summaryrefslogtreecommitdiff
path: root/vendor/github.com/klauspost/cpuid/v2
diff options
context:
space:
mode:
Diffstat (limited to 'vendor/github.com/klauspost/cpuid/v2')
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/.gitignore24
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml57
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/CONTRIBUTING.txt35
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/LICENSE22
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/README.md512
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/cpuid.go1679
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/cpuid_386.s47
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s72
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s36
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/detect_arm64.go250
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/detect_ref.go17
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/detect_x86.go45
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/featureid_string.go308
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go129
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go208
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go16
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go8
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go11
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/test-architectures.sh15
19 files changed, 0 insertions, 3491 deletions
diff --git a/vendor/github.com/klauspost/cpuid/v2/.gitignore b/vendor/github.com/klauspost/cpuid/v2/.gitignore
deleted file mode 100644
index daf913b1b..000000000
--- a/vendor/github.com/klauspost/cpuid/v2/.gitignore
+++ /dev/null
@@ -1,24 +0,0 @@
-# Compiled Object files, Static and Dynamic libs (Shared Objects)
-*.o
-*.a
-*.so
-
-# Folders
-_obj
-_test
-
-# Architecture specific extensions/prefixes
-*.[568vq]
-[568vq].out
-
-*.cgo1.go
-*.cgo2.c
-_cgo_defun.c
-_cgo_gotypes.go
-_cgo_export.*
-
-_testmain.go
-
-*.exe
-*.test
-*.prof
diff --git a/vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml b/vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml
deleted file mode 100644
index 1b695b62c..000000000
--- a/vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml
+++ /dev/null
@@ -1,57 +0,0 @@
-version: 2
-
-builds:
- -
- id: "cpuid"
- binary: cpuid
- main: ./cmd/cpuid/main.go
- env:
- - CGO_ENABLED=0
- flags:
- - -ldflags=-s -w
- goos:
- - aix
- - linux
- - freebsd
- - netbsd
- - windows
- - darwin
- goarch:
- - 386
- - amd64
- - arm64
- goarm:
- - 7
-
-archives:
- -
- id: cpuid
- name_template: "cpuid-{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}"
- format_overrides:
- - goos: windows
- format: zip
- files:
- - LICENSE
-checksum:
- name_template: 'checksums.txt'
-changelog:
- sort: asc
- filters:
- exclude:
- - '^doc:'
- - '^docs:'
- - '^test:'
- - '^tests:'
- - '^Update\sREADME.md'
-
-nfpms:
- -
- file_name_template: "cpuid_package_{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}"
- vendor: Klaus Post
- homepage: https://github.com/klauspost/cpuid
- maintainer: Klaus Post <klauspost@gmail.com>
- description: CPUID Tool
- license: BSD 3-Clause
- formats:
- - deb
- - rpm
diff --git a/vendor/github.com/klauspost/cpuid/v2/CONTRIBUTING.txt b/vendor/github.com/klauspost/cpuid/v2/CONTRIBUTING.txt
deleted file mode 100644
index 2ef4714f7..000000000
--- a/vendor/github.com/klauspost/cpuid/v2/CONTRIBUTING.txt
+++ /dev/null
@@ -1,35 +0,0 @@
-Developer Certificate of Origin
-Version 1.1
-
-Copyright (C) 2015- Klaus Post & Contributors.
-Email: klauspost@gmail.com
-
-Everyone is permitted to copy and distribute verbatim copies of this
-license document, but changing it is not allowed.
-
-
-Developer's Certificate of Origin 1.1
-
-By making a contribution to this project, I certify that:
-
-(a) The contribution was created in whole or in part by me and I
- have the right to submit it under the open source license
- indicated in the file; or
-
-(b) The contribution is based upon previous work that, to the best
- of my knowledge, is covered under an appropriate open source
- license and I have the right under that license to submit that
- work with modifications, whether created in whole or in part
- by me, under the same open source license (unless I am
- permitted to submit under a different license), as indicated
- in the file; or
-
-(c) The contribution was provided directly to me by some other
- person who certified (a), (b) or (c) and I have not modified
- it.
-
-(d) I understand and agree that this project and the contribution
- are public and that a record of the contribution (including all
- personal information I submit with it, including my sign-off) is
- maintained indefinitely and may be redistributed consistent with
- this project or the open source license(s) involved.
diff --git a/vendor/github.com/klauspost/cpuid/v2/LICENSE b/vendor/github.com/klauspost/cpuid/v2/LICENSE
deleted file mode 100644
index 5cec7ee94..000000000
--- a/vendor/github.com/klauspost/cpuid/v2/LICENSE
+++ /dev/null
@@ -1,22 +0,0 @@
-The MIT License (MIT)
-
-Copyright (c) 2015 Klaus Post
-
-Permission is hereby granted, free of charge, to any person obtaining a copy
-of this software and associated documentation files (the "Software"), to deal
-in the Software without restriction, including without limitation the rights
-to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-copies of the Software, and to permit persons to whom the Software is
-furnished to do so, subject to the following conditions:
-
-The above copyright notice and this permission notice shall be included in all
-copies or substantial portions of the Software.
-
-THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE
-SOFTWARE.
-
diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md
deleted file mode 100644
index 88d68d528..000000000
--- a/vendor/github.com/klauspost/cpuid/v2/README.md
+++ /dev/null
@@ -1,512 +0,0 @@
-# cpuid
-Package cpuid provides information about the CPU running the current program.
-
-CPU features are detected on startup, and kept for fast access through the life of the application.
-Currently x86 / x64 (AMD64/i386) and ARM (ARM64) is supported, and no external C (cgo) code is used, which should make the library very easy to use.
-
-You can access the CPU information by accessing the shared CPU variable of the cpuid library.
-
-Package home: https://github.com/klauspost/cpuid
-
-[![PkgGoDev](https://pkg.go.dev/badge/github.com/klauspost/cpuid)](https://pkg.go.dev/github.com/klauspost/cpuid/v2)
-[![Go](https://github.com/klauspost/cpuid/actions/workflows/go.yml/badge.svg)](https://github.com/klauspost/cpuid/actions/workflows/go.yml)
-
-## installing
-
-`go get -u github.com/klauspost/cpuid/v2` using modules.
-Drop `v2` for others.
-
-Installing binary:
-
-`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
-
-Or download binaries from release page: https://github.com/klauspost/cpuid/releases
-
-### Homebrew
-
-For macOS/Linux users, you can install via [brew](https://brew.sh/)
-
-```sh
-$ brew install cpuid
-```
-
-## example
-
-```Go
-package main
-
-import (
- "fmt"
- "strings"
-
- . "github.com/klauspost/cpuid/v2"
-)
-
-func main() {
- // Print basic CPU information:
- fmt.Println("Name:", CPU.BrandName)
- fmt.Println("PhysicalCores:", CPU.PhysicalCores)
- fmt.Println("ThreadsPerCore:", CPU.ThreadsPerCore)
- fmt.Println("LogicalCores:", CPU.LogicalCores)
- fmt.Println("Family", CPU.Family, "Model:", CPU.Model, "Vendor ID:", CPU.VendorID)
- fmt.Println("Features:", strings.Join(CPU.FeatureSet(), ","))
- fmt.Println("Cacheline bytes:", CPU.CacheLine)
- fmt.Println("L1 Data Cache:", CPU.Cache.L1D, "bytes")
- fmt.Println("L1 Instruction Cache:", CPU.Cache.L1I, "bytes")
- fmt.Println("L2 Cache:", CPU.Cache.L2, "bytes")
- fmt.Println("L3 Cache:", CPU.Cache.L3, "bytes")
- fmt.Println("Frequency", CPU.Hz, "hz")
-
- // Test if we have these specific features:
- if CPU.Supports(SSE, SSE2) {
- fmt.Println("We have Streaming SIMD 2 Extensions")
- }
-}
-```
-
-Sample output:
-```
->go run main.go
-Name: AMD Ryzen 9 3950X 16-Core Processor
-PhysicalCores: 16
-ThreadsPerCore: 2
-LogicalCores: 32
-Family 23 Model: 113 Vendor ID: AMD
-Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CMOV,CX16,F16C,FMA3,HTT,HYPERVISOR,LZCNT,MMX,MMXEXT,NX,POPCNT,RDRAND,RDSEED,RDTSCP,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3
-Cacheline bytes: 64
-L1 Data Cache: 32768 bytes
-L1 Instruction Cache: 32768 bytes
-L2 Cache: 524288 bytes
-L3 Cache: 16777216 bytes
-Frequency 0 hz
-We have Streaming SIMD 2 Extensions
-```
-
-# usage
-
-The `cpuid.CPU` provides access to CPU features. Use `cpuid.CPU.Supports()` to check for CPU features.
-A faster `cpuid.CPU.Has()` is provided which will usually be inlined by the gc compiler.
-
-To test a larger number of features, they can be combined using `f := CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2)`, etc.
-This can be using with `cpuid.CPU.HasAll(f)` to quickly test if all features are supported.
-
-Note that for some cpu/os combinations some features will not be detected.
-`amd64` has rather good support and should work reliably on all platforms.
-
-Note that hypervisors may not pass through all CPU features through to the guest OS,
-so even if your host supports a feature it may not be visible on guests.
-
-## arm64 feature detection
-
-Not all operating systems provide ARM features directly
-and there is no safe way to do so for the rest.
-
-Currently `arm64/linux` and `arm64/freebsd` should be quite reliable.
-`arm64/darwin` adds features expected from the M1 processor, but a lot remains undetected.
-
-A `DetectARM()` can be used if you are able to control your deployment,
-it will detect CPU features, but may crash if the OS doesn't intercept the calls.
-A `-cpu.arm` flag for detecting unsafe ARM features can be added. See below.
-
-Note that currently only features are detected on ARM,
-no additional information is currently available.
-
-## flags
-
-It is possible to add flags that affects cpu detection.
-
-For this the `Flags()` command is provided.
-
-This must be called *before* `flag.Parse()` AND after the flags have been parsed `Detect()` must be called.
-
-This means that any detection used in `init()` functions will not contain these flags.
-
-Example:
-
-```Go
-package main
-
-import (
- "flag"
- "fmt"
- "strings"
-
- "github.com/klauspost/cpuid/v2"
-)
-
-func main() {
- cpuid.Flags()
- flag.Parse()
- cpuid.Detect()
-
- // Test if we have these specific features:
- if cpuid.CPU.Supports(cpuid.SSE, cpuid.SSE2) {
- fmt.Println("We have Streaming SIMD 2 Extensions")
- }
-}
-```
-
-## commandline
-
-Download as binary from: https://github.com/klauspost/cpuid/releases
-
-Install from source:
-
-`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
-
-### Example
-
-```
-λ cpuid
-Name: AMD Ryzen 9 3950X 16-Core Processor
-Vendor String: AuthenticAMD
-Vendor ID: AMD
-PhysicalCores: 16
-Threads Per Core: 2
-Logical Cores: 32
-CPU Family 23 Model: 113
-Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CLZERO,CMOV,CMPXCHG8,CPBOOST,CX16,F16C,FMA3,FXSR,FXSROPT,HTT,HYPERVISOR,LAHF,LZCNT,MCAOVERFLOW,MMX,MMXEXT,MOVBE,NX,OSXSAVE,POPCNT,RDRAND,RDSEED,RDTSCP,SCE,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3,SUCCOR,X87,XSAVE
-Microarchitecture level: 3
-Cacheline bytes: 64
-L1 Instruction Cache: 32768 bytes
-L1 Data Cache: 32768 bytes
-L2 Cache: 524288 bytes
-L3 Cache: 16777216 bytes
-
-```
-### JSON Output:
-
-```
-λ cpuid --json
-{
- "BrandName": "AMD Ryzen 9 3950X 16-Core Processor",
- "VendorID": 2,
- "VendorString": "AuthenticAMD",
- "PhysicalCores": 16,
- "ThreadsPerCore": 2,
- "LogicalCores": 32,
- "Family": 23,
- "Model": 113,
- "CacheLine": 64,
- "Hz": 0,
- "BoostFreq": 0,
- "Cache": {
- "L1I": 32768,
- "L1D": 32768,
- "L2": 524288,
- "L3": 16777216
- },
- "SGX": {
- "Available": false,
- "LaunchControl": false,
- "SGX1Supported": false,
- "SGX2Supported": false,
- "MaxEnclaveSizeNot64": 0,
- "MaxEnclaveSize64": 0,
- "EPCSections": null
- },
- "Features": [
- "ADX",
- "AESNI",
- "AVX",
- "AVX2",
- "BMI1",
- "BMI2",
- "CLMUL",
- "CLZERO",
- "CMOV",
- "CMPXCHG8",
- "CPBOOST",
- "CX16",
- "F16C",
- "FMA3",
- "FXSR",
- "FXSROPT",
- "HTT",
- "HYPERVISOR",
- "LAHF",
- "LZCNT",
- "MCAOVERFLOW",
- "MMX",
- "MMXEXT",
- "MOVBE",
- "NX",
- "OSXSAVE",
- "POPCNT",
- "RDRAND",
- "RDSEED",
- "RDTSCP",
- "SCE",
- "SHA",
- "SSE",
- "SSE2",
- "SSE3",
- "SSE4",
- "SSE42",
- "SSE4A",
- "SSSE3",
- "SUCCOR",
- "X87",
- "XSAVE"
- ],
- "X64Level": 3
-}
-```
-
-### Check CPU microarch level
-
-```
-λ cpuid --check-level=3
-2022/03/18 17:04:40 AMD Ryzen 9 3950X 16-Core Processor
-2022/03/18 17:04:40 Microarchitecture level 3 is supported. Max level is 3.
-Exit Code 0
-
-λ cpuid --check-level=4
-2022/03/18 17:06:18 AMD Ryzen 9 3950X 16-Core Processor
-2022/03/18 17:06:18 Microarchitecture level 4 not supported. Max level is 3.
