackObjects = 3 - FUNCDATA_InlTree = 4 - FUNCDATA_OpenCodedDeferInfo = 5 - - // ArgsSizeUnknown is set in Func.argsize to mark all functions - // whose argument size is unknown (C vararg functions, and - // assembly code without an explicit specification). - // This value is generated by the compiler, assembler, or linker. - ArgsSizeUnknown = -0x80000000 -) - -// Special PCDATA values. -const ( - // PCDATA_RegMapIndex values. - // - // Only if !go115ReduceLiveness. - PCDATA_RegMapUnsafe = PCDATA_UnsafePointUnsafe // Unsafe for async preemption - - // PCDATA_UnsafePoint values. - PCDATA_UnsafePointSafe = -1 // Safe for async preemption - PCDATA_UnsafePointUnsafe = -2 // Unsafe for async preemption - - // PCDATA_Restart1(2) apply on a sequence of instructions, within - // which if an async preemption happens, we should back off the PC - // to the start of the sequence when resuming. - // We need two so we can distinguish the start/end of the sequence - // in case that two sequences are next to each other. - PCDATA_Restart1 = -3 - PCDATA_Restart2 = -4 - - // Like PCDATA_Restart1, but back to function entry if async preempted. - PCDATA_RestartAtEntry = -5 -) diff --git a/vendor/github.com/twitchyliquid64/golang-asm/objabi/funcid.go b/vendor/github.com/twitchyliquid64/golang-asm/objabi/funcid.go deleted file mode 100644 index 6c9336f31..000000000 --- a/vendor/github.com/twitchyliquid64/golang-asm/objabi/funcid.go +++ /dev/null @@ -1,100 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package objabi - -// A FuncID identifies particular functions that need to be treated -// specially by the runtime. -// Note that in some situations involving plugins, there may be multiple -// copies of a particular special runtime function. -// Note: this list must match the list in runtime/symtab.go. -type FuncID uint8 - -const ( - FuncID_normal FuncID = iota // not a special function - FuncID_runtime_main - FuncID_goexit - FuncID_jmpdefer - FuncID_mcall - FuncID_morestack - FuncID_mstart - FuncID_rt0_go - FuncID_asmcgocall - FuncID_sigpanic - FuncID_runfinq - FuncID_gcBgMarkWorker - FuncID_systemstack_switch - FuncID_systemstack - FuncID_cgocallback_gofunc - FuncID_gogo - FuncID_externalthreadhandler - FuncID_debugCallV1 - FuncID_gopanic - FuncID_panicwrap - FuncID_handleAsyncEvent - FuncID_asyncPreempt - FuncID_wrapper // any autogenerated code (hash/eq algorithms, method wrappers, etc.) -) - -// Get the function ID for the named function in the named file. -// The function should be package-qualified. -func GetFuncID(name string, isWrapper bool) FuncID { - if isWrapper { - return FuncID_wrapper - } - switch name { - case "runtime.main": - return FuncID_runtime_main - case "runtime.goexit": - return FuncID_goexit - case "runtime.jmpdefer": - return FuncID_jmpdefer - case "runtime.mcall": - return FuncID_mcall - case "runtime.morestack": - return FuncID_morestack - case "runtime.mstart": - return FuncID_mstart - case "runtime.rt0_go": - return FuncID_rt0_go - case "runtime.asmcgocall": - return FuncID_asmcgocall - case "runtime.sigpanic": - return FuncID_sigpanic - case "runtime.runfinq": - return FuncID_runfinq - case "runtime.gcBgMarkWorker": - return FuncID_gcBgMarkWorker - case "runtime.systemstack_switch": - return FuncID_systemstack_switch - case "runtime.systemstack": - return FuncID_systemstack - case "runtime.cgocallback_gofunc": - return FuncID_cgocallback_gofunc - case "runtime.gogo": - return FuncID_gogo - case "runtime.externalthreadhandler": - return FuncID_externalthreadhandler - case "runtime.debugCallV1": - return FuncID_debugCallV1 - case "runtime.gopanic": - return FuncID_gopanic - case "runtime.panicwrap": - return FuncID_panicwrap - case "runtime.handleAsyncEvent": - return FuncID_handleAsyncEvent - case "runtime.asyncPreempt": - return FuncID_asyncPreempt - case "runtime.deferreturn": - // Don't show in the call stack (used when invoking defer functions) - return FuncID_wrapper - case "runtime.runOpenDeferFrame": - // Don't show in the call stack (used when invoking defer functions) - return FuncID_wrapper - case "runtime.reflectcallSave": - // Don't show in the call stack (used when invoking defer functions) - return FuncID_wrapper - } - return FuncID_normal -} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/objabi/head.go