-Exit Code 1
-```
-
-
-## Available flags
-
-### x86 & amd64
-
-| Feature Flag | Description |
-|--------------------|------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------|
-| ADX | Intel ADX (Multi-Precision Add-Carry Instruction Extensions) |
-| AESNI | Advanced Encryption Standard New Instructions |
-| AMD3DNOW | AMD 3DNOW |
-| AMD3DNOWEXT | AMD 3DNowExt |
-| AMXBF16 | Tile computational operations on BFLOAT16 numbers |
-| AMXINT8 | Tile computational operations on 8-bit integers |
-| AMXFP16 | Tile computational operations on FP16 numbers |
-| AMXFP8 | Tile computational operations on FP8 numbers |
-| AMXCOMPLEX | Tile computational operations on complex numbers |
-| AMXTILE | Tile architecture |
-| AMXTF32 | Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile |
-| AMXTRANSPOSE | Tile multiply where the first operand is transposed |
-| APX_F | Intel APX |
-| AVX | AVX functions |
-| AVX10 | If set the Intel AVX10 Converged Vector ISA is supported |
-| AVX10_128 | If set indicates that AVX10 128-bit vector support is present |
-| AVX10_256 | If set indicates that AVX10 256-bit vector support is present |
-| AVX10_512 | If set indicates that AVX10 512-bit vector support is present |
-| AVX2 | AVX2 functions |
-| AVX512BF16 | AVX-512 BFLOAT16 Instructions |
-| AVX512BITALG | AVX-512 Bit Algorithms |
-| AVX512BW | AVX-512 Byte and Word Instructions |
-| AVX512CD | AVX-512 Conflict Detection Instructions |
-| AVX512DQ | AVX-512 Doubleword and Quadword Instructions |
-| AVX512ER | AVX-512 Exponential and Reciprocal Instructions |
-| AVX512F | AVX-512 Foundation |
-| AVX512FP16 | AVX-512 FP16 Instructions |
-| AVX512IFMA | AVX-512 Integer Fused Multiply-Add Instructions |
-| AVX512PF | AVX-512 Prefetch Instructions |
-| AVX512VBMI | AVX-512 Vector Bit Manipulation Instructions |
-| AVX512VBMI2 | AVX-512 Vector Bit Manipulation Instructions, Version 2 |
-| AVX512VL | AVX-512 Vector Length Extensions |
-| AVX512VNNI | AVX-512 Vector Neural Network Instructions |
-| AVX512VP2INTERSECT | AVX-512 Intersect for D/Q |
-| AVX512VPOPCNTDQ | AVX-512 Vector Population Count Doubleword and Quadword |
-| AVXIFMA | AVX-IFMA instructions |
-| AVXNECONVERT | AVX-NE-CONVERT instructions |
-| AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one |
-| AVXVNNI | AVX (VEX encoded) VNNI neural network instructions |
-| AVXVNNIINT8 | AVX-VNNI-INT8 instructions |
-| AVXVNNIINT16 | AVX-VNNI-INT16 instructions |
-| BHI_CTRL | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 |
-| BMI1 | Bit Manipulation Instruction Set 1 |
-| BMI2 | Bit Manipulation Instruction Set 2 |
-| CETIBT | Intel CET Indirect Branch Tracking |
-| CETSS | Intel CET Shadow Stack |
-| CLDEMOTE | Cache Line Demote |
-| CLMUL | Carry-less Multiplication |
-| CLZERO | CLZERO instruction supported |
-| CMOV | i686 CMOV |
-| CMPCCXADD | CMPCCXADD instructions |
-| CMPSB_SCADBS_SHORT | Fast short CMPSB and SCASB |
-| CMPXCHG8 | CMPXCHG8 instruction |
-| CPBOOST | Core Performance Boost |
-| CPPC | AMD: Collaborative Processor Performance Control |
-| CX16 | CMPXCHG16B Instruction |
-| EFER_LMSLE_UNS | AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ |
-| ENQCMD | Enqueue Command |
-| ERMS | Enhanced REP MOVSB/STOSB |
-| F16C | Half-precision floating-point conversion |
-| FLUSH_L1D | Flush L1D cache |
-| FMA3 | Intel FMA 3. Does not imply AVX. |
-| FMA4 | Bulldozer FMA4 functions |
-| FP128 | AMD: When set, the internal FP/SIMD execution datapath is 128-bits wide |
-| FP256 | AMD: When set, the internal FP/SIMD execution datapath is 256-bits wide |
-| FSRM | Fast Short Rep Mov |
-| FXSR | FXSAVE, FXRESTOR instructions, CR4 bit 9 |
-| FXSROPT | FXSAVE/FXRSTOR optimizations |
-| GFNI | Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. |
-| HLE | Hardware Lock Elision |
-| HRESET | If set CPU supports history reset and the IA32_HRESET_ENABLE MSR |
-| HTT | Hyperthreading (enabled) |
-| HWA | Hardware assert supported. Indicates support for MSRC001_10 |
-| HYBRID_CPU | This part has CPUs of more than one type. |
-| HYPERVISOR | This bit has been reserved by Intel & AMD for use by hypervisors |
-| IA32_ARCH_CAP | IA32_ARCH_CAPABILITIES MSR (Intel) |
-| IA32_CORE_CAP | IA32_CORE_CAPABILITIES MSR |
-| IBPB | Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) |
-| IBRS | AMD: Indirect Branch Restricted Speculation |
-| IBRS_PREFERRED | AMD: IBRS is preferred over software solution |
-| IBRS_PROVIDES_SMP | AMD: IBRS provides Same Mode Protection |
-| IBS | Instruction Based Sampling (AMD) |
-| IBSBRNTRGT | Instruction Based Sampling Feature (AMD) |
-| IBSFETCHSAM | Instruction Based Sampling Feature (AMD) |
-| IBSFFV | Instruction Based Sampling Feature (AMD) |
-| IBSOPCNT | Instruction Based Sampling Feature (AMD) |
-| IBSOPCNTEXT | Instruction Based Sampling Feature (AMD) |
-| IBSOPSAM | Instruction Based Sampling Feature (AMD) |
-| IBSRDWROPCNT | Instruction Based Sampling Feature (AMD) |
-| IBSRIPINVALIDCHK | Instruction Based Sampling Feature (AMD) |
-| IBS_FETCH_CTLX | AMD: IBS fetch control extended MSR supported |
-| IBS_OPDATA4 | AMD: IBS op data 4 MSR supported |
-| IBS_OPFUSE | AMD: Indicates support for IbsOpFuse |
-| IBS_PREVENTHOST | Disallowing IBS use by the host supported |
-| IBS_ZEN4 | Fetch and Op IBS support IBS extensions added with Zen4 |
-| IDPRED_CTRL | IPRED_DIS |
-| INT_WBINVD | WBINVD/WBNOINVD are interruptible. |
-| INVLPGB | NVLPGB and TLBSYNC instruction supported |
-| KEYLOCKER | Key locker |
-| KEYLOCKERW | Key locker wide |
-| LAHF | LAHF/SAHF in long mode |
-| LAM | If set, CPU supports Linear Address Masking |
-| LBRVIRT | LBR virtualization |
-| LZCNT | LZCNT instruction |
-| MCAOVERFLOW | MCA overflow recovery support. |
-| MCDT_NO | Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. |
-| MCOMMIT | MCOMMIT instruction supported |
-| MD_CLEAR | VERW clears CPU buffers |
-| MMX | standard MMX |
-| MMXEXT | SSE integer functions or AMD MMX ext |
-| MOVBE | MOVBE instruction (big-endian) |
-| MOVDIR64B | Move 64 Bytes as Direct Store |
-| MOVDIRI | Move Doubleword as Direct Store |
-| MOVSB_ZL | Fast Zero-Length MOVSB |
-| MPX | Intel MPX (Memory Protection Extensions) |
-| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD |
-| MSRIRC | Instruction Retired Counter MSR available |
-| MSRLIST | Read/Write List of Model Specific Registers |
-| MSR_PAGEFLUSH | Page Flush MSR available |
-| NRIPS | Indicates support for NRIP save on VMEXIT |
-| NX | NX (No-Execute) bit |
-| OSXSAVE | XSAVE enabled by OS |
-| PCONFIG | PCONFIG for Intel Multi-Key Total Memory Encryption |
-| POPCNT | POPCNT instruction |
-| PPIN | AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled |
-| PREFETCHI | PREFETCHIT0/1 instructions |
-| PSFD | Predictive Store Forward Disable |
-| RDPRU | RDPRU instruction supported |
-| RDRAND | RDRAND instruction is available |
-| RDSEED | RDSEED instruction is available |
-| RDTSCP | RDTSCP Instruction |
-| RRSBA_CTRL | Restricted RSB Alternate |
-| RTM | Restricted Transactional Memory |
-| RTM_ALWAYS_ABORT | Indicates that the loaded microcode is forcing RTM abort. |
-| SERIALIZE | Serialize Instruction Execution |
-| SEV | AMD Secure Encrypted Virtualization supported |
-| SEV_64BIT | AMD SEV guest execution only allowed from a 64-bit host |
-| SEV_ALTERNATIVE | AMD SEV Alternate Injection supported |
-| SEV_DEBUGSWAP | Full debug state swap supported for SEV-ES guests |
-| SEV_ES | AMD SEV Encrypted State supported |
-| SEV_RESTRICTED | AMD SEV Restricted Injection supported |
-| SEV_SNP | AMD SEV Secure Nested Paging supported |
-| SGX | Software Guard Extensions |
-| SGXLC | Software Guard Extensions Launch Control |
-| SGXPQC | Software Guard Extensions 256-bit Encryption |
-| SHA | Intel SHA Extensions |
-| SME | AMD Secure Memory Encryption supported |
-| SME_COHERENT | AMD Hardware cache coherency across encryption domains enforced |
-| SM3_X86 | SM3 instructions |
-| SM4_X86 | SM4 instructions |
-| SPEC_CTRL_SSBD | Speculative Store Bypass Disable |
-| SRBDS_CTRL | SRBDS mitigation MSR available |
-| SSE | SSE functions |
-| SSE2 | P4 SSE functions |
-| SSE3 | Prescott SSE3 functions |
-| SSE4 | Penryn SSE4.1 functions |
-| SSE42 | Nehalem SSE4.2 functions |
-| SSE4A | AMD Barcelona microarchitecture SSE4a instructions |
-| SSSE3 | Conroe SSSE3 functions |
-| STIBP | Single Thread Indirect Branch Predictors |
-| STIBP_ALWAYSON | AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On |
-| STOSB_SHORT | Fast short STOSB |
-| SUCCOR | Software uncorrectable error containment and recovery capability. |
-| SVM | AMD Secure Virtual Machine |
-| SVMDA | Indicates support for the SVM decode assists. |
-| SVMFBASID | SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control |
-| SVML | AMD SVM lock. Indicates support for SVM-Lock. |
-| SVMNP | AMD SVM nested paging |
-| SVMPF | SVM pause intercept filter. Indicates support for the pause intercept filter |
-| SVMPFT | SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold |
-| SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. |
-| SYSEE | SYSENTER and SYSEXIT instructions |
-| TBM | AMD Trailing Bit Manipulation |
-| TDX_GUEST | Intel Trust Domain Extensions Guest |
-| TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations |
-| TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. |
-| TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. |
-| TSA_L1_NO | AMD only: Not vulnerable to TSA-L1 |
-| TSA_SQ_NO | AMD only: Not vulnerable to TSA-SQ |
-| TSA_VERW_CLEAR | AMD: If set, the memory form of the VERW instruction may be used to help mitigate TSA |
-| TSCRATEMSR | MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 |
-| TSXLDTRK | Intel TSX Suspend Load Address Tracking |
-| VAES | Vector AES. AVX(512) versions requires additional checks. |
-| VMCBCLEAN | VMCB clean bits. Indicates support for VMCB clean bits. |
-| VMPL | AMD VM Permission Levels supported |
-| VMSA_REGPROT | AMD VMSA Register Protection supported |
-| VMX | Virtual Machine Extensions |
-| VPCLMULQDQ | Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. |
-| VTE | AMD Virtual Transparent Encryption supported |
-| WAITPKG | TPAUSE, UMONITOR, UMWAIT |
-| WBNOINVD | Write Back and Do Not Invalidate Cache |
-| WRMSRNS | Non-Serializing Write to Model Specific Register |
-| X87 | FPU |
-| XGETBV1 | Supports XGETBV with ECX = 1 |
-| XOP | Bulldozer XOP functions |
-| XSAVE | XSAVE, XRESTOR, XSETBV, XGETBV |
-| XSAVEC | Supports XSAVEC and the compacted form of XRSTOR. |
-| XSAVEOPT | XSAVEOPT available |
-| XSAVES | Supports XSAVES/XRSTORS and IA32_XSS |
-
-# ARM features:
-
-| Feature Flag | Description |
-|--------------|------------------------------------------------------------------|
-| AESARM | AES instructions |
-| ARMCPUID | Some CPU ID registers readable at user-level |
-| ASIMD | Advanced SIMD |
-| ASIMDDP | SIMD Dot Product |
-| ASIMDHP | Advanced SIMD half-precision floating point |
-| ASIMDRDM | Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) |
-| ATOMICS | Large System Extensions (LSE) |
-| CRC32 | CRC32/CRC32C instructions |
-| DCPOP | Data cache clean to Point of Persistence (DC CVAP) |
-| EVTSTRM | Generic timer |
-| FCMA | Floatin point complex number addition and multiplication |
-| FHM | FMLAL and FMLSL instructions |
-| FP | Single-precision and double-precision floating point |
-| FPHP | Half-precision floating point |
-| GPA | Generic Pointer Authentication |
-| JSCVT | Javascript-style double->int convert (FJCVTZS) |
-| LRCPC | Weaker release consistency (LDAPR, etc) |
-| PMULL | Polynomial Multiply instructions (PMULL/PMULL2) |
-| RNDR | Random Number instructions |
-| TLB | Outer Shareable and TLB range maintenance instructions |
-| TS | Flag manipulation instructions |
-| SHA1 | SHA-1 instructions (SHA1C, etc) |
-| SHA2 | SHA-2 instructions (SHA256H, etc) |
-| SHA3 | SHA-3 instructions (EOR3, RAXI, XAR, BCAX) |
-| SHA512 | SHA512 instructions |
-| SM3 | SM3 instructions |
-| SM4 | SM4 instructions |
-| SVE | Scalable Vector Extension |
-
-# license
-
-This code is published under an MIT license. See LICENSE file for more information.
diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go
deleted file mode 100644
index 9cf7738a9..000000000
--- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go
+++ /dev/null
@@ -1,1679 +0,0 @@
-// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
-
-// Package cpuid provides information about the CPU running the current program.
-//
-// CPU features are detected on startup, and kept for fast access through the life of the application.
-// Currently x86 / x64 (AMD64) as well as arm64 is supported.
-//
-// You can access the CPU information by accessing the shared CPU variable of the cpuid library.
-//
-// Package home: https://github.com/klauspost/cpuid
-package cpuid
-
-import (
- "flag"
- "fmt"
- "math"
- "math/bits"
- "os"
- "runtime"
- "strings"
-)
-
-// AMD refererence: https://www.amd.com/system/files/TechDocs/25481.pdf
-// and Processor Programming Reference (PPR)
-
-// Vendor is a representation of a CPU vendor.
-type Vendor int
-
-const (
- VendorUnknown Vendor = iota
- Intel
- AMD
- VIA
- Transmeta
- NSC
- KVM // Kernel-based Virtual Machine
- MSVM // Microsoft Hyper-V or Windows Virtual PC
- VMware
- XenHVM
- Bhyve
- Hygon
- SiS
- RDC
-
- Ampere
- ARM
- Broadcom
- Cavium
- DEC
- Fujitsu
- Infineon
- Motorola
- NVIDIA
- AMCC
- Qualcomm
- Marvell
-
- QEMU
- QNX
- ACRN
- SRE
- Apple
-
- lastVendor
-)
-
-//go:generate stringer -type=FeatureID,Vendor
-
-// FeatureID is the ID of a specific cpu feature.
-type FeatureID int
-
-const (
- // Keep index -1 as unknown
- UNKNOWN = -1
-
- // x86 features
- ADX FeatureID = iota // Intel ADX (Multi-Precision Add-Carry Instruction Extensions)
- AESNI // Advanced Encryption Standard New Instructions
- AMD3DNOW // AMD 3DNOW
- AMD3DNOWEXT // AMD 3DNowExt
- AMXBF16 // Tile computational operations on BFLOAT16 numbers
- AMXFP16 // Tile computational operations on FP16 numbers
- AMXINT8 // Tile computational operations on 8-bit integers
- AMXFP8 // Tile computational operations on FP8 numbers
- AMXTILE // Tile architecture
- AMXTF32 // Tile architecture
- AMXCOMPLEX // Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile
- AMXTRANSPOSE // Tile multiply where the first operand is transposed
- APX_F // Intel APX
- AVX // AVX functions
- AVX10 // If set the Intel AVX10 Converged Vector ISA is supported
- AVX10_128 // If set indicates that AVX10 128-bit vector support is present
- AVX10_256 // If set indicates that AVX10 256-bit vector support is present
- AVX10_512 // If set indicates that AVX10 512-bit vector support is present
- AVX2 // AVX2 functions
- AVX512BF16 // AVX-512 BFLOAT16 Instructions
- AVX512BITALG // AVX-512 Bit Algorithms
- AVX512BW // AVX-512 Byte and Word Instructions
- AVX512CD // AVX-512 Conflict Detection Instructions
- AVX512DQ // AVX-512 Doubleword and Quadword Instructions
- AVX512ER // AVX-512 Exponential and Reciprocal Instructions
- AVX512F // AVX-512 Foundation
- AVX512FP16 // AVX-512 FP16 Instructions
- AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions
- AVX512PF // AVX-512 Prefetch Instructions
- AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions
- AVX512VBMI2 // AVX-512 Vector Bit Manipulation Instructions, Version 2
- AVX512VL // AVX-512 Vector Length Extensions
- AVX512VNNI // AVX-512 Vector Neural Network Instructions
- AVX512VP2INTERSECT // AVX-512 Intersect for D/Q
- AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword
- AVXIFMA // AVX-IFMA instructions
- AVXNECONVERT // AVX-NE-CONVERT instructions
- AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one
- AVXVNNI // AVX (VEX encoded) VNNI neural network instructions
- AVXVNNIINT8 // AVX-VNNI-INT8 instructions
- AVXVNNIINT16 // AVX-VNNI-INT16 instructions
- BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598
- BMI1 // Bit Manipulation Instruction Set 1
- BMI2 // Bit Manipulation Instruction Set 2
- CETIBT // Intel CET Indirect Branch Tracking
- CETSS // Intel CET Shadow Stack
- CLDEMOTE // Cache Line Demote
- CLMUL // Carry-less Multiplication
- CLZERO // CLZERO instruction supported
- CMOV // i686 CMOV
- CMPCCXADD // CMPCCXADD instructions
- CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB
- CMPXCHG8 // CMPXCHG8 instruction
- CPBOOST // Core Performance Boost
- CPPC // AMD: Collaborative Processor Performance Control
- CX16 // CMPXCHG16B Instruction
- EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ
- ENQCMD // Enqueue Command
- ERMS // Enhanced REP MOVSB/STOSB
- F16C // Half-precision floating-point conversion
- FLUSH_L1D // Flush L1D cache
- FMA3 // Intel FMA 3. Does not imply AVX.
- FMA4 // Bulldozer FMA4 functions
- FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide
- FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide
- FSRM // Fast Short Rep Mov
- FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9
- FXSROPT // FXSAVE/FXRSTOR optimizations
- GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage.
- HLE // Hardware Lock Elision
- HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR
- HTT // Hyperthreading (enabled)
- HWA // Hardware assert supported. Indicates support for MSRC001_10
- HYBRID_CPU // This part has CPUs of more than one type.
- HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors
- IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel)
- IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR
- IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB)
- IBPB_BRTYPE // Indicates that MSR 49h (PRED_CMD) bit 0 (IBPB) flushes all branch type predictions from the CPU branch predictor
- IBRS // AMD: Indirect Branch Restricted Speculation
- IBRS_PREFERRED // AMD: IBRS is preferred over software solution
- IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection
- IBS // Instruction Based Sampling (AMD)
- IBSBRNTRGT // Instruction Based Sampling Feature (AMD)
- IBSFETCHSAM // Instruction Based Sampling Feature (AMD)
- IBSFFV // Instruction Based Sampling Feature (AMD)
- IBSOPCNT // Instruction Based Sampling Feature (AMD)
- IBSOPCNTEXT // Instruction Based Sampling Feature (AMD)
- IBSOPSAM // Instruction Based Sampling Feature (AMD)
- IBSRDWROPCNT // Instruction Based Sampling Feature (AMD)
- IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD)
- IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported
- IBS_OPDATA4 // AMD: IBS op data 4 MSR supported
- IBS_OPFUSE // AMD: Indicates support for IbsOpFuse
- IBS_PREVENTHOST // Disallowing IBS use by the host supported
- IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4
- IDPRED_CTRL // IPRED_DIS
- INT_WBINVD // WBINVD/WBNOINVD are interruptible.
- INVLPGB // NVLPGB and TLBSYNC instruction supported
- KEYLOCKER // Key locker
- KEYLOCKERW // Key locker wide
- LAHF // LAHF/SAHF in long mode
- LAM // If set, CPU supports Linear Address Masking
- LBRVIRT // LBR virtualization
- LZCNT // LZCNT instruction
- MCAOVERFLOW // MCA overflow recovery support.
- MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it.
- MCOMMIT // MCOMMIT instruction supported
- MD_CLEAR // VERW clears CPU buffers
- MMX // standard MMX
- MMXEXT // SSE integer functions or AMD MMX ext
- MOVBE // MOVBE instruction (big-endian)
- MOVDIR64B // Move 64 Bytes as Direct Store
- MOVDIRI // Move Doubleword as Direct Store
- MOVSB_ZL // Fast Zero-Length MOVSB
- MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD
- MPX // Intel MPX (Memory Protection Extensions)
- MSRIRC // Instruction Retired Counter MSR available
- MSRLIST // Read/Write List of Model Specific Registers
- MSR_PAGEFLUSH // Page Flush MSR available
- NRIPS // Indicates support for NRIP save on VMEXIT
- NX // NX (No-Execute) bit
- OSXSAVE // XSAVE enabled by OS
- PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption
- POPCNT // POPCNT instruction
- PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled
- PREFETCHI // PREFETCHIT0/1 instructions
- PSFD // Predictive Store Forward Disable
- RDPRU // RDPRU instruction supported
- RDRAND // RDRAND instruction is available
- RDSEED // RDSEED instruction is available
- RDTSCP // RDTSCP Instruction
- RRSBA_CTRL // Restricted RSB Alternate
- RTM // Restricted Transactional Memory
- RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort.
- SBPB // Indicates support for the Selective Branch Predictor Barrier
- SERIALIZE // Serialize Instruction Execution
- SEV // AMD Secure Encrypted Virtualization supported
- SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host
- SEV_ALTERNATIVE // AMD SEV Alternate Injection supported
- SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests
- SEV_ES // AMD SEV Encrypted State supported
- SEV_RESTRICTED // AMD SEV Restricted Injection supported
- SEV_SNP // AMD SEV Secure Nested Paging supported
- SGX // Software Guard Extensions
- SGXLC // Software Guard Extensions Launch Control
- SGXPQC // Software Guard Extensions 256-bit Encryption
- SHA // Intel SHA Extensions
- SME // AMD Secure Memory Encryption supported
- SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced
- SM3_X86 // SM3 instructions
- SM4_X86 // SM4 instructions
- SPEC_CTRL_SSBD // Speculative Store Bypass Disable
- SRBDS_CTRL // SRBDS mitigation MSR available
- SRSO_MSR_FIX // Indicates that software may use MSR BP_CFG[BpSpecReduce] to mitigate SRSO.
- SRSO_NO // Indicates the CPU is not subject to the SRSO vulnerability
- SRSO_USER_KERNEL_NO // Indicates the CPU is not subject to the SRSO vulnerability across user/kernel boundaries
- SSE // SSE functions
- SSE2 // P4 SSE functions
- SSE3 // Prescott SSE3 functions
- SSE4 // Penryn SSE4.1 functions
- SSE42 // Nehalem SSE4.2 functions
- SSE4A // AMD Barcelona microarchitecture SSE4a instructions
- SSSE3 // Conroe SSSE3 functions
- STIBP // Single Thread Indirect Branch Predictors
- STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On
- STOSB_SHORT // Fast short STOSB
- SUCCOR // Software uncorrectable error containment and recovery capability.
- SVM // AMD Secure Virtual Machine
- SVMDA // Indicates support for the SVM decode assists.
- SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control
- SVML // AMD SVM lock. Indicates support for SVM-Lock.
- SVMNP // AMD SVM nested paging
- SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter
- SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold
- SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions.
- SYSEE // SYSENTER and SYSEXIT instructions
- TBM // AMD Trailing Bit Manipulation
- TDX_GUEST // Intel Trust Domain Extensions Guest
- TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations
- TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE.
- TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX.
- TSA_L1_NO // AMD only: Not vulnerable to TSA-L1
- TSA_SQ_NO // AM onlyD: Not vulnerable to TSA-SQ
- TSA_VERW_CLEAR // If set, the memory form of the VERW instruction may be used to help mitigate TSA
- TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104
- TSXLDTRK // Intel TSX Suspend Load Address Tracking
- VAES // Vector AES. AVX(512) versions requires additional checks.
- VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits.
- VMPL // AMD VM Permission Levels supported
- VMSA_REGPROT // AMD VMSA Register Protection supported
- VMX // Virtual Machine Extensions
- VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions.
- VTE // AMD Virtual Transparent Encryption supported
- WAITPKG // TPAUSE, UMONITOR, UMWAIT
- WBNOINVD // Write Back and Do Not Invalidate Cache
- WRMSRNS // Non-Serializing Write to Model Specific Register
- X87 // FPU
- XGETBV1 // Supports XGETBV with ECX = 1
- XOP // Bulldozer XOP functions
- XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV
- XSAVEC // Supports XSAVEC and the compacted form of XRSTOR.
- XSAVEOPT // XSAVEOPT available
- XSAVES // Supports XSAVES/XRSTORS and IA32_XSS
-
- // ARM features:
- AESARM // AES instructions
- ARMCPUID // Some CPU ID registers readable at user-level
- ASIMD // Advanced SIMD
- ASIMDDP // SIMD Dot Product
- ASIMDHP // Advanced SIMD half-precision floating point
- ASIMDRDM // Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH)
- ATOMICS // Large System Extensions (LSE)
- CRC32 // CRC32/CRC32C instructions
- DCPOP // Data cache clean to Point of Persistence (DC CVAP)
- EVTSTRM // Generic timer
- FCMA // Floating point complex number addition and multiplication
- FHM // FMLAL and FMLSL instructions
- FP // Single-precision and double-precision floating point
- FPHP // Half-precision floating point
- GPA // Generic Pointer Authentication
- JSCVT // Javascript-style double->int convert (FJCVTZS)
- LRCPC // Weaker release consistency (LDAPR, etc)
- PMULL // Polynomial Multiply instructions (PMULL/PMULL2)
- RNDR // Random Number instructions
- TLB // Outer Shareable and TLB range maintenance instructions
- TS // Flag manipulation instructions
- SHA1 // SHA-1 instructions (SHA1C, etc)
- SHA2 // SHA-2 instructions (SHA256H, etc)
- SHA3 // SHA-3 instructions (EOR3, RAXI, XAR, BCAX)
- SHA512 // SHA512 instructions
- SM3 // SM3 instructions
- SM4 // SM4 instructions
- SVE // Scalable Vector Extension
-
- // PMU
- PMU_FIXEDCOUNTER_CYCLES
- PMU_FIXEDCOUNTER_REFCYCLES
- PMU_FIXEDCOUNTER_INSTRUCTIONS
- PMU_FIXEDCOUNTER_TOPDOWN_SLOTS
-
- // Keep it last. It automatically defines the size of []flagSet
- lastID
-
- firstID FeatureID = UNKNOWN + 1
-)
-
-// CPUInfo contains information about the detected system CPU.
-type CPUInfo struct {
- BrandName string // Brand name reported by the CPU
- VendorID Vendor // Comparable CPU vendor ID
- VendorString string // Raw vendor string.
- HypervisorVendorID Vendor // Hypervisor vendor
- HypervisorVendorString string // Raw hypervisor vendor string
- featureSet flagSet // Features of the CPU
- PhysicalCores int // Number of physical processor cores in your CPU. Will be 0 if undetectable.
- ThreadsPerCore int // Number of threads per physical core. Will be 1 if undetectable.
- LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable.
- Family int // CPU family number
- Model int // CPU model number
- Stepping int // CPU stepping info
- CacheLine int // Cache line size in bytes. Will be 0 if undetectable.
- Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed.
- BoostFreq int64 // Max clock speed, if known, 0 otherwise
- Cache struct {
- L1I int // L1 Instruction Cache (per core or shared). Will be -1 if undetected
- L1D int // L1 Data Cache (per core or shared). Will be -1 if undetected
- L2 int // L2 Cache (per core or shared). Will be -1 if undetected
- L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected
- }
- SGX SGXSupport
- AMDMemEncryption AMDMemEncryptionSupport
- AVX10Level uint8
- PMU PerformanceMonitoringInfo // holds information about the PMU
-
- maxFunc uint32
- maxExFunc uint32
-}
-
-// PerformanceMonitoringInfo holds information about CPU performance monitoring capabilities.
-// This is primarily populated from CPUID leaf 0xAh on x86
-type PerformanceMonitoringInfo struct {
- // VersionID (x86 only): Version ID of architectural performance monitoring.
- // A value of 0 means architectural performance monitoring is not supported or information is unavailable.
- VersionID uint8
- // NumGPPMC: Number of General-Purpose Performance Monitoring Counters per logical processor.
- // On ARM, this is derived from PMCR_EL0.N (number of event counters).
- NumGPCounters uint8
- // GPPMCWidth: Bit width of General-Purpose Performance Monitoring Counters.
- // On ARM, typically 64 for PMU event counters.
- GPPMCWidth uint8
- // NumFixedPMC: Number of Fixed-Function Performance Counters.
- // Valid on x86 if VersionID > 1. On ARM, this typically includes at least the cycle counter (PMCCNTR_EL0).
- NumFixedPMC uint8
- // FixedPMCWidth: Bit width of Fixed-Function Performance Counters.
- // Valid on x86 if VersionID > 1. On ARM, the cycle counter (PMCCNTR_EL0) is 64-bit.
- FixedPMCWidth uint8
- // Raw register output from CPUID leaf 0xAh.
- RawEBX uint32
- RawEAX uint32
- RawEDX uint32
-}
-
-var cpuid func(op uint32) (eax, ebx, ecx, edx uint32)
-var cpuidex func(op, op2 uint32) (eax, ebx, ecx, edx uint32)
-var xgetbv func(index uint32) (eax, edx uint32)
-var rdtscpAsm func() (eax, ebx, ecx, edx uint32)
-var darwinHasAVX512 = func() bool { return false }
-
-// CPU contains information about the CPU as detected on startup,
-// or when Detect last was called.
-//
-// Use this as the primary entry point to you data.
-var CPU CPUInfo
-
-func init() {
- initCPU()
- Detect()
-}
-
-// Detect will re-detect current CPU info.
-// This will replace the content of the exported CPU variable.
-//
-// Unless you expect the CPU to change while you are running your program
-// you should not need to call this function.
-// If you call this, you must ensure that no other goroutine is accessing the
-// exported CPU variable.
-func Detect() {
- // Set defaults
- CPU.ThreadsPerCore = 1
- CPU.Cache.L1I = -1
- CPU.Cache.L1D = -1
- CPU.Cache.L2 = -1
- CPU.Cache.L3 = -1
- safe := true
- if detectArmFlag != nil {
- safe = !*detectArmFlag
- }
- addInfo(&CPU, safe)
- if displayFeats != nil && *displayFeats {
- fmt.Println("cpu features:", strings.Join(CPU.FeatureSet(), ","))
- // Exit with non-zero so tests will print value.
- os.Exit(1)
- }
- if disableFlag != nil {
- s := strings.Split(*disableFlag, ",")
- for _, feat := range s {
- feat := ParseFeature(strings.TrimSpace(feat))
- if feat != UNKNOWN {
- CPU.featureSet.unset(feat)
- }
- }
- }
-}
-
-// DetectARM will detect ARM64 features.
-// This is NOT done automatically since it can potentially crash
-// if the OS does not handle the command.
-// If in the future this can be done safely this function may not
-// do anything.
-func DetectARM() {
- addInfo(&CPU, false)
-}
-
-var detectArmFlag *bool
-var displayFeats *bool
-var disableFlag *string
-
-// Flags will enable flags.
-// This must be called *before* flag.Parse AND
-// Detect must be called after the flags have been parsed.
-// Note that this means that any detection used in init() functions
-// will not contain these flags.
-func Flags() {
- disableFlag = flag.String("cpu.disable", "", "disable cpu features; comma separated list")
- displayFeats = flag.Bool("cpu.features", false, "lists cpu features and exits")
- detectArmFlag = flag.Bool("cpu.arm", false, "allow ARM features to be detected; can potentially crash")
-}
-
-// Supports returns whether the CPU supports all of the requested features.
-func (c CPUInfo) Supports(ids ...FeatureID) bool {
- for _, id := range ids {
- if !c.featureSet.inSet(id) {
- return false
- }
- }
- return true
-}
-
-// Has allows for checking a single feature.
-// Should be inlined by the compiler.
-func (c *CPUInfo) Has(id FeatureID) bool {
- return c.featureSet.inSet(id)
-}
-
-// AnyOf returns whether the CPU supports one or more of the requested features.
-func (c CPUInfo) AnyOf(ids ...FeatureID) bool {
- for _, id := range ids {
- if c.featureSet.inSet(id) {
- return true
- }
- }
- return false
-}
-
-// Features contains several features combined for a fast check using
-// CpuInfo.HasAll
-type Features *flagSet
-
-// CombineFeatures allows to combine several features for a close to constant time lookup.
-func CombineFeatures(ids ...FeatureID) Features {
- var v flagSet
- for _, id := range ids {
- v.set(id)
- }
- return &v
-}
-
-func (c *CPUInfo) HasAll(f Features) bool {
- return c.featureSet.hasSetP(f)
-}
-
-// https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels
-var oneOfLevel = CombineFeatures(SYSEE, SYSCALL)
-var level1Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2)
-var level2Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3)
-var level3Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE)
-var level4Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE, AVX512F, AVX512BW, AVX512CD, AVX512DQ, AVX512VL)
-
-// X64Level returns the microarchitecture level detected on the CPU.
-// If features are lacking or non x64 mode, 0 is returned.
-// See https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels
-func (c CPUInfo) X64Level() int {
- if !c.featureSet.hasOneOf(oneOfLevel) {
- return 0
- }
- if c.featureSet.hasSetP(level4Features) {
- return 4
- }
- if c.featureSet.hasSetP(level3Features) {
- return 3
- }
- if c.featureSet.hasSetP(level2Features) {
- return 2
- }
- if c.featureSet.hasSetP(level1Features) {
- return 1
- }
- return 0
-}
-
-// Disable will disable one or several features.
-func (c *CPUInfo) Disable(ids ...FeatureID) bool {
- for _, id := range ids {
- c.featureSet.unset(id)
- }
- return true
-}
-
-// Enable will disable one or several features even if they were undetected.
-// This is of course not recommended for obvious reasons.
-func (c *CPUInfo) Enable(ids ...FeatureID) bool {
- for _, id := range ids {
- c.featureSet.set(id)
- }
- return true
-}
-
-// IsVendor returns true if vendor is recognized as Intel
-func (c CPUInfo) IsVendor(v Vendor) bool {
- return c.VendorID == v
-}
-
-// FeatureSet returns all available features as strings.
-func (c CPUInfo) FeatureSet() []string {
- s := make([]string, 0, c.featureSet.nEnabled())
- s = append(s, c.featureSet.Strings()...)
- return s
-}
-
-// RTCounter returns the 64-bit time-stamp counter
-// Uses the RDTSCP instruction. The value 0 is returned
-// if the CPU does not support the instruction.
-func (c CPUInfo) RTCounter() uint64 {
- if !c.Has(RDTSCP) {
- return 0
- }
- a, _, _, d := rdtscpAsm()
- return uint64(a) | (uint64(d) << 32)
-}
-
-// Ia32TscAux returns the IA32_TSC_AUX part of the RDTSCP.
-// This variable is OS dependent, but on Linux contains information
-// about the current cpu/core the code is running on.
-// If the RDTSCP instruction isn't supported on the CPU, the value 0 is returned.
-func (c CPUInfo) Ia32TscAux() uint32 {
- if !c.Has(RDTSCP) {
- return 0
- }
- _, _, ecx, _ := rdtscpAsm()
- return ecx
-}
-
-// SveLengths returns arm SVE vector and predicate lengths in bits.
-// Will return 0, 0 if SVE is not enabled or otherwise unable to detect.
-func (c CPUInfo) SveLengths() (vl, pl uint64) {
- if !c.Has(SVE) {
- return 0, 0
- }
- return getVectorLength()
-}
-
-// LogicalCPU will return the Logical CPU the code is currently executing on.
-// This is likely to change when the OS re-schedules the running thread
-// to another CPU.
-// If the current core cannot be detected, -1 will be returned.
-func (c CPUInfo) LogicalCPU() int {
- if c.maxFunc < 1 {
- return -1
- }
- _, ebx, _, _ := cpuid(1)
- return int(ebx >> 24)
-}
-
-// frequencies tries to compute the clock speed of the CPU. If leaf 15 is
-// supported, use it, otherwise parse the brand string. Yes, really.
-func (c *CPUInfo) frequencies() {
- c.Hz, c.BoostFreq = 0, 0
- mfi := maxFunctionID()
- if mfi >= 0x15 {
- eax, ebx, ecx, _ := cpuid(0x15)
- if eax != 0 && ebx != 0 && ecx != 0 {
- c.Hz = (int64(ecx) * int64(ebx)) / int64(eax)
- }
- }
- if mfi >= 0x16 {
- a, b, _, _ := cpuid(0x16)
- // Base...
- if a&0xffff > 0 {
- c.Hz = int64(a&0xffff) * 1_000_000
- }
- // Boost...
- if b&0xffff > 0 {
- c.BoostFreq = int64(b&0xffff) * 1_000_000
- }
- }
- if c.Hz > 0 {
- return
- }
-
- // computeHz determines the official rated speed of a CPU from its brand
- // string. This insanity is *actually the official documented way to do
- // this according to Intel*, prior to leaf 0x15 existing. The official
- // documentation only shows this working for exactly `x.xx` or `xxxx`
- // cases, e.g., `2.50GHz` or `1300MHz`; this parser will accept other
- // sizes.
- model := c.BrandName
- hz := strings.LastIndex(model, "Hz")
- if hz < 3 {
- return
- }
- var multiplier int64
- switch model[hz-1] {
- case 'M':
- multiplier = 1000 * 1000
- case 'G':
- multiplier = 1000 * 1000 * 1000
- case 'T':
- multiplier = 1000 * 1000 * 1000 * 1000
- }
- if multiplier == 0 {
- return
- }
- freq := int64(0)
- divisor := int64(0)
- decimalShift := int64(1)
- var i int
- for i = hz - 2; i >= 0 && model[i] != ' '; i-- {
- if model[i] >= '0' && model[i] <= '9' {
- freq += int64(model[i]-'0') * decimalShift
- decimalShift *= 10
- } else if model[i] == '.' {
- if divisor != 0 {
- return
- }
- divisor = decimalShift
- } else {
- return
- }
- }
- // we didn't find a space
- if i < 0 {
- return
- }
- if divisor != 0 {
- c.Hz = (freq * multiplier) / divisor
- return
- }
- c.Hz = freq * multiplier
-}
-
-// VM Will return true if the cpu id indicates we are in
-// a virtual machine.
-func (c CPUInfo) VM() bool {
- return CPU.featureSet.inSet(HYPERVISOR)
-}
-
-// flags contains detected cpu features and characteristics
-type flags uint64
-
-// log2(bits_in_uint64)
-const flagBitsLog2 = 6
-const flagBits = 1 << flagBitsLog2
-const flagMask = flagBits - 1
-
-// flagSet contains detected cpu features and characteristics in an array of flags
-type flagSet [(lastID + flagMask) / flagBits]flags
-
-func (s *flagSet) inSet(feat FeatureID) bool {
- return s[feat>>flagBitsLog2]&(1<<(feat&flagMask)) != 0
-}
-
-func (s *flagSet) set(feat FeatureID) {
- s[feat>>flagBitsLog2] |= 1 << (feat & flagMask)
-}
-
-// setIf will set a feature if boolean is true.
-func (s *flagSet) setIf(cond bool, features ...FeatureID) {
- if cond {
- for _, offset := range features {
- s[offset>>flagBitsLog2] |= 1 << (offset & flagMask)
- }
- }
-}
-
-func (s *flagSet) unset(offset FeatureID) {
- bit := flags(1 << (offset & flagMask))
- s[offset>>flagBitsLog2] = s[offset>>flagBitsLog2] & ^bit
-}
-
-// or with another flagset.