b/vendor/github.com/twitchyliquid64/golang-asm/objabi/head.go deleted file mode 100644 index 95b8db380..000000000 --- a/vendor/github.com/twitchyliquid64/golang-asm/objabi/head.go +++ /dev/null @@ -1,109 +0,0 @@ -// Derived from Inferno utils/6l/l.h and related files. -// https://bitbucket.org/inferno-os/inferno-os/src/master/utils/6l/l.h -// -// Copyright © 1994-1999 Lucent Technologies Inc. All rights reserved. -// Portions Copyright © 1995-1997 C H Forsyth (forsyth@terzarima.net) -// Portions Copyright © 1997-1999 Vita Nuova Limited -// Portions Copyright © 2000-2007 Vita Nuova Holdings Limited (www.vitanuova.com) -// Portions Copyright © 2004,2006 Bruce Ellis -// Portions Copyright © 2005-2007 C H Forsyth (forsyth@terzarima.net) -// Revisions Copyright © 2000-2007 Lucent Technologies Inc. and others -// Portions Copyright © 2009 The Go Authors. All rights reserved. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package objabi - -import "fmt" - -// HeadType is the executable header type. -type HeadType uint8 - -const ( - Hunknown HeadType = iota - Hdarwin - Hdragonfly - Hfreebsd - Hjs - Hlinux - Hnetbsd - Hopenbsd - Hplan9 - Hsolaris - Hwindows - Haix -) - -func (h *HeadType) Set(s string) error { - switch s { - case "aix": - *h = Haix - case "darwin": - *h = Hdarwin - case "dragonfly": - *h = Hdragonfly - case "freebsd": - *h = Hfreebsd - case "js": - *h = Hjs - case "linux", "android": - *h = Hlinux - case "netbsd": - *h = Hnetbsd - case "openbsd": - *h = Hopenbsd - case "plan9": - *h = Hplan9 - case "illumos", "solaris": - *h = Hsolaris - case "windows": - *h = Hwindows - default: - return fmt.Errorf("invalid headtype: %q", s) - } - return nil -} - -func (h *HeadType) String() string { - switch *h { - case Haix: - return "aix" - case Hdarwin: - return "darwin" - case Hdragonfly: - return "dragonfly" - case Hfreebsd: - return "freebsd" - case Hjs: - return "js" - case Hlinux: - return "linux" - case Hnetbsd: - return "netbsd" - case Hopenbsd: - return "openbsd" - case Hplan9: - return "plan9" - case Hsolaris: - return "solaris" - case Hwindows: - return "windows" - } - return fmt.Sprintf("HeadType(%d)", *h) -} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/objabi/line.go b/vendor/github.com/twitchyliquid64/golang-asm/objabi/line.go deleted file mode 100644 index 178c8363d..000000000 --- a/vendor/github.com/twitchyliquid64/golang-asm/objabi/line.go +++ /dev/null @@ -1,114 +0,0 @@ -// Copyright 2009 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package objabi - -import ( - "os" - "path/filepath" - "strings" -) - -// WorkingDir returns the current working directory -// (or "/???" if the directory cannot be identified), -// with "/" as separator. -func WorkingDir() string { - var path string - path, _ = os.Getwd() - if path == "" { - path = "/???" - } - return filepath.ToSlash(path) -} - -// AbsFile returns the absolute filename for file in the given directory, -// as rewritten by the rewrites argument. -// For unrewritten paths, AbsFile rewrites a leading $GOROOT prefix to the literal "$GOROOT". -// If the resulting path is the empty string, the result is "??". -// -// The rewrites argument is a ;-separated list of rewrites. -// Each rewrite is of the form "prefix" or "prefix=>replace", -// where prefix must match a leading sequence of path elements -// and is either removed entirely or replaced by the replacement. -func AbsFile(dir, file, rewrites string) string { - abs := file - if dir != "" && !filepath.IsAbs(file) { - abs = filepath.Join(dir, file) - } - - start := 0 - for i := 0; i <= len(rewrites); i++ { - if i == len(rewrites) || rewrites[i] == ';' { - if new, ok := applyRewrite(abs, rewrites[start:i]); ok { - abs = new - goto Rewritten - } - start = i + 1 - } - } - if hasPathPrefix(abs, GOROOT) { - abs = "$GOROOT" + abs[len(GOROOT):] - } - -Rewritten: - if abs == "" { - abs = "??" - } - return abs -} - -// applyRewrite applies the rewrite to the path, -// returning the rewritten path and a boolean -// indicating whether the rewrite applied at all. -func applyRewrite(path, rewrite string) (string, bool) { - prefix, replace := rewrite, "" - if j := strings.LastIndex(rewrite, "=>"); j >= 0 { - prefix, replace = rewrite[:j], rewrite[j+len("=>"):] - } - - if prefix == "" || !hasPathPrefix(path, prefix) { - return path, false - } - if len(path) == len(prefix) { - return