-func (s *flagSet) or(other flagSet) {
- for i, v := range other[:] {
- s[i] |= v
- }
-}
-
-// hasSet returns whether all features are present.
-func (s *flagSet) hasSet(other flagSet) bool {
- for i, v := range other[:] {
- if s[i]&v != v {
- return false
- }
- }
- return true
-}
-
-// hasSet returns whether all features are present.
-func (s *flagSet) hasSetP(other *flagSet) bool {
- for i, v := range other[:] {
- if s[i]&v != v {
- return false
- }
- }
- return true
-}
-
-// hasOneOf returns whether one or more features are present.
-func (s *flagSet) hasOneOf(other *flagSet) bool {
- for i, v := range other[:] {
- if s[i]&v != 0 {
- return true
- }
- }
- return false
-}
-
-// nEnabled will return the number of enabled flags.
-func (s *flagSet) nEnabled() (n int) {
- for _, v := range s[:] {
- n += bits.OnesCount64(uint64(v))
- }
- return n
-}
-
-func flagSetWith(feat ...FeatureID) flagSet {
- var res flagSet
- for _, f := range feat {
- res.set(f)
- }
- return res
-}
-
-// ParseFeature will parse the string and return the ID of the matching feature.
-// Will return UNKNOWN if not found.
-func ParseFeature(s string) FeatureID {
- s = strings.ToUpper(s)
- for i := firstID; i < lastID; i++ {
- if i.String() == s {
- return i
- }
- }
- return UNKNOWN
-}
-
-// Strings returns an array of the detected features for FlagsSet.
-func (s flagSet) Strings() []string {
- if len(s) == 0 {
- return []string{""}
- }
- r := make([]string, 0)
- for i := firstID; i < lastID; i++ {
- if s.inSet(i) {
- r = append(r, i.String())
- }
- }
- return r
-}
-
-func maxExtendedFunction() uint32 {
- eax, _, _, _ := cpuid(0x80000000)
- return eax
-}
-
-func maxFunctionID() uint32 {
- a, _, _, _ := cpuid(0)
- return a
-}
-
-func brandName() string {
- if maxExtendedFunction() >= 0x80000004 {
- v := make([]uint32, 0, 48)
- for i := uint32(0); i < 3; i++ {
- a, b, c, d := cpuid(0x80000002 + i)
- v = append(v, a, b, c, d)
- }
- return strings.Trim(string(valAsString(v...)), " ")
- }
- return "unknown"
-}
-
-func threadsPerCore() int {
- mfi := maxFunctionID()
- vend, _ := vendorID()
-
- if mfi < 0x4 || (vend != Intel && vend != AMD) {
- return 1
- }
-
- if mfi < 0xb {
- if vend != Intel {
- return 1
- }
- _, b, _, d := cpuid(1)
- if (d & (1 << 28)) != 0 {
- // v will contain logical core count
- v := (b >> 16) & 255
- if v > 1 {
- a4, _, _, _ := cpuid(4)
- // physical cores
- v2 := (a4 >> 26) + 1
- if v2 > 0 {
- return int(v) / int(v2)
- }
- }
- }
- return 1
- }
- _, b, _, _ := cpuidex(0xb, 0)
- if b&0xffff == 0 {
- if vend == AMD {
- // if >= Zen 2 0x8000001e EBX 15-8 bits means threads per core.
- // The number of threads per core is ThreadsPerCore+1
- // See PPR for AMD Family 17h Models 00h-0Fh (page 82)
- fam, _, _ := familyModel()
- _, _, _, d := cpuid(1)
- if (d&(1<<28)) != 0 && fam >= 23 {
- if maxExtendedFunction() >= 0x8000001e {
- _, b, _, _ := cpuid(0x8000001e)
- return int((b>>8)&0xff) + 1
- }
- return 2
- }
- }
- return 1
- }
- return int(b & 0xffff)
-}
-
-func logicalCores() int {
- mfi := maxFunctionID()
- v, _ := vendorID()
- switch v {
- case Intel:
- // Use this on old Intel processors
- if mfi < 0xb {
- if mfi < 1 {
- return 0
- }
- // CPUID.1:EBX[23:16] represents the maximum number of addressable IDs (initial APIC ID)
- // that can be assigned to logical processors in a physical package.
- // The value may not be the same as the number of logical processors that are present in the hardware of a physical package.
- _, ebx, _, _ := cpuid(1)
- logical := (ebx >> 16) & 0xff
- return int(logical)
- }
- _, b, _, _ := cpuidex(0xb, 1)
- return int(b & 0xffff)
- case AMD, Hygon:
- _, b, _, _ := cpuid(1)
- return int((b >> 16) & 0xff)
- default:
- return 0
- }
-}
-
-func familyModel() (family, model, stepping int) {
- if maxFunctionID() < 0x1 {
- return 0, 0, 0
- }
- eax, _, _, _ := cpuid(1)
- // If BaseFamily[3:0] is less than Fh then ExtendedFamily[7:0] is reserved and Family is equal to BaseFamily[3:0].
- family = int((eax >> 8) & 0xf)
- extFam := family == 0x6 // Intel is 0x6, needs extended model.
- if family == 0xf {
- // Add ExtFamily
- family += int((eax >> 20) & 0xff)
- extFam = true
- }
- // If BaseFamily[3:0] is less than 0Fh then ExtendedModel[3:0] is reserved and Model is equal to BaseModel[3:0].
- model = int((eax >> 4) & 0xf)
- if extFam {
- // Add ExtModel
- model += int((eax >> 12) & 0xf0)
- }
- stepping = int(eax & 0xf)
- return family, model, stepping
-}
-
-func physicalCores() int {
- v, _ := vendorID()
- switch v {
- case Intel:
- lc := logicalCores()
- tpc := threadsPerCore()
- if lc > 0 && tpc > 0 {
- return lc / tpc
- }
- return 0
- case AMD, Hygon:
- lc := logicalCores()
- tpc := threadsPerCore()
- if lc > 0 && tpc > 0 {
- return lc / tpc
- }
-
- // The following is inaccurate on AMD EPYC 7742 64-Core Processor
- if maxExtendedFunction() >= 0x80000008 {
- _, _, c, _ := cpuid(0x80000008)
- if c&0xff > 0 {
- return int(c&0xff) + 1
- }
- }
- }
- return 0
-}
-
-// Except from http://en.wikipedia.org/wiki/CPUID#EAX.3D0:_Get_vendor_ID
-var vendorMapping = map[string]Vendor{
- "AMDisbetter!": AMD,
- "AuthenticAMD": AMD,
- "CentaurHauls": VIA,
- "GenuineIntel": Intel,
- "TransmetaCPU": Transmeta,
- "GenuineTMx86": Transmeta,
- "Geode by NSC": NSC,
- "VIA VIA VIA ": VIA,
- "KVMKVMKVM": KVM,
- "Linux KVM Hv": KVM,
- "TCGTCGTCGTCG": QEMU,
- "Microsoft Hv": MSVM,
- "VMwareVMware": VMware,
- "XenVMMXenVMM": XenHVM,
- "bhyve bhyve ": Bhyve,
- "HygonGenuine": Hygon,
- "Vortex86 SoC": SiS,
- "SiS SiS SiS ": SiS,
- "RiseRiseRise": SiS,
- "Genuine RDC": RDC,
- "QNXQVMBSQG": QNX,
- "ACRNACRNACRN": ACRN,
- "SRESRESRESRE": SRE,
- "Apple VZ": Apple,
-}
-
-func vendorID() (Vendor, string) {
- _, b, c, d := cpuid(0)
- v := string(valAsString(b, d, c))
- vend, ok := vendorMapping[v]
- if !ok {
- return VendorUnknown, v
- }
- return vend, v
-}
-
-func hypervisorVendorID() (Vendor, string) {
- // https://lwn.net/Articles/301888/
- _, b, c, d := cpuid(0x40000000)
- v := string(valAsString(b, c, d))
- vend, ok := vendorMapping[v]
- if !ok {
- return VendorUnknown, v
- }
- return vend, v
-}
-
-func cacheLine() int {
- if maxFunctionID() < 0x1 {
- return 0
- }
-
- _, ebx, _, _ := cpuid(1)
- cache := (ebx & 0xff00) >> 5 // cflush size
- if cache == 0 && maxExtendedFunction() >= 0x80000006 {
- _, _, ecx, _ := cpuid(0x80000006)
- cache = ecx & 0xff // cacheline size
- }
- // TODO: Read from Cache and TLB Information
- return int(cache)
-}
-
-func (c *CPUInfo) cacheSize() {
- c.Cache.L1D = -1
- c.Cache.L1I = -1
- c.Cache.L2 = -1
- c.Cache.L3 = -1
- vendor, _ := vendorID()
- switch vendor {
- case Intel:
- if maxFunctionID() < 4 {
- return
- }
- c.Cache.L1I, c.Cache.L1D, c.Cache.L2, c.Cache.L3 = 0, 0, 0, 0
- for i := uint32(0); ; i++ {
- eax, ebx, ecx, _ := cpuidex(4, i)
- cacheType := eax & 15
- if cacheType == 0 {
- break
- }
- cacheLevel := (eax >> 5) & 7
- coherency := int(ebx&0xfff) + 1
- partitions := int((ebx>>12)&0x3ff) + 1
- associativity := int((ebx>>22)&0x3ff) + 1
- sets := int(ecx) + 1
- size := associativity * partitions * coherency * sets
- switch cacheLevel {
- case 1:
- if cacheType == 1 {
- // 1 = Data Cache
- c.Cache.L1D = size
- } else if cacheType == 2 {
- // 2 = Instruction Cache
- c.Cache.L1I = size
- } else {
- if c.Cache.L1D < 0 {
- c.Cache.L1I = size
- }
- if c.Cache.L1I < 0 {
- c.Cache.L1I = size
- }
- }
- case 2:
- c.Cache.L2 = size
- case 3:
- c.Cache.L3 = size
- }
- }
- case AMD, Hygon:
- // Untested.
- if maxExtendedFunction() < 0x80000005 {
- return
- }
- _, _, ecx, edx := cpuid(0x80000005)
- c.Cache.L1D = int(((ecx >> 24) & 0xFF) * 1024)
- c.Cache.L1I = int(((edx >> 24) & 0xFF) * 1024)
-
- if maxExtendedFunction() < 0x80000006 {
- return
- }
- _, _, ecx, _ = cpuid(0x80000006)
- c.Cache.L2 = int(((ecx >> 16) & 0xFFFF) * 1024)
-
- // CPUID Fn8000_001D_EAX_x[N:0] Cache Properties
- if maxExtendedFunction() < 0x8000001D || !c.Has(TOPEXT) {
- return
- }
-
- // Xen Hypervisor is buggy and returns the same entry no matter ECX value.
- // Hack: When we encounter the same entry 100 times we break.
- nSame := 0
- var last uint32
- for i := uint32(0); i < math.MaxUint32; i++ {
- eax, ebx, ecx, _ := cpuidex(0x8000001D, i)
-
- level := (eax >> 5) & 7
- cacheNumSets := ecx + 1
- cacheLineSize := 1 + (ebx & 2047)
- cachePhysPartitions := 1 + ((ebx >> 12) & 511)
- cacheNumWays := 1 + ((ebx >> 22) & 511)
-
- typ := eax & 15
- size := int(cacheNumSets * cacheLineSize * cachePhysPartitions * cacheNumWays)
- if typ == 0 {
- return
- }
-
- // Check for the same value repeated.
- comb := eax ^ ebx ^ ecx
- if comb == last {
- nSame++
- if nSame == 100 {
- return
- }
- }
- last = comb
-
- switch level {
- case 1:
- switch typ {
- case 1:
- // Data cache
- c.Cache.L1D = size
- case 2:
- // Inst cache
- c.Cache.L1I = size
- default:
- if c.Cache.L1D < 0 {
- c.Cache.L1I = size
- }
- if c.Cache.L1I < 0 {
- c.Cache.L1I = size
- }
- }
- case 2:
- c.Cache.L2 = size
- case 3:
- c.Cache.L3 = size
- }
- }
- }
-}
-
-type SGXEPCSection struct {
- BaseAddress uint64
- EPCSize uint64
-}
-
-type SGXSupport struct {
- Available bool
- LaunchControl bool
- SGX1Supported bool
- SGX2Supported bool
- MaxEnclaveSizeNot64 int64
- MaxEnclaveSize64 int64
- EPCSections []SGXEPCSection
-}
-
-func hasSGX(available, lc bool) (rval SGXSupport) {
- rval.Available = available
-
- if !available {
- return
- }
-
- rval.LaunchControl = lc
-
- a, _, _, d := cpuidex(0x12, 0)
- rval.SGX1Supported = a&0x01 != 0
- rval.SGX2Supported = a&0x02 != 0
- rval.MaxEnclaveSizeNot64 = 1 << (d & 0xFF) // pow 2
- rval.MaxEnclaveSize64 = 1 << ((d >> 8) & 0xFF) // pow 2
- rval.EPCSections = make([]SGXEPCSection, 0)
-
- for subleaf := uint32(2); subleaf < 2+8; subleaf++ {
- eax, ebx, ecx, edx := cpuidex(0x12, subleaf)
- leafType := eax & 0xf
-
- if leafType == 0 {
- // Invalid subleaf, stop iterating
- break
- } else if leafType == 1 {
- // EPC Section subleaf
- baseAddress := uint64(eax&0xfffff000) + (uint64(ebx&0x000fffff) << 32)
- size := uint64(ecx&0xfffff000) + (uint64(edx&0x000fffff) << 32)
-
- section := SGXEPCSection{BaseAddress: baseAddress, EPCSize: size}
- rval.EPCSections = append(rval.EPCSections, section)
- }
- }
-
- return
-}
-
-type AMDMemEncryptionSupport struct {
- Available bool
- CBitPossition uint32
- NumVMPL uint32
- PhysAddrReduction uint32
- NumEntryptedGuests uint32
- MinSevNoEsAsid uint32
-}
-
-func hasAMDMemEncryption(available bool) (rval AMDMemEncryptionSupport) {
- rval.Available = available
- if !available {
- return
- }
-
- _, b, c, d := cpuidex(0x8000001f, 0)
-
- rval.CBitPossition = b & 0x3f
- rval.PhysAddrReduction = (b >> 6) & 0x3F
- rval.NumVMPL = (b >> 12) & 0xf
- rval.NumEntryptedGuests = c
- rval.MinSevNoEsAsid = d
-
- return
-}
-
-func support() flagSet {
- var fs flagSet
- mfi := maxFunctionID()
- vend, _ := vendorID()
- if mfi < 0x1 {
- return fs
- }
- family, model, _ := familyModel()
-
- _, _, c, d := cpuid(1)
- fs.setIf((d&(1<<0)) != 0, X87)
- fs.setIf((d&(1<<8)) != 0, CMPXCHG8)
- fs.setIf((d&(1<<11)) != 0, SYSEE)
- fs.setIf((d&(1<<15)) != 0, CMOV)
- fs.setIf((d&(1<<23)) != 0, MMX)
- fs.setIf((d&(1<<24)) != 0, FXSR)
- fs.setIf((d&(1<<25)) != 0, FXSROPT)
- fs.setIf((d&(1<<25)) != 0, SSE)
- fs.setIf((d&(1<<26)) != 0, SSE2)
- fs.setIf((c&1) != 0, SSE3)
- fs.setIf((c&(1<<5)) != 0, VMX)
- fs.setIf((c&(1<<9)) != 0, SSSE3)
- fs.setIf((c&(1<<19)) != 0, SSE4)
- fs.setIf((c&(1<<20)) != 0, SSE42)
- fs.setIf((c&(1<<25)) != 0, AESNI)
- fs.setIf((c&(1<<1)) != 0, CLMUL)
- fs.setIf(c&(1<<22) != 0, MOVBE)
- fs.setIf(c&(1<<23) != 0, POPCNT)
- fs.setIf(c&(1<<30) != 0, RDRAND)
-
- // This bit has been reserved by Intel & AMD for use by hypervisors,
- // and indicates the presence of a hypervisor.
- fs.setIf(c&(1<<31) != 0, HYPERVISOR)
- fs.setIf(c&(1<<29) != 0, F16C)
- fs.setIf(c&(1<<13) != 0, CX16)
-
- if vend == Intel && (d&(1<<28)) != 0 && mfi >= 4 {
- fs.setIf(threadsPerCore() > 1, HTT)
- }
- if vend == AMD && (d&(1<<28)) != 0 && mfi >= 4 {
- fs.setIf(threadsPerCore() > 1, HTT)
- }
- fs.setIf(c&1<<26 != 0, XSAVE)
- fs.setIf(c&1<<27 != 0, OSXSAVE)
- // Check XGETBV/XSAVE (26), OXSAVE (27) and AVX (28) bits
- const avxCheck = 1<<26 | 1<<27 | 1<<28
- if c&avxCheck == avxCheck {
- // Check for OS support
- eax, _ := xgetbv(0)
- if (eax & 0x6) == 0x6 {
- fs.set(AVX)
- switch vend {
- case Intel:
- // Older than Haswell.
- fs.setIf(family == 6 && model < 60, AVXSLOW)
- case AMD:
- // Older than Zen 2
- fs.setIf(family < 23 || (family == 23 && model < 49), AVXSLOW)
- }
- }
- }
- // FMA3 can be used with SSE registers, so no OS support is strictly needed.
- // fma3 and OSXSAVE needed.
- const fma3Check = 1<<12 | 1<<27
- fs.setIf(c&fma3Check == fma3Check, FMA3)
-
- // Check AVX2, AVX2 requires OS support, but BMI1/2 don't.
- if mfi >= 7 {
- _, ebx, ecx, edx := cpuidex(7, 0)
- if fs.inSet(AVX) && (ebx&0x00000020) != 0 {
- fs.set(AVX2)
- }
- // CPUID.(EAX=7, ECX=0).EBX
- if (ebx & 0x00000008) != 0 {
- fs.set(BMI1)
- fs.setIf((ebx&0x00000100) != 0, BMI2)
- }
- fs.setIf(ebx&(1<<2) != 0, SGX)
- fs.setIf(ebx&(1<<4) != 0, HLE)
- fs.setIf(ebx&(1<<9) != 0, ERMS)
- fs.setIf(ebx&(1<<11) != 0, RTM)
- fs.setIf(ebx&(1<<14) != 0, MPX)
- fs.setIf(ebx&(1<<18) != 0, RDSEED)
- fs.setIf(ebx&(1<<19) != 0, ADX)
- fs.setIf(ebx&(1<<29) != 0, SHA)
-
- // CPUID.(EAX=7, ECX=0).ECX
- fs.setIf(ecx&(1<<5) != 0, WAITPKG)
- fs.setIf(ecx&(1<<7) != 0, CETSS)
- fs.setIf(ecx&(1<<8) != 0, GFNI)
- fs.setIf(ecx&(1<<9) != 0, VAES)
- fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ)
- fs.setIf(ecx&(1<<13) != 0, TME)
- fs.setIf(ecx&(1<<25) != 0, CLDEMOTE)
- fs.setIf(ecx&(1<<23) != 0, KEYLOCKER)
- fs.setIf(ecx&(1<<27) != 0, MOVDIRI)
- fs.setIf(ecx&(1<<28) != 0, MOVDIR64B)
- fs.setIf(ecx&(1<<29) != 0, ENQCMD)
- fs.setIf(ecx&(1<<30) != 0, SGXLC)
-
- // CPUID.(EAX=7, ECX=0).EDX
- fs.setIf(edx&(1<<4) != 0, FSRM)
- fs.setIf(edx&(1<<9) != 0, SRBDS_CTRL)
- fs.setIf(edx&(1<<10) != 0, MD_CLEAR)
- fs.setIf(edx&(1<<11) != 0, RTM_ALWAYS_ABORT)
- fs.setIf(edx&(1<<14) != 0, SERIALIZE)
- fs.setIf(edx&(1<<15) != 0, HYBRID_CPU)
- fs.setIf(edx&(1<<16) != 0, TSXLDTRK)
- fs.setIf(edx&(1<<18) != 0, PCONFIG)
- fs.setIf(edx&(1<<20) != 0, CETIBT)
- fs.setIf(edx&(1<<26) != 0, IBPB)
- fs.setIf(edx&(1<<27) != 0, STIBP)
- fs.setIf(edx&(1<<28) != 0, FLUSH_L1D)
- fs.setIf(edx&(1<<29) != 0, IA32_ARCH_CAP)
- fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP)
- fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD)
-
- // CPUID.(EAX=7, ECX=1).EAX
- eax1, _, _, edx1 := cpuidex(7, 1)
- fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI)
- fs.setIf(eax1&(1<<1) != 0, SM3_X86)
- fs.setIf(eax1&(1<<2) != 0, SM4_X86)
- fs.setIf(eax1&(1<<7) != 0, CMPCCXADD)
- fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL)
- fs.setIf(eax1&(1<<11) != 0, STOSB_SHORT)
- fs.setIf(eax1&(1<<12) != 0, CMPSB_SCADBS_SHORT)
- fs.setIf(eax1&(1<<22) != 0, HRESET)
- fs.setIf(eax1&(1<<23) != 0, AVXIFMA)
- fs.setIf(eax1&(1<<26) != 0, LAM)
-
- // CPUID.(EAX=7, ECX=1).EDX
- fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
- fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
- fs.setIf(edx1&(1<<6) != 0, AMXTRANSPOSE)
- fs.setIf(edx1&(1<<7) != 0, AMXTF32)
- fs.setIf(edx1&(1<<8) != 0, AMXCOMPLEX)
- fs.setIf(edx1&(1<<10) != 0, AVXVNNIINT16)
- fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
- fs.setIf(edx1&(1<<19) != 0, AVX10)
- fs.setIf(edx1&(1<<21) != 0, APX_F)
-
- // Only detect AVX-512 features if XGETBV is supported
- if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) {
- // Check for OS support
- eax, _ := xgetbv(0)
-
- // Verify that XCR0[7:5] = ‘111b’ (OPMASK state, upper 256-bit of ZMM0-ZMM15 and
- // ZMM16-ZMM31 state are enabled by OS)
- /// and that XCR0[2:1] = ‘11b’ (XMM state and YMM state are enabled by OS).
- hasAVX512 := (eax>>5)&7 == 7 && (eax>>1)&3 == 3
- if runtime.GOOS == "darwin" {
- hasAVX512 = fs.inSet(AVX) && darwinHasAVX512()
- }
- if hasAVX512 {
- fs.setIf(ebx&(1<<16) != 0, AVX512F)
- fs.setIf(ebx&(1<<17) != 0, AVX512DQ)
- fs.setIf(ebx&(1<<21) != 0, AVX512IFMA)
- fs.setIf(ebx&(1<<26) != 0, AVX512PF)
- fs.setIf(ebx&(1<<27) != 0, AVX512ER)
- fs.setIf(ebx&(1<<28) != 0, AVX512CD)
- fs.setIf(ebx&(1<<30) != 0, AVX512BW)
- fs.setIf(ebx&(1<<31) != 0, AVX512VL)
- // ecx
- fs.setIf(ecx&(1<<1) != 0, AVX512VBMI)
- fs.setIf(ecx&(1<<3) != 0, AMXFP8)
- fs.setIf(ecx&(1<<6) != 0, AVX512VBMI2)
- fs.setIf(ecx&(1<<11) != 0, AVX512VNNI)
- fs.setIf(ecx&(1<<12) != 0, AVX512BITALG)
- fs.setIf(ecx&(1<<14) != 0, AVX512VPOPCNTDQ)
- // edx
- fs.setIf(edx&(1<<8) != 0, AVX512VP2INTERSECT)
- fs.setIf(edx&(1<<22) != 0, AMXBF16)
- fs.setIf(edx&(1<<23) != 0, AVX512FP16)
- fs.setIf(edx&(1<<24) != 0, AMXTILE)
- fs.setIf(edx&(1<<25) != 0, AMXINT8)
- // eax1 = CPUID.(EAX=7, ECX=1).EAX
- fs.setIf(eax1&(1<<5) != 0, AVX512BF16)
- fs.setIf(eax1&(1<<19) != 0, WRMSRNS)
- fs.setIf(eax1&(1<<21) != 0, AMXFP16)
- fs.setIf(eax1&(1<<27) != 0, MSRLIST)
- }
- }
-
- // CPUID.(EAX=7, ECX=2)
- _, _, _, edx = cpuidex(7, 2)
- fs.setIf(edx&(1<<0) != 0, PSFD)
- fs.setIf(edx&(1<<1) != 0, IDPRED_CTRL)
- fs.setIf(edx&(1<<2) != 0, RRSBA_CTRL)
- fs.setIf(edx&(1<<4) != 0, BHI_CTRL)
- fs.setIf(edx&(1<<5) != 0, MCDT_NO)
-
- if fs.inSet(SGX) {
- eax, _, _, _ := cpuidex(0x12, 0)
- fs.setIf(eax&(1<<12) != 0, SGXPQC)
- }
-
- // Add keylocker features.
- if fs.inSet(KEYLOCKER) && mfi >= 0x19 {
- _, ebx, _, _ := cpuidex(0x19, 0)
- fs.setIf(ebx&5 == 5, KEYLOCKERW) // Bit 0 and 2 (1+4)
- }
-
- // Add AVX10 features.
- if fs.inSet(AVX10) && mfi >= 0x24 {
- _, ebx, _, _ := cpuidex(0x24, 0)
- fs.setIf(ebx&(1<<16) != 0, AVX10_128)
- fs.setIf(ebx&(1<<17) != 0, AVX10_256)
- fs.setIf(ebx&(1<<18) != 0, AVX10_512)
- }
-
- }
-
- // Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1)
- // EAX
- // Bit 00: XSAVEOPT is available.
- // Bit 01: Supports XSAVEC and the compacted form of XRSTOR if set.
- // Bit 02: Supports XGETBV with ECX = 1 if set.
- // Bit 03: Supports XSAVES/XRSTORS and IA32_XSS if set.
- // Bits 31 - 04: Reserved.
- // EBX
- // Bits 31 - 00: The size in bytes of the XSAVE area containing all states enabled by XCRO | IA32_XSS.
- // ECX
- // Bits 31 - 00: Reports the supported bits of the lower 32 bits of the IA32_XSS MSR. IA32_XSS[n] can be set to 1 only if ECX[n] is 1.
- // EDX?
- // Bits 07 - 00: Used for XCR0. Bit 08: PT state. Bit 09: Used for XCR0. Bits 12 - 10: Reserved. Bit 13: HWP state. Bits 31 - 14: Reserved.
- if mfi >= 0xd {
- if fs.inSet(XSAVE) {
- eax, _, _, _ := cpuidex(0xd, 1)
- fs.setIf(eax&(1<<0) != 0, XSAVEOPT)
- fs.setIf(eax&(1<<1) != 0, XSAVEC)
- fs.setIf(eax&(1<<2) != 0, XGETBV1)
- fs.setIf(eax&(1<<3) != 0, XSAVES)
- }
- }
- if maxExtendedFunction() >= 0x80000001 {
- _, _, c, d := cpuid(0x80000001)
- if (c & (1 << 5)) != 0 {
- fs.set(LZCNT)
- fs.set(POPCNT)
- }
- // ECX
- fs.setIf((c&(1<<0)) != 0, LAHF)
- fs.setIf((c&(1<<2)) != 0, SVM)
- fs.setIf((c&(1<<6)) != 0, SSE4A)
- fs.setIf((c&(1<<10)) != 0, IBS)
- fs.setIf((c&(1<<22)) != 0, TOPEXT)
-
- // EDX
- fs.setIf(d&(1<<11) != 0, SYSCALL)
- fs.setIf(d&(1<<20) != 0, NX)
- fs.setIf(d&(1<<22) != 0, MMXEXT)
- fs.setIf(d&(1<<23) != 0, MMX)
- fs.setIf(d&(1<<24) != 0, FXSR)
- fs.setIf(d&(1<<25) != 0, FXSROPT)
- fs.setIf(d&(1<<27) != 0, RDTSCP)
- fs.setIf(d&(1<<30) != 0, AMD3DNOWEXT)
- fs.setIf(d&(1<<31) != 0, AMD3DNOW)
-
- /* XOP and FMA4 use the AVX instruction coding scheme, so they can't be
- * used unless the OS has AVX support. */
- if fs.inSet(AVX) {
- fs.setIf((c&(1<<11)) != 0, XOP)
- fs.setIf((c&(1<<16)) != 0, FMA4)
- }
-
- }
- if maxExtendedFunction() >= 0x80000007 {
- _, b, _, d := cpuid(0x80000007)
- fs.setIf((b&(1<<0)) != 0, MCAOVERFLOW)
- fs.setIf((b&(1<<1)) != 0, SUCCOR)
- fs.setIf((b&(1<<2)) != 0, HWA)
- fs.setIf((d&(1<<9)) != 0, CPBOOST)
- }
-
- if maxExtendedFunction() >= 0x80000008 {
- _, b, _, _ := cpuid(0x80000008)
- fs.setIf(b&(1<<28) != 0, PSFD)
- fs.setIf(b&(1<<27) != 0, CPPC)
- fs.setIf(b&(1<<24) != 0, SPEC_CTRL_SSBD)
- fs.setIf(b&(1<<23) != 0, PPIN)
- fs.setIf(b&(1<<21) != 0, TLB_FLUSH_NESTED)
- fs.setIf(b&(1<<20) != 0, EFER_LMSLE_UNS)
- fs.setIf(b&(1<<19) != 0, IBRS_PROVIDES_SMP)
- fs.setIf(b&(1<<18) != 0, IBRS_PREFERRED)
- fs.setIf(b&(1<<17) != 0, STIBP_ALWAYSON)
- fs.setIf(b&(1<<15) != 0, STIBP)
- fs.setIf(b&(1<<14) != 0, IBRS)
- fs.setIf((b&(1<<13)) != 0, INT_WBINVD)
- fs.setIf(b&(1<<12) != 0, IBPB)
- fs.setIf((b&(1<<9)) != 0, WBNOINVD)
- fs.setIf((b&(1<<8)) != 0, MCOMMIT)
- fs.setIf((b&(1<<4)) != 0, RDPRU)
- fs.setIf((b&(1<<3)) != 0, INVLPGB)
- fs.setIf((b&(1<<1)) != 0, MSRIRC)
- fs.setIf((b&(1<<0)) != 0, CLZERO)
- }
-
- if fs.inSet(SVM) && maxExtendedFunction() >= 0x8000000A {
- _, _, _, edx := cpuid(0x8000000A)
- fs.setIf((edx>>0)&1 == 1, SVMNP)
- fs.setIf((edx>>1)&1 == 1, LBRVIRT)
- fs.setIf((edx>>2)&1 == 1, SVML)
- fs.setIf((edx>>3)&1 == 1, NRIPS)
- fs.setIf((edx>>4)&1 == 1, TSCRATEMSR)
- fs.setIf((edx>>5)&1 == 1, VMCBCLEAN)
- fs.setIf((edx>>6)&1 == 1, SVMFBASID)
- fs.setIf((edx>>7)&1 == 1, SVMDA)
- fs.setIf((edx>>10)&1 == 1, SVMPF)
- fs.setIf((edx>>12)&1 == 1, SVMPFT)
- }
-
- if maxExtendedFunction() >= 0x8000001a {
- eax, _, _, _ := cpuid(0x8000001a)
- fs.setIf((eax>>0)&1 == 1, FP128)
- fs.setIf((eax>>1)&1 == 1, MOVU)
- fs.setIf((eax>>2)&1 == 1, FP256)
- }
-
- if maxExtendedFunction() >= 0x8000001b && fs.inSet(IBS) {
- eax, _, _, _ := cpuid(0x8000001b)
- fs.setIf((eax>>0)&1 == 1, IBSFFV)
- fs.setIf((eax>>1)&1 == 1, IBSFETCHSAM)
- fs.setIf((eax>>2)&1 == 1, IBSOPSAM)
- fs.setIf((eax>>3)&1 == 1, IBSRDWROPCNT)
- fs.setIf((eax>>4)&1 == 1, IBSOPCNT)
- fs.setIf((eax>>5)&1 == 1, IBSBRNTRGT)
- fs.setIf((eax>>6)&1 == 1, IBSOPCNTEXT)
- fs.setIf((eax>>7)&1 == 1, IBSRIPINVALIDCHK)
- fs.setIf((eax>>8)&1 == 1, IBS_OPFUSE)
- fs.setIf((eax>>9)&1 == 1, IBS_FETCH_CTLX)
- fs.setIf((eax>>10)&1 == 1, IBS_OPDATA4) // Doc says "Fixed,0. IBS op data 4 MSR supported", but assuming they mean 1.
- fs.setIf((eax>>11)&1 == 1, IBS_ZEN4)
- }
-
- if maxExtendedFunction() >= 0x8000001f && vend == AMD {
- a, _, _, _ := cpuid(0x8000001f)
- fs.setIf((a>>0)&1 == 1, SME)
- fs.setIf((a>>1)&1 == 1, SEV)
- fs.setIf((a>>2)&1 == 1, MSR_PAGEFLUSH)
- fs.setIf((a>>3)&1 == 1, SEV_ES)
- fs.setIf((a>>4)&1 == 1, SEV_SNP)
- fs.setIf((a>>5)&1 == 1, VMPL)
- fs.setIf((a>>10)&1 == 1, SME_COHERENT)
- fs.setIf((a>>11)&1 == 1, SEV_64BIT)
- fs.setIf((a>>12)&1 == 1, SEV_RESTRICTED)
- fs.setIf((a>>13)&1 == 1, SEV_ALTERNATIVE)
- fs.setIf((a>>14)&1 == 1, SEV_DEBUGSWAP)
- fs.setIf((a>>15)&1 == 1, IBS_PREVENTHOST)
- fs.setIf((a>>16)&1 == 1, VTE)
- fs.setIf((a>>24)&1 == 1, VMSA_REGPROT)
- }
-
- if maxExtendedFunction() >= 0x80000021 && vend == AMD {
- a, _, c, _ := cpuid(0x80000021)
- fs.setIf((a>>31)&1 == 1, SRSO_MSR_FIX)
- fs.setIf((a>>30)&1 == 1, SRSO_USER_KERNEL_NO)
- fs.setIf((a>>29)&1 == 1, SRSO_NO)
- fs.setIf((a>>28)&1 == 1, IBPB_BRTYPE)
- fs.setIf((a>>27)&1 == 1, SBPB)
- fs.setIf((c>>1)&1 == 1, TSA_L1_NO)
- fs.setIf((c>>2)&1 == 1, TSA_SQ_NO)
- fs.setIf((a>>5)&1 == 1, TSA_VERW_CLEAR)
- }
- if vend == AMD {
- if family < 0x19 {
- // AMD CPUs that are older than Family 19h are not vulnerable to TSA but do not set TSA_L1_NO or TSA_SQ_NO.
- // Source: https://www.amd.com/content/dam/amd/en/documents/resources/bulletin/technical-guidance-for-mitigating-transient-scheduler-attacks.pdf
- fs.set(TSA_L1_NO)
- fs.set(TSA_SQ_NO)
- } else if family == 0x1a {
- // AMD Family 1Ah models 00h-4Fh and 60h-7Fh are also not vulnerable to TSA but do not set TSA_L1_NO or TSA_SQ_NO.
- // Future AMD CPUs will set these CPUID bits if appropriate. CPUs will be designed to set these CPUID bits if appropriate.
- notVuln := model <= 0x4f || (model >= 0x60 && model <= 0x7f)
- fs.setIf(notVuln, TSA_L1_NO, TSA_SQ_NO)
- }
- }
-
- if mfi >= 0x20 {
- // Microsoft has decided to purposefully hide the information
- // of the guest TEE when VMs are being created using Hyper-V.
- //
- // This leads us to check for the Hyper-V cpuid features
- // (0x4000000C), and then for the `ebx` value set.
- //
- // For Intel TDX, `ebx` is set as `0xbe3`, being 3 the part
- // we're mostly interested about,according to:
- // https://github.com/torvalds/linux/blob/d2f51b3516dade79269ff45eae2a7668ae711b25/arch/x86/include/asm/hyperv-tlfs.h#L169-L174
- _, ebx, _, _ := cpuid(0x4000000C)
- fs.setIf(ebx == 0xbe3, TDX_GUEST)
- }
-
- if mfi >= 0x21 {
- // Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21).