replace, true - } - if replace == "" { - return path[len(prefix)+1:], true - } - return replace + path[len(prefix):], true -} - -// Does s have t as a path prefix? -// That is, does s == t or does s begin with t followed by a slash? -// For portability, we allow ASCII case folding, so that hasPathPrefix("a/b/c", "A/B") is true. -// Similarly, we allow slash folding, so that hasPathPrefix("a/b/c", "a\\b") is true. -// We do not allow full Unicode case folding, for fear of causing more confusion -// or harm than good. (For an example of the kinds of things that can go wrong, -// see http://article.gmane.org/gmane.linux.kernel/1853266.) -func hasPathPrefix(s string, t string) bool { - if len(t) > len(s) { - return false - } - var i int - for i = 0; i < len(t); i++ { - cs := int(s[i]) - ct := int(t[i]) - if 'A' <= cs && cs <= 'Z' { - cs += 'a' - 'A' - } - if 'A' <= ct && ct <= 'Z' { - ct += 'a' - 'A' - } - if cs == '\\' { - cs = '/' - } - if ct == '\\' { - ct = '/' - } - if cs != ct { - return false - } - } - return i >= len(s) || s[i] == '/' || s[i] == '\\' -} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/objabi/path.go b/vendor/github.com/twitchyliquid64/golang-asm/objabi/path.go deleted file mode 100644 index 2a42179a3..000000000 --- a/vendor/github.com/twitchyliquid64/golang-asm/objabi/path.go +++ /dev/null @@ -1,41 +0,0 @@ -// Copyright 2017 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package objabi - -import "strings" - -// PathToPrefix converts raw string to the prefix that will be used in the -// symbol table. All control characters, space, '%' and '"', as well as -// non-7-bit clean bytes turn into %xx. The period needs escaping only in the -// last segment of the path, and it makes for happier users if we escape that as -// little as possible. -func PathToPrefix(s string) string { - slash := strings.LastIndex(s, "/") - // check for chars that need escaping - n := 0 - for r := 0; r < len(s); r++ { - if c := s[r]; c <= ' ' || (c == '.' && r > slash) || c == '%' || c == '"' || c >= 0x7F { - n++ - } - } - - // quick exit - if n == 0 { - return s - } - - // escape - const hex = "0123456789abcdef" - p := make([]byte, 0, len(s)+2*n) - for r := 0; r < len(s); r++ { - if c := s[r]; c <= ' ' || (c == '.' && r > slash) || c == '%' || c == '"' || c >= 0x7F { - p = append(p, '%', hex[c>>4], hex[c&0xF]) - } else { - p = append(p, c) - } - } - - return string(p) -} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/objabi/reloctype.go b/vendor/github.com/twitchyliquid64/golang-asm/objabi/reloctype.go deleted file mode 100644 index f029a3c39..000000000 --- a/vendor/github.com/twitchyliquid64/golang-asm/objabi/reloctype.go +++ /dev/null @@ -1,269 +0,0 @@ -// Derived from Inferno utils/6l/l.h and related files. -// https://bitbucket.org/inferno-os/inferno-os/src/master/utils/6l/l.h -// -// Copyright © 1994-1999 Lucent Technologies Inc. All rights reserved. -// Portions Copyright © 1995-1997 C H Forsyth (forsyth@terzarima.net) -// Portions Copyright © 1997-1999 Vita Nuova Limited -// Portions Copyright © 2000-2007 Vita Nuova Holdings Limited (www.vitanuova.com) -// Portions Copyright © 2004,2006 Bruce Ellis -// Portions Copyright © 2005-2007 C H Forsyth (forsyth@terzarima.net) -// Revisions Copyright © 2000-2007 Lucent Technologies Inc. and others -// Portions Copyright © 2009 The Go Authors. All rights reserved. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package objabi - -type RelocType int16 - -//go:generate stringer -type=RelocType -const ( - R_ADDR RelocType = 1 + iota - // R_ADDRPOWER relocates a pair of "D-form" instructions (instructions with 16-bit - // immediates in the low half of the instruction word), usually addis followed by - // another add or a load, inserting the "high adjusted" 16 bits of the address of - // the referenced symbol into the immediate field of the first instruction and the - // low 16 bits into that of the second instruction. - R_ADDRPOWER - // R_ADDRARM64 relocates an adrp, add pair to compute the address of the - // referenced symbol. - R_ADDRARM64 - // R_ADDRMIPS (only used on mips/mips64) resolves to the low 16 bits of an external - // address, by encoding it into the instruction. - R_ADDRMIPS - // R_ADDROFF resolves to a 32-bit offset from the beginning of the section - // holding the data being