- _, ebx, ecx, edx := cpuid(0x21)
- identity := string(valAsString(ebx, edx, ecx))
- fs.setIf(identity == "IntelTDX ", TDX_GUEST)
- }
-
- return fs
-}
-
-func (c *CPUInfo) supportAVX10() uint8 {
- if c.maxFunc >= 0x24 && c.featureSet.inSet(AVX10) {
- _, ebx, _, _ := cpuidex(0x24, 0)
- return uint8(ebx)
- }
- return 0
-}
-
-func valAsString(values ...uint32) []byte {
- r := make([]byte, 4*len(values))
- for i, v := range values {
- dst := r[i*4:]
- dst[0] = byte(v & 0xff)
- dst[1] = byte((v >> 8) & 0xff)
- dst[2] = byte((v >> 16) & 0xff)
- dst[3] = byte((v >> 24) & 0xff)
- switch {
- case dst[0] == 0:
- return r[:i*4]
- case dst[1] == 0:
- return r[:i*4+1]
- case dst[2] == 0:
- return r[:i*4+2]
- case dst[3] == 0:
- return r[:i*4+3]
- }
- }
- return r
-}
-
-func parseLeaf0AH(c *CPUInfo, eax, ebx, edx uint32) (info PerformanceMonitoringInfo) {
- info.VersionID = uint8(eax & 0xFF)
- info.NumGPCounters = uint8((eax >> 8) & 0xFF)
- info.GPPMCWidth = uint8((eax >> 16) & 0xFF)
-
- info.RawEBX = ebx
- info.RawEAX = eax
- info.RawEDX = edx
-
- if info.VersionID > 1 { // This information is only valid if VersionID > 1
- info.NumFixedPMC = uint8(edx & 0x1F) // Bits 4:0
- info.FixedPMCWidth = uint8((edx >> 5) & 0xFF) // Bits 12:5
- }
- if info.VersionID > 0 {
- // first 4 fixed events are always instructions retired, cycles, ref cycles and topdown slots
- if ebx == 0x0 && info.NumFixedPMC == 3 {
- c.featureSet.set(PMU_FIXEDCOUNTER_INSTRUCTIONS)
- c.featureSet.set(PMU_FIXEDCOUNTER_CYCLES)
- c.featureSet.set(PMU_FIXEDCOUNTER_REFCYCLES)
- }
- if ebx == 0x0 && info.NumFixedPMC == 4 {
- c.featureSet.set(PMU_FIXEDCOUNTER_INSTRUCTIONS)
- c.featureSet.set(PMU_FIXEDCOUNTER_CYCLES)
- c.featureSet.set(PMU_FIXEDCOUNTER_REFCYCLES)
- c.featureSet.set(PMU_FIXEDCOUNTER_TOPDOWN_SLOTS)
- }
- if ebx != 0x0 {
- if ((ebx >> 0) & 1) == 0 {
- c.featureSet.set(PMU_FIXEDCOUNTER_INSTRUCTIONS)
- }
- if ((ebx >> 1) & 1) == 0 {
- c.featureSet.set(PMU_FIXEDCOUNTER_CYCLES)
- }
- if ((ebx >> 2) & 1) == 0 {
- c.featureSet.set(PMU_FIXEDCOUNTER_REFCYCLES)
- }
- if ((ebx >> 3) & 1) == 0 {
- c.featureSet.set(PMU_FIXEDCOUNTER_TOPDOWN_SLOTS)
- }
- }
- }
- return info
-}
diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid_386.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_386.s
deleted file mode 100644
index 8587c3a1f..000000000
--- a/vendor/github.com/klauspost/cpuid/v2/cpuid_386.s
+++ /dev/null
@@ -1,47 +0,0 @@
-// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
-
-//+build 386,!gccgo,!noasm,!appengine
-
-// func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32)
-TEXT ·asmCpuid(SB), 7, $0
- XORL CX, CX
- MOVL op+0(FP), AX
- CPUID
- MOVL AX, eax+4(FP)
- MOVL BX, ebx+8(FP)
- MOVL CX, ecx+12(FP)
- MOVL DX, edx+16(FP)
- RET
-
-// func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32)
-TEXT ·asmCpuidex(SB), 7, $0
- MOVL op+0(FP), AX
- MOVL op2+4(FP), CX
- CPUID
- MOVL AX, eax+8(FP)
- MOVL BX, ebx+12(FP)
- MOVL CX, ecx+16(FP)
- MOVL DX, edx+20(FP)
- RET
-
-// func xgetbv(index uint32) (eax, edx uint32)
-TEXT ·asmXgetbv(SB), 7, $0
- MOVL index+0(FP), CX
- BYTE $0x0f; BYTE $0x01; BYTE $0xd0 // XGETBV
- MOVL AX, eax+4(FP)
- MOVL DX, edx+8(FP)
- RET
-
-// func asmRdtscpAsm() (eax, ebx, ecx, edx uint32)
-TEXT ·asmRdtscpAsm(SB), 7, $0
- BYTE $0x0F; BYTE $0x01; BYTE $0xF9 // RDTSCP
- MOVL AX, eax+0(FP)
- MOVL BX, ebx+4(FP)
- MOVL CX, ecx+8(FP)
- MOVL DX, edx+12(FP)
- RET
-
-// func asmDarwinHasAVX512() bool
-TEXT ·asmDarwinHasAVX512(SB), 7, $0
- MOVL $0, eax+0(FP)
- RET
diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s
deleted file mode 100644
index bc11f8942..000000000
--- a/vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s
+++ /dev/null
@@ -1,72 +0,0 @@
-// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
-
-//+build amd64,!gccgo,!noasm,!appengine
-
-// func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32)
-TEXT ·asmCpuid(SB), 7, $0
- XORQ CX, CX
- MOVL op+0(FP), AX
- CPUID
- MOVL AX, eax+8(FP)
- MOVL BX, ebx+12(FP)
- MOVL CX, ecx+16(FP)
- MOVL DX, edx+20(FP)
- RET
-
-// func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32)
-TEXT ·asmCpuidex(SB), 7, $0
- MOVL op+0(FP), AX
- MOVL op2+4(FP), CX
- CPUID
- MOVL AX, eax+8(FP)
- MOVL BX, ebx+12(FP)
- MOVL CX, ecx+16(FP)
- MOVL DX, edx+20(FP)
- RET
-
-// func asmXgetbv(index uint32) (eax, edx uint32)
-TEXT ·asmXgetbv(SB), 7, $0
- MOVL index+0(FP), CX
- BYTE $0x0f; BYTE $0x01; BYTE $0xd0 // XGETBV
- MOVL AX, eax+8(FP)
- MOVL DX, edx+12(FP)
- RET
-
-// func asmRdtscpAsm() (eax, ebx, ecx, edx uint32)
-TEXT ·asmRdtscpAsm(SB), 7, $0
- BYTE $0x0F; BYTE $0x01; BYTE $0xF9 // RDTSCP
- MOVL AX, eax+0(FP)
- MOVL BX, ebx+4(FP)
- MOVL CX, ecx+8(FP)
- MOVL DX, edx+12(FP)
- RET
-
-// From https://go-review.googlesource.com/c/sys/+/285572/
-// func asmDarwinHasAVX512() bool
-TEXT ·asmDarwinHasAVX512(SB), 7, $0-1
- MOVB $0, ret+0(FP) // default to false
-
-#ifdef GOOS_darwin // return if not darwin
-#ifdef GOARCH_amd64 // return if not amd64
-// These values from:
-// https://github.com/apple/darwin-xnu/blob/xnu-4570.1.46/osfmk/i386/cpu_capabilities.h
-#define commpage64_base_address 0x00007fffffe00000
-#define commpage64_cpu_capabilities64 (commpage64_base_address+0x010)
-#define commpage64_version (commpage64_base_address+0x01E)
-#define hasAVX512F 0x0000004000000000
- MOVQ $commpage64_version, BX
- MOVW (BX), AX
- CMPW AX, $13 // versions < 13 do not support AVX512
- JL no_avx512
- MOVQ $commpage64_cpu_capabilities64, BX
- MOVQ (BX), AX
- MOVQ $hasAVX512F, CX
- ANDQ CX, AX
- JZ no_avx512
- MOVB $1, ret+0(FP)
-
-no_avx512:
-#endif
-#endif
- RET
-
diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s
deleted file mode 100644
index b196f78eb..000000000
--- a/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s
+++ /dev/null
@@ -1,36 +0,0 @@
-// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
-
-//+build arm64,!gccgo,!noasm,!appengine
-
-// See https://www.kernel.org/doc/Documentation/arm64/cpu-feature-registers.txt
-
-// func getMidr
-TEXT ·getMidr(SB), 7, $0
- WORD $0xd5380000 // mrs x0, midr_el1 /* Main ID Register */
- MOVD R0, midr+0(FP)
- RET
-
-// func getProcFeatures
-TEXT ·getProcFeatures(SB), 7, $0
- WORD $0xd5380400 // mrs x0, id_aa64pfr0_el1 /* Processor Feature Register 0 */
- MOVD R0, procFeatures+0(FP)
- RET
-
-// func getInstAttributes
-TEXT ·getInstAttributes(SB), 7, $0
- WORD $0xd5380600 // mrs x0, id_aa64isar0_el1 /* Instruction Set Attribute Register 0 */
- WORD $0xd5380621 // mrs x1, id_aa64isar1_el1 /* Instruction Set Attribute Register 1 */
- MOVD R0, instAttrReg0+0(FP)
- MOVD R1, instAttrReg1+8(FP)
- RET
-
-TEXT ·getVectorLength(SB), 7, $0
- WORD $0xd2800002 // mov x2, #0
- WORD $0x04225022 // addvl x2, x2, #1
- WORD $0xd37df042 // lsl x2, x2, #3
- WORD $0xd2800003 // mov x3, #0
- WORD $0x04635023 // addpl x3, x3, #1
- WORD $0xd37df063 // lsl x3, x3, #3
- MOVD R2, vl+0(FP)
- MOVD R3, pl+8(FP)
- RET
diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go
deleted file mode 100644
index 9ae32d607..000000000
--- a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go
+++ /dev/null
@@ -1,250 +0,0 @@
-// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
-
-//go:build arm64 && !gccgo && !noasm && !appengine
-// +build arm64,!gccgo,!noasm,!appengine
-
-package cpuid
-
-import "runtime"
-
-func getMidr() (midr uint64)
-func getProcFeatures() (procFeatures uint64)
-func getInstAttributes() (instAttrReg0, instAttrReg1 uint64)
-func getVectorLength() (vl, pl uint64)
-
-func initCPU() {
- cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 }
- cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 }
- xgetbv = func(uint32) (a, b uint32) { return 0, 0 }
- rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 }
-}
-
-func addInfo(c *CPUInfo, safe bool) {
- // Seems to be safe to assume on ARM64
- c.CacheLine = 64
- detectOS(c)
-
- // ARM64 disabled since it may crash if interrupt is not intercepted by OS.
- if safe && !c.Has(ARMCPUID) && runtime.GOOS != "freebsd" {
- return
- }
- midr := getMidr()
-
- // MIDR_EL1 - Main ID Register
- // https://developer.arm.com/docs/ddi0595/h/aarch64-system-registers/midr_el1
- // x--------------------------------------------------x
- // | Name | bits | visible |
- // |--------------------------------------------------|
- // | Implementer | [31-24] | y |
- // |--------------------------------------------------|
- // | Variant | [23-20] | y |
- // |--------------------------------------------------|
- // | Architecture | [19-16] | y |
- // |--------------------------------------------------|
- // | PartNum | [15-4] | y |
- // |--------------------------------------------------|
- // | Revision | [3-0] | y |
- // x--------------------------------------------------x
-
- switch (midr >> 24) & 0xff {
- case 0xC0:
- c.VendorString = "Ampere Computing"
- c.VendorID = Ampere
- case 0x41:
- c.VendorString = "Arm Limited"
- c.VendorID = ARM
- case 0x42:
- c.VendorString = "Broadcom Corporation"
- c.VendorID = Broadcom
- case 0x43:
- c.VendorString = "Cavium Inc"
- c.VendorID = Cavium
- case 0x44:
- c.VendorString = "Digital Equipment Corporation"
- c.VendorID = DEC
- case 0x46:
- c.VendorString = "Fujitsu Ltd"
- c.VendorID = Fujitsu
- case 0x49:
- c.VendorString = "Infineon Technologies AG"
- c.VendorID = Infineon
- case 0x4D:
- c.VendorString = "Motorola or Freescale Semiconductor Inc"
- c.VendorID = Motorola
- case 0x4E:
- c.VendorString = "NVIDIA Corporation"
- c.VendorID = NVIDIA
- case 0x50:
- c.VendorString = "Applied Micro Circuits Corporation"
- c.VendorID = AMCC
- case 0x51:
- c.VendorString = "Qualcomm Inc"
- c.VendorID = Qualcomm
- case 0x56:
- c.VendorString = "Marvell International Ltd"
- c.VendorID = Marvell
- case 0x69:
- c.VendorString = "Intel Corporation"
- c.VendorID = Intel
- }
-
- // Lower 4 bits: Architecture
- // Architecture Meaning
- // 0b0001 Armv4.
- // 0b0010 Armv4T.
- // 0b0011 Armv5 (obsolete).
- // 0b0100 Armv5T.
- // 0b0101 Armv5TE.
- // 0b0110 Armv5TEJ.
- // 0b0111 Armv6.
- // 0b1111 Architectural features are individually identified in the ID_* registers, see 'ID registers'.
- // Upper 4 bit: Variant
- // An IMPLEMENTATION DEFINED variant number.
- // Typically, this field is used to distinguish between different product variants, or major revisions of a product.
- c.Family = int(midr>>16) & 0xff
-
- // PartNum, bits [15:4]
- // An IMPLEMENTATION DEFINED primary part number for the device.
- // On processors implemented by Arm, if the top four bits of the primary
- // part number are 0x0 or 0x7, the variant and architecture are encoded differently.
- // Revision, bits [3:0]
- // An IMPLEMENTATION DEFINED revision number for the device.
- c.Model = int(midr) & 0xffff
-
- procFeatures := getProcFeatures()
-
- // ID_AA64PFR0_EL1 - Processor Feature Register 0
- // x--------------------------------------------------x
- // | Name | bits | visible |
- // |--------------------------------------------------|
- // | DIT | [51-48] | y |
- // |--------------------------------------------------|
- // | SVE | [35-32] | y |
- // |--------------------------------------------------|
- // | GIC | [27-24] | n |
- // |--------------------------------------------------|
- // | AdvSIMD | [23-20] | y |
- // |--------------------------------------------------|
- // | FP | [19-16] | y |
- // |--------------------------------------------------|
- // | EL3 | [15-12] | n |
- // |--------------------------------------------------|
- // | EL2 | [11-8] | n |
- // |--------------------------------------------------|
- // | EL1 | [7-4] | n |
- // |--------------------------------------------------|
- // | EL0 | [3-0] | n |
- // x--------------------------------------------------x
-
- var f flagSet
- // if procFeatures&(0xf<<48) != 0 {
- // fmt.Println("DIT")
- // }
- f.setIf(procFeatures&(0xf<<32) != 0, SVE)
- if procFeatures&(0xf<<20) != 15<<20 {
- f.set(ASIMD)
- // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64pfr0_el1
- // 0b0001 --> As for 0b0000, and also includes support for half-precision floating-point arithmetic.
- f.setIf(procFeatures&(0xf<<20) == 1<<20, FPHP, ASIMDHP)
- }
- f.setIf(procFeatures&(0xf<<16) != 0, FP)
-
- instAttrReg0, instAttrReg1 := getInstAttributes()
-
- // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1
- //
- // ID_AA64ISAR0_EL1 - Instruction Set Attribute Register 0
- // x--------------------------------------------------x
- // | Name | bits | visible |
- // |--------------------------------------------------|
- // | RNDR | [63-60] | y |
- // |--------------------------------------------------|
- // | TLB | [59-56] | y |
- // |--------------------------------------------------|
- // | TS | [55-52] | y |
- // |--------------------------------------------------|
- // | FHM | [51-48] | y |
- // |--------------------------------------------------|
- // | DP | [47-44] | y |
- // |--------------------------------------------------|
- // | SM4 | [43-40] | y |
- // |--------------------------------------------------|
- // | SM3 | [39-36] | y |
- // |--------------------------------------------------|
- // | SHA3 | [35-32] | y |
- // |--------------------------------------------------|
- // | RDM | [31-28] | y |
- // |--------------------------------------------------|
- // | ATOMICS | [23-20] | y |
- // |--------------------------------------------------|
- // | CRC32 | [19-16] | y |
- // |--------------------------------------------------|
- // | SHA2 | [15-12] | y |
- // |--------------------------------------------------|
- // | SHA1 | [11-8] | y |
- // |--------------------------------------------------|
- // | AES | [7-4] | y |
- // x--------------------------------------------------x
-
- f.setIf(instAttrReg0&(0xf<<60) != 0, RNDR)
- f.setIf(instAttrReg0&(0xf<<56) != 0, TLB)
- f.setIf(instAttrReg0&(0xf<<52) != 0, TS)
- f.setIf(instAttrReg0&(0xf<<48) != 0, FHM)
- f.setIf(instAttrReg0&(0xf<<44) != 0, ASIMDDP)
- f.setIf(instAttrReg0&(0xf<<40) != 0, SM4)
- f.setIf(instAttrReg0&(0xf<<36) != 0, SM3)
- f.setIf(instAttrReg0&(0xf<<32) != 0, SHA3)
- f.setIf(instAttrReg0&(0xf<<28) != 0, ASIMDRDM)
- f.setIf(instAttrReg0&(0xf<<20) != 0, ATOMICS)
- f.setIf(instAttrReg0&(0xf<<16) != 0, CRC32)
- f.setIf(instAttrReg0&(0xf<<12) != 0, SHA2)
- // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1
- // 0b0010 --> As 0b0001, plus SHA512H, SHA512H2, SHA512SU0, and SHA512SU1 instructions implemented.
- f.setIf(instAttrReg0&(0xf<<12) == 2<<12, SHA512)
- f.setIf(instAttrReg0&(0xf<<8) != 0, SHA1)
- f.setIf(instAttrReg0&(0xf<<4) != 0, AESARM)
- // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1
- // 0b0010 --> As for 0b0001, plus PMULL/PMULL2 instructions operating on 64-bit data quantities.