relocated to the referenced symbol. - R_ADDROFF - // R_WEAKADDROFF resolves just like R_ADDROFF but is a weak relocation. - // A weak relocation does not make the symbol it refers to reachable, - // and is only honored by the linker if the symbol is in some other way - // reachable. - R_WEAKADDROFF - R_SIZE - R_CALL - R_CALLARM - R_CALLARM64 - R_CALLIND - R_CALLPOWER - // R_CALLMIPS (only used on mips64) resolves to non-PC-relative target address - // of a CALL (JAL) instruction, by encoding the address into the instruction. - R_CALLMIPS - // R_CALLRISCV marks RISC-V CALLs for stack checking. - R_CALLRISCV - R_CONST - R_PCREL - // R_TLS_LE, used on 386, amd64, and ARM, resolves to the offset of the - // thread-local symbol from the thread local base and is used to implement the - // "local exec" model for tls access (r.Sym is not set on intel platforms but is - // set to a TLS symbol -- runtime.tlsg -- in the linker when externally linking). - R_TLS_LE - // R_TLS_IE, used 386, amd64, and ARM resolves to the PC-relative offset to a GOT - // slot containing the offset from the thread-local symbol from the thread local - // base and is used to implemented the "initial exec" model for tls access (r.Sym - // is not set on intel platforms but is set to a TLS symbol -- runtime.tlsg -- in - // the linker when externally linking). - R_TLS_IE - R_GOTOFF - R_PLT0 - R_PLT1 - R_PLT2 - R_USEFIELD - // R_USETYPE resolves to an *rtype, but no relocation is created. The - // linker uses this as a signal that the pointed-to type information - // should be linked into the final binary, even if there are no other - // direct references. (This is used for types reachable by reflection.) - R_USETYPE - // R_METHODOFF resolves to a 32-bit offset from the beginning of the section - // holding the data being relocated to the referenced symbol. - // It is a variant of R_ADDROFF used when linking from the uncommonType of a - // *rtype, and may be set to zero by the linker if it determines the method - // text is unreachable by the linked program. - R_METHODOFF - R_POWER_TOC - R_GOTPCREL - // R_JMPMIPS (only used on mips64) resolves to non-PC-relative target address - // of a JMP instruction, by encoding the address into the instruction. - // The stack nosplit check ignores this since it is not a function call. - R_JMPMIPS - - // R_DWARFSECREF resolves to the offset of the symbol from its section. - // Target of relocation must be size 4 (in current implementation). - R_DWARFSECREF - - // R_DWARFFILEREF resolves to an index into the DWARF .debug_line - // file table for the specified file symbol. Must be applied to an - // attribute of form DW_FORM_data4. - R_DWARFFILEREF - - // Platform dependent relocations. Architectures with fixed width instructions - // have the inherent issue that a 32-bit (or 64-bit!) displacement cannot be - // stuffed into a 32-bit instruction, so an address needs to be spread across - // several instructions, and in turn this requires a sequence of relocations, each - // updating a part of an instruction. This leads to relocation codes that are - // inherently processor specific. - - // Arm64. - - // Set a MOV[NZ] immediate field to bits [15:0] of the offset from the thread - // local base to the thread local variable defined by the referenced (thread - // local) symbol. Error if the offset does not fit into 16 bits. - R_ARM64_TLS_LE - - // Relocates an ADRP; LD64 instruction sequence to load the offset between - // the thread local base and the thread local variable defined by the - // referenced (thread local) symbol from the GOT. - R_ARM64_TLS_IE - - // R_ARM64_GOTPCREL relocates an adrp, ld64 pair to compute the address of the GOT - // slot of the referenced symbol. - R_ARM64_GOTPCREL - - // R_ARM64_GOT resolves a GOT-relative instruction sequence, usually an adrp - // followed by another ld instruction. - R_ARM64_GOT - - // R_ARM64_PCREL resolves a PC-relative addresses instruction sequence, usually an - // adrp followed by another add instruction. - R_ARM64_PCREL - - // R_ARM64_LDST8 sets a LD/ST immediate value to bits [11:0] of a local address. - R_ARM64_LDST8 - - // R_ARM64_LDST32 sets a LD/ST immediate value to bits [11:2] of a local address. - R_ARM64_LDST32 - - // R_ARM64_LDST64 sets a LD/ST immediate value to bits [11:3] of a local address. - R_ARM64_LDST64 - - // R_ARM64_LDST128 sets a LD/ST immediate value to bits [11:4] of a local address. - R_ARM64_LDST128 - - // PPC64. - - // R_POWER_TLS_LE is used to implement the "local exec" model for tls - // access. It resolves to the offset of the thread-local symbol from the - // thread pointer (R13) and inserts this value into the low 16 bits of an - // instruction word. - R_POWER_TLS_LE - - // R_POWER_TLS_IE is used to implement the "initial exec" model for tls access. It - // relocates a D-form, DS-form instruction sequence like R_ADDRPOWER_DS. It - // inserts to the offset of GOT slot for the thread-local symbol from the TOC (the - // GOT slot is filled by the dynamic linker with the offset of the thread-local - // symbol from the thread pointer (R13)). - R_POWER_TLS_IE - - // R_POWER_TLS marks an X-form instruction such as "MOVD 0(R13)(R31*1), g" as - // accessing a particular thread-local symbol. It does not affect code generation - // but is used by the system linker when relaxing "initial exec" model code to - // "local exec" model code. - R_POWER_TLS - - // R_ADDRPOWER_DS is similar to R_ADDRPOWER above, but assumes the second - // instruction is a "DS-form" instruction, which has an immediate field occupying - // bits [15:2] of the instruction word. Bits [15:2] of the address of the - // relocated symbol are inserted into this field; it is an error if the last two - // bits of the address are not 0. - R_ADDRPOWER_DS - - // R_ADDRPOWER_PCREL relocates a D-form, DS-form instruction sequence like - // R_ADDRPOWER_DS but inserts the offset of the GOT slot for the referenced symbol - // from the TOC rather than the symbol's address. - R_ADDRPOWER_GOT - - // R_ADDRPOWER_PCREL relocates two D-form instructions like R_ADDRPOWER, but - // inserts the displacement from the place being relocated to the address of the - // relocated symbol instead of just its address. - R_ADDRPOWER_PCREL - - // R_ADDRPOWER_TOCREL relocates two D-form instructions like R_ADDRPOWER, but - // inserts the offset from the TOC to the address of the relocated symbol - // rather than the symbol's address. - R_ADDRPOWER_TOCREL - - // R_ADDRPOWER_TOCREL relocates a D-form, DS-form instruction sequence like - // R_ADDRPOWER_DS but inserts the offset from the TOC to the address of the - // relocated symbol rather than the symbol's address. - R_ADDRPOWER_TOCREL_DS - - // RISC-V. - - // R_RISCV_PCREL_ITYPE resolves a 32-bit PC-relative address using an - // AUIPC + I-type instruction pair. - R_RISCV_PCREL_ITYPE - - // R_RISCV_PCREL_STYPE resolves a 32-bit PC-relative address using an - // AUIPC + S-type instruction pair. - R_RISCV_PCREL_STYPE - - // R_PCRELDBL relocates s390x 2-byte aligned PC-relative addresses. - // TODO(mundaym): remove once variants can be serialized - see issue 14218. - R_PCRELDBL - - // R_ADDRMIPSU (only used on mips/mips64) resolves to the sign-adjusted "upper" 16 - // bits (bit 16-31) of an external address, by encoding it into the instruction. - R_ADDRMIPSU - // R_ADDRMIPSTLS (only used on mips64) resolves to the low 16 bits of a TLS - // address (offset from thread pointer), by encoding it into the instruction. - R_ADDRMIPSTLS - - // R_ADDRCUOFF resolves to a pointer-sized offset from the start of the - // symbol's DWARF compile unit. - R_ADDRCUOFF - - // R_WASMIMPORT resolves to the index of the WebAssembly function import. - R_WASMIMPORT - - // R_XCOFFREF (only used on aix/ppc64) prevents garbage collection by ld - // of a symbol. This isn't a real relocation, it can be placed in anywhere - // in a symbol and target any symbols. - R_XCOFFREF -) - -// IsDirectCall reports whether r is a relocation for a direct call. -// A direct call is a CALL instruction that takes the target address -// as an immediate. The address is embedded into the instruction, possibly -// with limited width. An indirect call is a CALL instruction that takes -// the target address in register or memory. -func (r RelocType) IsDirectCall() bool { - switch r { - case R_CALL, R_CALLARM, R_CALLARM64, R_CALLMIPS, R_CALLPOWER, R_CALLRISCV: - return true - } - return false -} - -// IsDirectJump reports whether r is a relocation for a direct jump. -// A direct jump is a JMP instruction that takes the target address -// as an immediate. The address is embedded into the instruction, possibly -// with