- f.setIf(instAttrReg0&(0xf<<4) == 2<<4, PMULL)
-
- // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar1_el1
- //
- // ID_AA64ISAR1_EL1 - Instruction set attribute register 1
- // x--------------------------------------------------x
- // | Name | bits | visible |
- // |--------------------------------------------------|
- // | GPI | [31-28] | y |
- // |--------------------------------------------------|
- // | GPA | [27-24] | y |
- // |--------------------------------------------------|
- // | LRCPC | [23-20] | y |
- // |--------------------------------------------------|
- // | FCMA | [19-16] | y |
- // |--------------------------------------------------|
- // | JSCVT | [15-12] | y |
- // |--------------------------------------------------|
- // | API | [11-8] | y |
- // |--------------------------------------------------|
- // | APA | [7-4] | y |
- // |--------------------------------------------------|
- // | DPB | [3-0] | y |
- // x--------------------------------------------------x
-
- // if instAttrReg1&(0xf<<28) != 0 {
- // fmt.Println("GPI")
- // }
- f.setIf(instAttrReg1&(0xf<<28) != 24, GPA)
- f.setIf(instAttrReg1&(0xf<<20) != 0, LRCPC)
- f.setIf(instAttrReg1&(0xf<<16) != 0, FCMA)
- f.setIf(instAttrReg1&(0xf<<12) != 0, JSCVT)
- // if instAttrReg1&(0xf<<8) != 0 {
- // fmt.Println("API")
- // }
- // if instAttrReg1&(0xf<<4) != 0 {
- // fmt.Println("APA")
- // }
- f.setIf(instAttrReg1&(0xf<<0) != 0, DCPOP)
-
- // Store
- c.featureSet.or(f)
-}
diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go
deleted file mode 100644
index 574f9389c..000000000
--- a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go
+++ /dev/null
@@ -1,17 +0,0 @@
-// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
-
-//go:build (!amd64 && !386 && !arm64) || gccgo || noasm || appengine
-// +build !amd64,!386,!arm64 gccgo noasm appengine
-
-package cpuid
-
-func initCPU() {
- cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 }
- cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 }
- xgetbv = func(uint32) (a, b uint32) { return 0, 0 }
- rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 }
-
-}
-
-func addInfo(info *CPUInfo, safe bool) {}
-func getVectorLength() (vl, pl uint64) { return 0, 0 }
diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go
deleted file mode 100644
index 14a56b930..000000000
--- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go
+++ /dev/null
@@ -1,45 +0,0 @@
-// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
-
-//go:build (386 && !gccgo && !noasm && !appengine) || (amd64 && !gccgo && !noasm && !appengine)
-// +build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine
-
-package cpuid
-
-func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32)
-func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32)
-func asmXgetbv(index uint32) (eax, edx uint32)
-func asmRdtscpAsm() (eax, ebx, ecx, edx uint32)
-func asmDarwinHasAVX512() bool
-
-func initCPU() {
- cpuid = asmCpuid
- cpuidex = asmCpuidex
- xgetbv = asmXgetbv
- rdtscpAsm = asmRdtscpAsm
- darwinHasAVX512 = asmDarwinHasAVX512
-}
-
-func addInfo(c *CPUInfo, safe bool) {
- c.maxFunc = maxFunctionID()
- c.maxExFunc = maxExtendedFunction()
- c.BrandName = brandName()
- c.CacheLine = cacheLine()
- c.Family, c.Model, c.Stepping = familyModel()
- c.featureSet = support()
- c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC))
- c.AMDMemEncryption = hasAMDMemEncryption(c.featureSet.inSet(SME) || c.featureSet.inSet(SEV))
- c.ThreadsPerCore = threadsPerCore()
- c.LogicalCores = logicalCores()
- c.PhysicalCores = physicalCores()
- c.VendorID, c.VendorString = vendorID()
- c.HypervisorVendorID, c.HypervisorVendorString = hypervisorVendorID()
- c.AVX10Level = c.supportAVX10()
- c.cacheSize()
- c.frequencies()
- if c.maxFunc >= 0x0A {
- eax, ebx, _, edx := cpuid(0x0A)
- c.PMU = parseLeaf0AH(c, eax, ebx, edx)
- }
-}
-
-func getVectorLength() (vl, pl uint64) { return 0, 0 }
diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go
deleted file mode 100644
index 2888bae8f..000000000
--- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go
+++ /dev/null
@@ -1,308 +0,0 @@
-// Code generated by "stringer -type=FeatureID,Vendor"; DO NOT EDIT.
-
-package cpuid
-
-import "strconv"
-
-func _() {
- // An "invalid array index" compiler error signifies that the constant values have changed.
- // Re-run the stringer command to generate them again.
- var x [1]struct{}
- _ = x[ADX-1]
- _ = x[AESNI-2]
- _ = x[AMD3DNOW-3]
- _ = x[AMD3DNOWEXT-4]
- _ = x[AMXBF16-5]
- _ = x[AMXFP16-6]
- _ = x[AMXINT8-7]
- _ = x[AMXFP8-8]
- _ = x[AMXTILE-9]
- _ = x[AMXTF32-10]
- _ = x[AMXCOMPLEX-11]
- _ = x[AMXTRANSPOSE-12]
- _ = x[APX_F-13]
- _ = x[AVX-14]
- _ = x[AVX10-15]
- _ = x[AVX10_128-16]
- _ = x[AVX10_256-17]
- _ = x[AVX10_512-18]
- _ = x[AVX2-19]
- _ = x[AVX512BF16-20]
- _ = x[AVX512BITALG-21]
- _ = x[AVX512BW-22]
- _ = x[AVX512CD-23]
- _ = x[AVX512DQ-24]
- _ = x[AVX512ER-25]
- _ = x[AVX512F-26]
- _ = x[AVX512FP16-27]
- _ = x[AVX512IFMA-28]
- _ = x[AVX512PF-29]
- _ = x[AVX512VBMI-30]
- _ = x[AVX512VBMI2-31]
- _ = x[AVX512VL-32]
- _ = x[AVX512VNNI-33]
- _ = x[AVX512VP2INTERSECT-34]
- _ = x[AVX512VPOPCNTDQ-35]
- _ = x[AVXIFMA-36]
- _ = x[AVXNECONVERT-37]
- _ = x[AVXSLOW-38]
- _ = x[AVXVNNI-39]
- _ = x[AVXVNNIINT8-40]
- _ = x[AVXVNNIINT16-41]
- _ = x[BHI_CTRL-42]
- _ = x[BMI1-43]
- _ = x[BMI2-44]
- _ = x[CETIBT-45]
- _ = x[CETSS-46]
- _ = x[CLDEMOTE-47]
- _ = x[CLMUL-48]
- _ = x[CLZERO-49]
- _ = x[CMOV-50]
- _ = x[CMPCCXADD-51]
- _ = x[CMPSB_SCADBS_SHORT-52]
- _ = x[CMPXCHG8-53]
- _ = x[CPBOOST-54]
- _ = x[CPPC-55]
- _ = x[CX16-56]
- _ = x[EFER_LMSLE_UNS-57]
- _ = x[ENQCMD-58]
- _ = x[ERMS-59]
- _ = x[F16C-60]
- _ = x[FLUSH_L1D-61]
- _ = x[FMA3-62]
- _ = x[FMA4-63]
- _ = x[FP128-64]
- _ = x[FP256-65]
- _ = x[FSRM-66]
- _ = x[FXSR-67]
- _ = x[FXSROPT-68]
- _ = x[GFNI-69]
- _ = x[HLE-70]
- _ = x[HRESET-71]
- _ = x[HTT-72]
- _ = x[HWA-73]
- _ = x[HYBRID_CPU-74]
- _ = x[HYPERVISOR-75]
- _ = x[IA32_ARCH_CAP-76]
- _ = x[IA32_CORE_CAP-77]
- _ = x[IBPB-78]
- _ = x[IBPB_BRTYPE-79]
- _ = x[IBRS-80]
- _ = x[IBRS_PREFERRED-81]
- _ = x[IBRS_PROVIDES_SMP-82]
- _ = x[IBS-83]
- _ = x[IBSBRNTRGT-84]
- _ = x[IBSFETCHSAM-85]
- _ = x[IBSFFV-86]
- _ = x[IBSOPCNT-87]
- _ = x[IBSOPCNTEXT-88]
- _ = x[IBSOPSAM-89]
- _ = x[IBSRDWROPCNT-90]
- _ = x[IBSRIPINVALIDCHK-91]
- _ = x[IBS_FETCH_CTLX-92]
- _ = x[IBS_OPDATA4-93]
- _ = x[IBS_OPFUSE-94]
- _ = x[IBS_PREVENTHOST-95]
- _ = x[IBS_ZEN4-96]
- _ = x[IDPRED_CTRL-97]
- _ = x[INT_WBINVD-98]
- _ = x[INVLPGB-99]
- _ = x[KEYLOCKER-100]
- _ = x[KEYLOCKERW-101]
- _ = x[LAHF-102]
- _ = x[LAM-103]
- _ = x[LBRVIRT-104]
- _ = x[LZCNT-105]
- _ = x[MCAOVERFLOW-106]
- _ = x[MCDT_NO-107]
- _ = x[MCOMMIT-108]
- _ = x[MD_CLEAR-109]
- _ = x[MMX-110]
- _ = x[MMXEXT-111]
- _ = x[MOVBE-112]
- _ = x[MOVDIR64B-113]
- _ = x[MOVDIRI-114]
- _ = x[MOVSB_ZL-115]
- _ = x[MOVU-116]
- _ = x[MPX-117]
- _ = x[MSRIRC-118]
- _ = x[MSRLIST-119]
- _ = x[MSR_PAGEFLUSH-120]
- _ = x[NRIPS-121]
- _ = x[NX-122]
- _ = x[OSXSAVE-123]
- _ = x[PCONFIG-124]
- _ = x[POPCNT-125]
- _ = x[PPIN-126]
- _ = x[PREFETCHI-127]
- _ = x[PSFD-128]
- _ = x[RDPRU-129]
- _ = x[RDRAND-130]
- _ = x[RDSEED-131]
- _ = x[RDTSCP-132]
- _ = x[RRSBA_CTRL-133]
- _ = x[RTM-134]
- _ = x[RTM_ALWAYS_ABORT-135]
- _ = x[SBPB-136]
- _ = x[SERIALIZE-137]
- _ = x[SEV-138]
- _ = x[SEV_64BIT-139]
- _ = x[SEV_ALTERNATIVE-140]
- _ = x[SEV_DEBUGSWAP-141]
- _ = x[SEV_ES-142]
- _ = x[SEV_RESTRICTED-143]
- _ = x[SEV_SNP-144]
- _ = x[SGX-145]
- _ = x[SGXLC-146]
- _ = x[SGXPQC-147]
- _ = x[SHA-148]
- _ = x[SME-149]
- _ = x[SME_COHERENT-150]
- _ = x[SM3_X86-151]
- _ = x[SM4_X86-152]
- _ = x[SPEC_CTRL_SSBD-153]
- _ = x[SRBDS_CTRL-154]
- _ = x[SRSO_MSR_FIX-155]
- _ = x[SRSO_NO-156]
- _ = x[SRSO_USER_KERNEL_NO-157]
- _ = x[SSE-158]
- _ = x[SSE2-159]
- _ = x[SSE3-160]
- _ = x[SSE4-161]
- _ = x[SSE42-162]
- _ = x[SSE4A-163]
- _ = x[SSSE3-164]
- _ = x[STIBP-165]
- _ = x[STIBP_ALWAYSON-166]
- _ = x[STOSB_SHORT-167]
- _ = x[SUCCOR-168]
- _ = x[SVM-169]
- _ = x[SVMDA-170]
- _ = x[SVMFBASID-171]
- _ = x[SVML-172]
- _ = x[SVMNP-173]
- _ = x[SVMPF-174]
- _ = x[SVMPFT-175]
- _ = x[SYSCALL-176]
- _ = x[SYSEE-177]
- _ = x[TBM-178]
- _ = x[TDX_GUEST-179]
- _ = x[TLB_FLUSH_NESTED-180]
- _ = x[TME-181]
- _ = x[TOPEXT-182]
- _ = x[TSA_L1_NO-183]
- _ = x[TSA_SQ_NO-184]
- _ = x[TSA_VERW_CLEAR-185]
- _ = x[TSCRATEMSR-186]
- _ = x[TSXLDTRK-187]
- _ = x[VAES-188]
- _ = x[VMCBCLEAN-189]
- _ = x[VMPL-190]
- _ = x[VMSA_REGPROT-191]
- _ = x[VMX-192]
- _ = x[VPCLMULQDQ-193]
- _ = x[VTE-194]
- _ = x[WAITPKG-195]
- _ = x[WBNOINVD-196]
- _ = x[WRMSRNS-197]
- _ = x[X87-198]
- _ = x[XGETBV1-199]
- _ = x[XOP-200]
- _ = x[XSAVE-201]
- _ = x[XSAVEC-202]
- _ = x[XSAVEOPT-203]
- _ = x[XSAVES-204]
- _ = x[AESARM-205]
- _ = x[ARMCPUID-206]
- _ = x[ASIMD-207]
- _ = x[ASIMDDP-208]
- _ = x[ASIMDHP-209]
- _ = x[ASIMDRDM-210]
- _ = x[ATOMICS-211]
- _ = x[CRC32-212]
- _ = x[DCPOP-213]
- _ = x[EVTSTRM-214]
- _ = x[FCMA-215]
- _ = x[FHM-216]
- _ = x[FP-217]
- _ = x[FPHP-218]
- _ = x[GPA-219]
- _ = x[JSCVT-220]
- _ = x[LRCPC-221]
- _ = x[PMULL-222]
- _ = x[RNDR-223]
- _ = x[TLB-224]
- _ = x[TS-225]
- _ = x[SHA1-226]
- _ = x[SHA2-227]
- _ = x[SHA3-228]
- _ = x[SHA512-229]
- _ = x[SM3-230]
- _ = x[SM4-231]
- _ = x[SVE-232]
- _ = x[PMU_FIXEDCOUNTER_CYCLES-233]
- _ = x[PMU_FIXEDCOUNTER_REFCYCLES-234]
- _ = x[PMU_FIXEDCOUNTER_INSTRUCTIONS-235]
- _ = x[PMU_FIXEDCOUNTER_TOPDOWN_SLOTS-236]
- _ = x[lastID-237]
- _ = x[firstID-0]
-}
-
-const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAMXTF32AMXCOMPLEXAMXTRANSPOSEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSGXPQCSHASMESME_COHERENTSM3_X86SM4_X86SPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSA_L1_NOTSA_SQ_NOTSA_VERW_CLEARTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFHMFPFPHPGPAJSCVTLRCPCPMULLRNDRTLBTSSHA1SHA2SHA3SHA512SM3SM4SVEPMU_FIXEDCOUNTER_CYCLESPMU_FIXEDCOUNTER_REFCYCLESPMU_FIXEDCOUNTER_INSTRUCTIONSPMU_FIXEDCOUNTER_TOPDOWN_SLOTSlastID"
-
-var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 75, 85, 97, 102, 105, 110, 119, 128, 137, 141, 151, 163, 171, 179, 187, 195, 202, 212, 222, 230, 240, 251, 259, 269, 287, 302, 309, 321, 328, 335, 346, 358, 366, 370, 374, 380, 385, 393, 398, 404, 408, 417, 435, 443, 450, 454, 458, 472, 478, 482, 486, 495, 499, 503, 508, 513, 517, 521, 528, 532, 535, 541, 544, 547, 557, 567, 580, 593, 597, 608, 612, 626, 643, 646, 656, 667, 673, 681, 692, 700, 712, 728, 742, 753, 763, 778, 786, 797, 807, 814, 823, 833, 837, 840, 847, 852, 863, 870, 877, 885, 888, 894, 899, 908, 915, 923, 927, 930, 936, 943, 956, 961, 963, 970, 977, 983, 987, 996, 1000, 1005, 1011, 1017, 1023, 1033, 1036, 1052, 1056, 1065, 1068, 1077, 1092, 1105, 1111, 1125, 1132, 1135, 1140, 1146, 1149, 1152, 1164, 1171, 1178, 1192, 1202, 1214, 1221, 1240, 1243, 1247, 1251, 1255, 1260, 1265, 1270, 1275, 1289, 1300, 1306, 1309, 1314, 1323, 1327, 1332, 1337, 1343, 1350, 1355, 1358, 1367, 1383, 1386, 1392, 1401, 1410, 1424, 1434, 1442, 1446, 1455, 1459, 1471, 1474, 1484, 1487, 1494, 1502, 1509, 1512, 1519, 1522, 1527, 1533, 1541, 1547, 1553, 1561, 1566, 1573, 1580, 1588, 1595, 1600, 1605, 1612, 1616, 1619, 1621, 1625, 1628, 1633, 1638, 1643, 1647, 1650, 1652, 1656, 1660, 1664, 1670, 1673, 1676, 1679, 1702, 1728, 1757, 1787, 1793}
-
-func (i FeatureID) String() string {
- if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
- return "FeatureID(" + strconv.FormatInt(int64(i), 10) + ")"
- }
- return _FeatureID_name[_FeatureID_index[i]:_FeatureID_index[i+1]]
-}
-func _() {
- // An "invalid array index" compiler error signifies that the constant values have changed.
- // Re-run the stringer command to generate them again.
- var x [1]struct{}
- _ = x[VendorUnknown-0]
- _ = x[Intel-1]
- _ = x[AMD-2]
- _ = x[VIA-3]
- _ = x[Transmeta-4]
- _ = x[NSC-5]
- _ = x[KVM-6]
- _ = x[MSVM-7]
- _ = x[VMware-8]
- _ = x[XenHVM-9]
- _ = x[Bhyve-10]
- _ = x[Hygon-11]
- _ = x[SiS-12]
- _ = x[RDC-13]
- _ = x[Ampere-14]
- _ = x[ARM-15]
- _ = x[Broadcom-16]
- _ = x[Cavium-17]
- _ = x[DEC-18]
- _ = x[Fujitsu-19]
- _ = x[Infineon-20]
- _ = x[Motorola-21]
- _ = x[NVIDIA-22]
- _ = x[AMCC-23]
- _ = x[Qualcomm-24]
- _ = x[Marvell-25]
- _ = x[QEMU-26]
- _ = x[QNX-27]
- _ = x[ACRN-28]
- _ = x[SRE-29]
- _ = x[Apple-30]
- _ = x[lastVendor-31]
-}
-
-const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvellQEMUQNXACRNSREApplelastVendor"
-
-var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 149, 152, 156, 159, 164, 174}
-
-func (i Vendor) String() string {
- if i < 0 || i >= Vendor(len(_Vendor_index)-1) {
- return "Vendor(" + strconv.FormatInt(int64(i), 10) + ")"
- }
- return _Vendor_name[_Vendor_index[i]:_Vendor_index[i+1]]
-}
diff --git a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go
deleted file mode 100644
index da07522e7..000000000
--- a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go
+++ /dev/null
@@ -1,129 +0,0 @@
-// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file.