limited width. An indirect jump is a JMP instruction that takes -// the target address in register or memory. -func (r RelocType) IsDirectJump() bool { - switch r { - case R_JMPMIPS: - return true - } - return false -} - -// IsDirectCallOrJump reports whether r is a relocation for a direct -// call or a direct jump. -func (r RelocType) IsDirectCallOrJump() bool { - return r.IsDirectCall() || r.IsDirectJump() -} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/objabi/reloctype_string.go b/vendor/github.com/twitchyliquid64/golang-asm/objabi/reloctype_string.go deleted file mode 100644 index 83dfe71e0..000000000 --- a/vendor/github.com/twitchyliquid64/golang-asm/objabi/reloctype_string.go +++ /dev/null @@ -1,17 +0,0 @@ -// Code generated by "stringer -type=RelocType"; DO NOT EDIT. - -package objabi - -import "strconv" - -const _RelocType_name = "R_ADDRR_ADDRPOWERR_ADDRARM64R_ADDRMIPSR_ADDROFFR_WEAKADDROFFR_SIZER_CALLR_CALLARMR_CALLARM64R_CALLINDR_CALLPOWERR_CALLMIPSR_CALLRISCVR_CONSTR_PCRELR_TLS_LER_TLS_IER_GOTOFFR_PLT0R_PLT1R_PLT2R_USEFIELDR_USETYPER_METHODOFFR_POWER_TOCR_GOTPCRELR_JMPMIPSR_DWARFSECREFR_DWARFFILEREFR_ARM64_TLS_LER_ARM64_TLS_IER_ARM64_GOTPCRELR_ARM64_GOTR_ARM64_PCRELR_ARM64_LDST8R_ARM64_LDST32R_ARM64_LDST64R_ARM64_LDST128R_POWER_TLS_LER_POWER_TLS_IER_POWER_TLSR_ADDRPOWER_DSR_ADDRPOWER_GOTR_ADDRPOWER_PCRELR_ADDRPOWER_TOCRELR_ADDRPOWER_TOCREL_DSR_RISCV_PCREL_ITYPER_RISCV_PCREL_STYPER_PCRELDBLR_ADDRMIPSUR_ADDRMIPSTLSR_ADDRCUOFFR_WASMIMPORTR_XCOFFREF" - -var _RelocType_index = [...]uint16{0, 6, 17, 28, 38, 47, 60, 66, 72, 81, 92, 101, 112, 122, 133, 140, 147, 155, 163, 171, 177, 183, 189, 199, 208, 219, 230, 240, 249, 262, 276, 290, 304, 320, 331, 344, 357, 371, 385, 400, 414, 428, 439, 453, 468, 485, 503, 524, 543, 562, 572, 583, 596, 607, 619, 629} - -func (i RelocType) String() string { - i -= 1 - if i < 0 || i >= RelocType(len(_RelocType_index)-1) { - return "RelocType(" + strconv.FormatInt(int64(i+1), 10) + ")" - } - return _RelocType_name[_RelocType_index[i]:_RelocType_index[i+1]] -} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/objabi/stack.go b/vendor/github.com/twitchyliquid64/golang-asm/objabi/stack.go deleted file mode 100644 index 389de5867..000000000 --- a/vendor/github.com/twitchyliquid64/golang-asm/objabi/stack.go +++ /dev/null @@ -1,33 +0,0 @@ -// Copyright 2011 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package objabi - -// For the linkers. Must match Go definitions. - -const ( - STACKSYSTEM = 0 - StackSystem = STACKSYSTEM - StackBig = 4096 - StackSmall = 128 -) - -const ( - StackPreempt = -1314 // 0xfff...fade -) - -// Initialize StackGuard and StackLimit according to target system. -var StackGuard = 928*stackGuardMultiplier() + StackSystem -var StackLimit = StackGuard - StackSystem - StackSmall - -// stackGuardMultiplier returns a multiplier to apply to the default -// stack guard size. Larger multipliers are used for non-optimized -// builds that have larger stack frames or for specific targets. -func stackGuardMultiplier() int { - // On AIX, a larger stack is needed for syscalls. - if GOOS == "aix" { - return 2 - } - return 1 -} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/objabi/symkind.go b/vendor/github.com/twitchyliquid64/golang-asm/objabi/symkind.go deleted file mode 100644 index 6c991121e..000000000 --- a/vendor/github.com/twitchyliquid64/golang-asm/objabi/symkind.go +++ /dev/null @@ -1,79 +0,0 @@ -// Derived from Inferno utils/6l/l.h and related files. -// https://bitbucket.org/inferno-os/inferno-os/src/master/utils/6l/l.h -// -// Copyright © 1994-1999 Lucent Technologies Inc. All rights reserved. -// Portions Copyright © 1995-1997 C H Forsyth (forsyth@terzarima.net) -// Portions Copyright © 1997-1999 Vita Nuova Limited -// Portions Copyright © 2000-2007 Vita Nuova Holdings Limited (www.vitanuova.com) -// Portions Copyright © 2004,2006 Bruce Ellis -// Portions Copyright © 2005-2007 C H Forsyth (forsyth@terzarima.net) -// Revisions Copyright © 2000-2007 Lucent Technologies Inc. and others -// Portions Copyright © 2009 The Go Authors. All rights reserved. -// -// Permission is hereby granted, free of charge, to any person obtaining a copy -// of this software and associated documentation files (the "Software"), to deal -// in the Software without restriction, including without limitation the