-
-package cpuid
-
-import (
- "runtime"
- "strings"
-
- "golang.org/x/sys/unix"
-)
-
-func detectOS(c *CPUInfo) bool {
- if runtime.GOOS != "ios" {
- tryToFillCPUInfoFomSysctl(c)
- }
- // There are no hw.optional sysctl values for the below features on Mac OS 11.0
- // to detect their supported state dynamically. Assume the CPU features that
- // Apple Silicon M1 supports to be available as a minimal set of features
- // to all Go programs running on darwin/arm64.
- // TODO: Add more if we know them.
- c.featureSet.setIf(runtime.GOOS != "ios", AESARM, PMULL, SHA1, SHA2)
-
- return true
-}
-
-func sysctlGetBool(name string) bool {
- value, err := unix.SysctlUint32(name)
- if err != nil {
- return false
- }
- return value != 0
-}
-
-func sysctlGetString(name string) string {
- value, err := unix.Sysctl(name)
- if err != nil {
- return ""
- }
- return value
-}
-
-func sysctlGetInt(unknown int, names ...string) int {
- for _, name := range names {
- value, err := unix.SysctlUint32(name)
- if err != nil {
- continue
- }
- if value != 0 {
- return int(value)
- }
- }
- return unknown
-}
-
-func sysctlGetInt64(unknown int, names ...string) int {
- for _, name := range names {
- value64, err := unix.SysctlUint64(name)
- if err != nil {
- continue
- }
- if int(value64) != unknown {
- return int(value64)
- }
- }
- return unknown
-}
-
-func setFeature(c *CPUInfo, feature FeatureID, aliases ...string) {
- for _, alias := range aliases {
- set := sysctlGetBool(alias)
- c.featureSet.setIf(set, feature)
- if set {
- break
- }
- }
-}
-
-func tryToFillCPUInfoFomSysctl(c *CPUInfo) {
- c.BrandName = sysctlGetString("machdep.cpu.brand_string")
-
- if len(c.BrandName) != 0 {
- c.VendorString = strings.Fields(c.BrandName)[0]
- }
-
- c.PhysicalCores = sysctlGetInt(runtime.NumCPU(), "hw.physicalcpu")
- c.ThreadsPerCore = sysctlGetInt(1, "machdep.cpu.thread_count", "kern.num_threads") /
- sysctlGetInt(1, "hw.physicalcpu")
- c.LogicalCores = sysctlGetInt(runtime.NumCPU(), "machdep.cpu.core_count")
- c.Family = sysctlGetInt(0, "machdep.cpu.family", "hw.cpufamily")
- c.Model = sysctlGetInt(0, "machdep.cpu.model")
- c.CacheLine = sysctlGetInt64(0, "hw.cachelinesize")
- c.Cache.L1I = sysctlGetInt64(-1, "hw.l1icachesize")
- c.Cache.L1D = sysctlGetInt64(-1, "hw.l1dcachesize")
- c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize")
- c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize")
-
- // ARM features:
- //
- // Note: On some Apple Silicon system, some feats have aliases. See:
- // https://developer.apple.com/documentation/kernel/1387446-sysctlbyname/determining_instruction_set_characteristics
- // When so, we look at all aliases and consider a feature available when at least one identifier matches.
- setFeature(c, AESARM, "hw.optional.arm.FEAT_AES") // AES instructions
- setFeature(c, ASIMD, "hw.optional.arm.AdvSIMD", "hw.optional.neon") // Advanced SIMD
- setFeature(c, ASIMDDP, "hw.optional.arm.FEAT_DotProd") // SIMD Dot Product
- setFeature(c, ASIMDHP, "hw.optional.arm.AdvSIMD_HPFPCvt", "hw.optional.neon_hpfp") // Advanced SIMD half-precision floating point
- setFeature(c, ASIMDRDM, "hw.optional.arm.FEAT_RDM") // Rounding Double Multiply Accumulate/Subtract
- setFeature(c, ATOMICS, "hw.optional.arm.FEAT_LSE", "hw.optional.armv8_1_atomics") // Large System Extensions (LSE)
- setFeature(c, CRC32, "hw.optional.arm.FEAT_CRC32", "hw.optional.armv8_crc32") // CRC32/CRC32C instructions
- setFeature(c, DCPOP, "hw.optional.arm.FEAT_DPB") // Data cache clean to Point of Persistence (DC CVAP)
- setFeature(c, EVTSTRM, "hw.optional.arm.FEAT_ECV") // Generic timer
- setFeature(c, FCMA, "hw.optional.arm.FEAT_FCMA", "hw.optional.armv8_3_compnum") // Floating point complex number addition and multiplication
- setFeature(c, FHM, "hw.optional.armv8_2_fhm", "hw.optional.arm.FEAT_FHM") // FMLAL and FMLSL instructions
- setFeature(c, FP, "hw.optional.floatingpoint") // Single-precision and double-precision floating point
- setFeature(c, FPHP, "hw.optional.arm.FEAT_FP16", "hw.optional.neon_fp16") // Half-precision floating point
- setFeature(c, GPA, "hw.optional.arm.FEAT_PAuth") // Generic Pointer Authentication
- setFeature(c, JSCVT, "hw.optional.arm.FEAT_JSCVT") // Javascript-style double->int convert (FJCVTZS)
- setFeature(c, LRCPC, "hw.optional.arm.FEAT_LRCPC") // Weaker release consistency (LDAPR, etc)
- setFeature(c, PMULL, "hw.optional.arm.FEAT_PMULL") // Polynomial Multiply instructions (PMULL/PMULL2)
- setFeature(c, RNDR, "hw.optional.arm.FEAT_RNG") // Random Number instructions
- setFeature(c, TLB, "hw.optional.arm.FEAT_TLBIOS", "hw.optional.arm.FEAT_TLBIRANGE") // Outer Shareable and TLB range maintenance instructions
- setFeature(c, TS, "hw.optional.arm.FEAT_FlagM", "hw.optional.arm.FEAT_FlagM2") // Flag manipulation instructions
- setFeature(c, SHA1, "hw.optional.arm.FEAT_SHA1") // SHA-1 instructions (SHA1C, etc)
- setFeature(c, SHA2, "hw.optional.arm.FEAT_SHA256") // SHA-2 instructions (SHA256H, etc)
- setFeature(c, SHA3, "hw.optional.arm.FEAT_SHA3") // SHA-3 instructions (EOR3, RAXI, XAR, BCAX)
- setFeature(c, SHA512, "hw.optional.arm.FEAT_SHA512") // SHA512 instructions
- setFeature(c, SM3, "hw.optional.arm.FEAT_SM3") // SM3 instructions
- setFeature(c, SM4, "hw.optional.arm.FEAT_SM4") // SM4 instructions
- setFeature(c, SVE, "hw.optional.arm.FEAT_SVE") // Scalable Vector Extension
-}
diff --git a/vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go
deleted file mode 100644
index d96d24438..000000000
--- a/vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go
+++ /dev/null
@@ -1,208 +0,0 @@
-// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file.
-
-// Copyright 2018 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file located
-// here https://github.com/golang/sys/blob/master/LICENSE
-
-package cpuid
-
-import (
- "encoding/binary"
- "io/ioutil"
- "runtime"
-)
-
-// HWCAP bits.
-const (
- hwcap_FP = 1 << 0
- hwcap_ASIMD = 1 << 1
- hwcap_EVTSTRM = 1 << 2
- hwcap_AES = 1 << 3
- hwcap_PMULL = 1 << 4
- hwcap_SHA1 = 1 << 5
- hwcap_SHA2 = 1 << 6
- hwcap_CRC32 = 1 << 7
- hwcap_ATOMICS = 1 << 8
- hwcap_FPHP = 1 << 9
- hwcap_ASIMDHP = 1 << 10
- hwcap_CPUID = 1 << 11
- hwcap_ASIMDRDM = 1 << 12
- hwcap_JSCVT = 1 << 13
- hwcap_FCMA = 1 << 14
- hwcap_LRCPC = 1 << 15
- hwcap_DCPOP = 1 << 16
- hwcap_SHA3 = 1 << 17
- hwcap_SM3 = 1 << 18
- hwcap_SM4 = 1 << 19
- hwcap_ASIMDDP = 1 << 20
- hwcap_SHA512 = 1 << 21
- hwcap_SVE = 1 << 22
- hwcap_ASIMDFHM = 1 << 23
- hwcap_DIT = 1 << 24
- hwcap_USCAT = 1 << 25
- hwcap_ILRCPC = 1 << 26
- hwcap_FLAGM = 1 << 27
- hwcap_SSBS = 1 << 28
- hwcap_SB = 1 << 29
- hwcap_PACA = 1 << 30
- hwcap_PACG = 1 << 31
- hwcap_GCS = 1 << 32
-
- hwcap2_DCPODP = 1 << 0
- hwcap2_SVE2 = 1 << 1
- hwcap2_SVEAES = 1 << 2
- hwcap2_SVEPMULL = 1 << 3
- hwcap2_SVEBITPERM = 1 << 4
- hwcap2_SVESHA3 = 1 << 5
- hwcap2_SVESM4 = 1 << 6
- hwcap2_FLAGM2 = 1 << 7
- hwcap2_FRINT = 1 << 8
- hwcap2_SVEI8MM = 1 << 9
- hwcap2_SVEF32MM = 1 << 10
- hwcap2_SVEF64MM = 1 << 11
- hwcap2_SVEBF16 = 1 << 12
- hwcap2_I8MM = 1 << 13
- hwcap2_BF16 = 1 << 14
- hwcap2_DGH = 1 << 15
- hwcap2_RNG = 1 << 16
- hwcap2_BTI = 1 << 17
- hwcap2_MTE = 1 << 18
- hwcap2_ECV = 1 << 19
- hwcap2_AFP = 1 << 20
- hwcap2_RPRES = 1 << 21
- hwcap2_MTE3 = 1 << 22
- hwcap2_SME = 1 << 23
- hwcap2_SME_I16I64 = 1 << 24
- hwcap2_SME_F64F64 = 1 << 25
- hwcap2_SME_I8I32 = 1 << 26
- hwcap2_SME_F16F32 = 1 << 27
- hwcap2_SME_B16F32 = 1 << 28
- hwcap2_SME_F32F32 = 1 << 29
- hwcap2_SME_FA64 = 1 << 30
- hwcap2_WFXT = 1 << 31
- hwcap2_EBF16 = 1 << 32
- hwcap2_SVE_EBF16 = 1 << 33
- hwcap2_CSSC = 1 << 34
- hwcap2_RPRFM = 1 << 35
- hwcap2_SVE2P1 = 1 << 36
- hwcap2_SME2 = 1 << 37
- hwcap2_SME2P1 = 1 << 38
- hwcap2_SME_I16I32 = 1 << 39
- hwcap2_SME_BI32I32 = 1 << 40
- hwcap2_SME_B16B16 = 1 << 41
- hwcap2_SME_F16F16 = 1 << 42
- hwcap2_MOPS = 1 << 43
- hwcap2_HBC = 1 << 44
- hwcap2_SVE_B16B16 = 1 << 45
- hwcap2_LRCPC3 = 1 << 46
- hwcap2_LSE128 = 1 << 47
- hwcap2_FPMR = 1 << 48
- hwcap2_LUT = 1 << 49
- hwcap2_FAMINMAX = 1 << 50
- hwcap2_F8CVT = 1 << 51
- hwcap2_F8FMA = 1 << 52
- hwcap2_F8DP4 = 1 << 53
- hwcap2_F8DP2 = 1 << 54
- hwcap2_F8E4M3 = 1 << 55
- hwcap2_F8E5M2 = 1 << 56
- hwcap2_SME_LUTV2 = 1 << 57
- hwcap2_SME_F8F16 = 1 << 58
- hwcap2_SME_F8F32 = 1 << 59
- hwcap2_SME_SF8FMA = 1 << 60
- hwcap2_SME_SF8DP4 = 1 << 61
- hwcap2_SME_SF8DP2 = 1 << 62
- hwcap2_POE = 1 << 63
-)
-
-func detectOS(c *CPUInfo) bool {
- // For now assuming no hyperthreading is reasonable.
- c.LogicalCores = runtime.NumCPU()
- c.PhysicalCores = c.LogicalCores
- c.ThreadsPerCore = 1
- if hwcap == 0 {
- // We did not get values from the runtime.
- // Try reading /proc/self/auxv
-
- // From https://github.com/golang/sys
- const (
- _AT_HWCAP = 16
- _AT_HWCAP2 = 26
-
- uintSize = int(32 << (^uint(0) >> 63))
- )
-
- buf, err := ioutil.ReadFile("/proc/self/auxv")
- if err != nil {
- // e.g. on android /proc/self/auxv is not accessible, so silently
- // ignore the error and leave Initialized = false. On some
- // architectures (e.g. arm64) doinit() implements a fallback
- // readout and will set Initialized = true again.
- return false
- }
- bo := binary.LittleEndian
- for len(buf) >= 2*(uintSize/8) {
- var tag, val uint
- switch uintSize {
- case 32:
- tag = uint(bo.Uint32(buf[0:]))
- val = uint(bo.Uint32(buf[4:]))
- buf = buf[8:]
- case 64:
- tag = uint(bo.Uint64(buf[0:]))
- val = uint(bo.Uint64(buf[8:]))
- buf = buf[16:]
- }
- switch tag {
- case _AT_HWCAP:
- hwcap = val
- case _AT_HWCAP2:
- // Not used
- }
- }
- if hwcap == 0 {
- return false
- }
- }
-
- // HWCap was populated by the runtime from the auxiliary vector.
- // Use HWCap information since reading aarch64 system registers
- // is not supported in user space on older linux kernels.
- c.featureSet.setIf(isSet(hwcap, hwcap_AES), AESARM)
- c.featureSet.setIf(isSet(hwcap, hwcap_ASIMD), ASIMD)
- c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDDP), ASIMDDP)
- c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDHP), ASIMDHP)
- c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDRDM), ASIMDRDM)
- c.featureSet.setIf(isSet(hwcap, hwcap_CPUID), ARMCPUID)
- c.featureSet.setIf(isSet(hwcap, hwcap_CRC32), CRC32)
- c.featureSet.setIf(isSet(hwcap, hwcap_DCPOP), DCPOP)
- c.featureSet.setIf(isSet(hwcap, hwcap_EVTSTRM), EVTSTRM)
- c.featureSet.setIf(isSet(hwcap, hwcap_FCMA), FCMA)
- c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDFHM), FHM)
- c.featureSet.setIf(isSet(hwcap, hwcap_FP), FP)
- c.featureSet.setIf(isSet(hwcap, hwcap_FPHP), FPHP)
- c.featureSet.setIf(isSet(hwcap, hwcap_JSCVT), JSCVT)
- c.featureSet.setIf(isSet(hwcap, hwcap_LRCPC), LRCPC)
- c.featureSet.setIf(isSet(hwcap, hwcap_PMULL), PMULL)
- c.featureSet.setIf(isSet(hwcap, hwcap2_RNG), RNDR)
- // c.featureSet.setIf(isSet(hwcap, hwcap_), TLB)
- // c.featureSet.setIf(isSet(hwcap, hwcap_), TS)
- c.featureSet.setIf(isSet(hwcap, hwcap_SHA1), SHA1)
- c.featureSet.setIf(isSet(hwcap, hwcap_SHA2), SHA2)
- c.featureSet.setIf(isSet(hwcap, hwcap_SHA3), SHA3)
- c.featureSet.setIf(isSet(hwcap, hwcap_SHA512), SHA512)
- c.featureSet.setIf(isSet(hwcap, hwcap_SM3), SM3)
- c.featureSet.setIf(isSet(hwcap, hwcap_SM4), SM4)
- c.featureSet.setIf(isSet(hwcap, hwcap_SVE), SVE)
-
- // The Samsung S9+ kernel reports support for atomics, but not all cores
- // actually support them, resulting in SIGILL. See issue #28431.
- // TODO(elias.naur): Only disable the optimization on bad chipsets on android.
- c.featureSet.setIf(isSet(hwcap, hwcap_ATOMICS) && runtime.GOOS != "android", ATOMICS)
-
- return true
-}
-
-func isSet(hwc uint, value uint) bool {
- return hwc&value != 0
-}
diff --git a/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go
deleted file mode 100644
index 8733ba343..000000000
--- a/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go
+++ /dev/null
@@ -1,16 +0,0 @@
-// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file.
-
-//go:build arm64 && !linux && !darwin
-// +build arm64,!linux,!darwin
-
-package cpuid
-
-import "runtime"
-
-func detectOS(c *CPUInfo) bool {
- c.PhysicalCores = runtime.NumCPU()
- // For now assuming 1 thread per core...
- c.ThreadsPerCore = 1
- c.LogicalCores = c.PhysicalCores
- return false
-}
diff --git a/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go
deleted file mode 100644
index f8f201b5f..000000000
--- a/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go
+++ /dev/null
@@ -1,8 +0,0 @@
-// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file.
-
-//go:build nounsafe
-// +build nounsafe
-
-package cpuid
-
-var hwcap uint
diff --git a/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go
deleted file mode 100644
index 92af622eb..000000000
--- a/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go
+++ /dev/null
@@ -1,11 +0,0 @@
-// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file.
-
-//go:build !nounsafe
-// +build !nounsafe
-
-package cpuid
-
-import _ "unsafe" // needed for go:linkname
-
-//go:linkname hwcap internal/cpu.HWCap
-var hwcap uint
diff --git a/vendor/github.com/klauspost/cpuid/v2/test-architectures.sh b/vendor/github.com/klauspost/cpuid/v2/test-architectures.sh
deleted file mode 100644
index 471d986d2..000000000
--- a/vendor/github.com/klauspost/cpuid/v2/test-architectures.sh
+++ /dev/null
@@ -1,15 +0,0 @@
-#!/bin/sh
-
-set -e
-
-go tool dist list | while IFS=/ read os arch; do
- echo "Checking $os/$arch..."
- echo " normal"
- GOARCH=$arch GOOS=$os go build -o /dev/null .
- echo " noasm"
- GOARCH=$arch GOOS=$os go build -tags noasm -o /dev/null .
- echo " appengine"
- GOARCH=$arch GOOS=$os go build -tags appengine -o /dev/null .
- echo " noasm,appengine"
- GOARCH=$arch GOOS=$os go build -tags 'appengine noasm' -o /dev/null .
-done