rights -// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell -// copies of the Software, and to permit persons to whom the Software is -// furnished to do so, subject to the following conditions: -// -// The above copyright notice and this permission notice shall be included in -// all copies or substantial portions of the Software. -// -// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, -// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN -// THE SOFTWARE. - -package objabi - -// A SymKind describes the kind of memory represented by a symbol. -type SymKind uint8 - -// Defined SymKind values. -// These are used to index into cmd/link/internal/sym/AbiSymKindToSymKind -// -// TODO(rsc): Give idiomatic Go names. -//go:generate stringer -type=SymKind -const ( - // An otherwise invalid zero value for the type - Sxxx SymKind = iota - // Executable instructions - STEXT - // Read only static data - SRODATA - // Static data that does not contain any pointers - SNOPTRDATA - // Static data - SDATA - // Statically data that is initially all 0s - SBSS - // Statically data that is initially all 0s and does not contain pointers - SNOPTRBSS - // Thread-local data that is initially all 0s - STLSBSS - // Debugging data - SDWARFCUINFO - SDWARFCONST - SDWARFFCN - SDWARFABSFCN - SDWARFTYPE - SDWARFVAR - SDWARFRANGE - SDWARFLOC - SDWARFLINES - // ABI alias. An ABI alias symbol is an empty symbol with a - // single relocation with 0 size that references the native - // function implementation symbol. - // - // TODO(austin): Remove this and all uses once the compiler - // generates real ABI wrappers rather than symbol aliases. - SABIALIAS - // Coverage instrumentation counter for libfuzzer. - SLIBFUZZER_EXTRA_COUNTER - // Update cmd/link/internal/sym/AbiSymKindToSymKind for new SymKind values. - -) diff --git a/vendor/github.com/twitchyliquid64/golang-asm/objabi/symkind_string.go b/vendor/github.com/twitchyliquid64/golang-asm/objabi/symkind_string.go deleted file mode 100644 index 1b1c39403..000000000 --- a/vendor/github.com/twitchyliquid64/golang-asm/objabi/symkind_string.go +++ /dev/null @@ -1,41 +0,0 @@ -// Code generated by "stringer -type=SymKind"; DO NOT EDIT. - -package objabi - -import "strconv" - -func _() { - // An "invalid array index" compiler error signifies that the constant values have changed. - // Re-run the stringer command to generate them again. - var x [1]struct{} - _ = x[Sxxx-0] - _ = x[STEXT-1] - _ = x[SRODATA-2] - _ = x[SNOPTRDATA-3] - _ = x[SDATA-4] - _ = x[SBSS-5] - _ = x[SNOPTRBSS-6] - _ = x[STLSBSS-7] - _ = x[SDWARFCUINFO-8] - _ = x[SDWARFCONST-9] - _ = x[SDWARFFCN-10] - _ = x[SDWARFABSFCN-11] - _ = x[SDWARFTYPE-12] - _ = x[SDWARFVAR-13] - _ = x[SDWARFRANGE-14] - _ = x[SDWARFLOC-15] - _ = x[SDWARFLINES-16] - _ = x[SABIALIAS-17] - _ = x[SLIBFUZZER_EXTRA_COUNTER-18] -} - -const _SymKind_name = "SxxxSTEXTSRODATASNOPTRDATASDATASBSSSNOPTRBSSSTLSBSSSDWARFCUINFOSDWARFCONSTSDWARFFCNSDWARFABSFCNSDWARFTYPESDWARFVARSDWARFRANGESDWARFLOCSDWARFLINESSABIALIASSLIBFUZZER_EXTRA_COUNTER" - -var _SymKind_index = [...]uint8{0, 4, 9, 16, 26, 31, 35, 44, 51, 63, 74, 83, 95, 105, 114, 125, 134, 145, 154, 178} - -func (i SymKind) String() string { - if i >= SymKind(len(_SymKind_index)-1) { - return "SymKind(" + strconv.FormatInt(int64(i), 10) + ")" - } - return _SymKind_name[_SymKind_index[i]:_SymKind_index[i+1]] -} diff --git a/vendor/github.com/twitchyliquid64/golang-asm/objabi/typekind.go b/vendor/github.com/twitchyliquid64/golang-asm/objabi/typekind.go deleted file mode 100644 index 990ff1888..000000000 --- a/vendor/github.com/twitchyliquid64/golang-asm/objabi/typekind.go +++ /dev/null @@ -1,40 +0,0 @@ -// Copyright 2012 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package objabi - -// Must match runtime and reflect. -// Included by cmd/gc. - -const ( - KindBool = 1 + iota - KindInt - KindInt8 - KindInt16 - KindInt32 - KindInt64 - KindUint - KindUint8 - KindUint16 - KindUint32 - KindUint64 - KindUintptr - KindFloat32 - KindFloat64 - KindComplex64 - KindComplex128 - KindArray - KindChan - KindFunc - KindInterface - KindMap - KindPtr - KindSlice - KindString - KindStruct - KindUnsafePointer - KindDirectIface = 1 << 5 - KindGCProg = 1 << 6 - KindMask = (1 << 5) - 1 -) diff --git a/vendor/github.com/twitchyliquid64/golang-asm/objabi/util.go b/vendor/github.com/twitchyliquid64/golang-asm/objabi/util.go deleted file mode 100644 index 2c7b66e4d..000000000 --- a/vendor/github.com/twitchyliquid64/golang-asm/objabi/util.go +++ /dev/null @@ -1,203 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package objabi - -import ( - "fmt" - "log" - "os" - "strings" -) - -func envOr(key, value string) string { - if x := os.Getenv(key); x != "" { - return x - } - return value -} - -var ( - defaultGOROOT string // set by linker - - GOROOT = envOr("GOROOT", defaultGOROOT) - GOARCH = envOr("GOARCH", "amd64") - GOOS = envOr("GOOS", "linux") - GO386 = envOr("GO386", "") - GOAMD64 = goamd64() - GOARM = goarm() - GOMIPS = gomips() - GOMIPS64 = gomips64() - GOPPC64 = goppc64() - GOWASM = gowasm() - GO_LDSO = "" - Version = "" -) - -const ( - ElfRelocOffset = 256 - MachoRelocOffset = 2048 // reserve enough space for ELF relocations - Go115AMD64 = "alignedjumps" // Should be "alignedjumps" or "normaljumps"; this replaces environment variable introduced in CL 219357. -) - -// TODO(1.16): assuming no issues in 1.15 release, remove this and related constant. -func goamd64() string { - return Go115AMD64 -} - -func goarm() int { - switch v := envOr("GOARM", "7"); v { - case "5": - return 5 - case "6": - return 6 - case "7": - return 7 - } - // Fail here, rather than validate at multiple call sites. - log.Fatalf("Invalid GOARM value. Must be 5, 6, or 7.") - panic("unreachable") -} - -func gomips() string { - switch v := envOr("GOMIPS", "hardfloat"); v { - case "hardfloat", "softfloat": - return v - } - log.Fatalf("Invalid GOMIPS value. Must be hardfloat or softfloat.") - panic("unreachable") -} - -func gomips64() string { - switch v := envOr("GOMIPS64", "hardfloat"); v { - case "hardfloat", "softfloat": - return v - } - log.Fatalf("Invalid GOMIPS64 value. Must be hardfloat or softfloat.") - panic("unreachable") -} - -func goppc64() int { - switch v := envOr("GOPPC64", "power8"); v { - case "power8": - return 8 - case "power9": - return 9 - } - log.Fatalf("Invalid GOPPC64 value. Must be power8 or power9.") - panic("unreachable") -} - -type gowasmFeatures struct { - SignExt bool - SatConv bool -} - -func (f gowasmFeatures) String() string { - var flags []string - if f.SatConv { - flags = append(flags, "satconv") - } - if f.SignExt { - flags = append(flags, "signext") - } - return strings.Join(flags, ",") -} - -func gowasm() (f gowasmFeatures) { - for _, opt := range strings.Split(envOr("GOWASM", ""), ",") { - switch opt { - case "satconv": - f.SatConv = true - case "signext": - f.SignExt = true - case "": - // ignore - default: - log.Fatalf("Invalid GOWASM value. No such feature: " + opt) - } - } - return -} - -func Getgoextlinkenabled() string { - return envOr("GO_EXTLINK_ENABLED", "") -} - -func init() { - for _, f := range strings.Split("", ",") { - if f != "" { - addexp(f) - } - } - - // regabi is only supported on amd64. - if GOARCH != "amd64" { - Regabi_enabled = 0 - } -} - -// Note: must agree with runtime.framepointer_enabled. -var Framepointer_enabled = GOARCH == "amd64" || GOARCH == "arm64" && (GOOS == "linux" || GOOS == "darwin") - -func addexp(s string) { - // Could do general integer parsing here, but the runtime copy doesn't yet. - v := 1 - name := s - if len(name) > 2 && name[:2] == "no" { - v = 0 - name = name[2:] - } - for i := 0; i < len(exper); i++ { - if exper[i].name == name { - if exper[i].val != nil { - *exper[i].val = v - } - return - } - } - - fmt.Printf("unknown experiment %s\n", s) - os.Exit(2) -} - -var ( - Fieldtrack_enabled int - Preemptibleloops_enabled int - Staticlockranking_enabled int - Regabi_enabled int -) - -// Toolchain experiments. -// These are controlled by the GOEXPERIMENT environment -// variable recorded when the toolchain is built. -// This list is also known to cmd/gc. -var exper = []struct { - name string - val *int -}{ - {"fieldtrack", &Fieldtrack_enabled}, - {"preemptibleloops", &Preemptibleloops_enabled}, - {"staticlockranking", &Staticlockranking_enabled}, - {"regabi", &Regabi_enabled}, -} - -var defaultExpstring = Expstring() - -func DefaultExpstring() string { - return defaultExpstring -} - -func Expstring() string { - buf := "X" - for i := range exper { - if *exper[i].val != 0 { - buf += "," + exper[i].name - } - } - if buf == "X" { - buf += ",none" - } - return "X:" + buf[2:] -} |
